PFRMAT RR
TARGET T0405
AUTHOR 4008-1775-0004
REMARK From group SAM-TO6 under the direction of
REMARK Kevin Karplus.
REMARK Residue-residue contact predictions
REMARK  by George Shackelford and Kevin Karplus
REMARK The value given is an approximation of the probability
REMARK as provided by the neural network.
REMARK The predictions are limited to a score >= .18 which
REMARK is an approximation of the probability.
REMARK
METHOD The predictor is an artificial neural network.
METHOD NN: con.aa5str2_5near5nsep5.entmi_epplccrr.th62.17.730_47.net
METHOD Inputs may include separation and sequence length,
METHOD e-value statistic based on mutual information values,
METHOD a statistic based on propensity of residues in contact.
METHOD Other inputs are distributions from alignments and
METHOD secondary predictions from SAM-t04 and/or SAM-t06 of
METHOD the University of California, Santa Cruz
MODEL 1
MNETEKLVAALLERNFGKNIGTRYPGNEAAQMRAEEVIGEIAIVIAPLVE
KLGIENKTVKKTIPFLYELQKNQFCDMSAYPYPLLLVNGTSTDTEKYWRD
LPTYWTDDANKIVLPYVLEHIKNNKVRQKLLAFHAWLLGEVVEMNEALGA
DFRVKLVFESDMRIRLRVYEVEQIAIEVHFLDNHDTEQQHLGYDVSLDAD
FTEKARLLLRQGILTENLGLEALKAYMKSVLPIAHSLKNLEHLTFEETKK
LTKLLTQEEPKIMEDTDLTSKALDFLQKAAQQ
213 222 0 8 0.272628
213 223 0 8 0.278224
213 225 0 8 0.167547
213 226 0 8 0.211294
213 227 0 8 0.218789
213 230 0 8 0.211732
213 231 0 8 0.200403
213 233 0 8 0.269633
213 234 0 8 0.188649
213 237 0 8 0.20131
213 240 0 8 0.255029
213 243 0 8 0.239956
213 251 0 8 0.25858
214 223 0 8 0.345656
214 224 0 8 0.177724
214 225 0 8 0.206048
214 226 0 8 0.249337
214 227 0 8 0.238163
214 230 0 8 0.304315
214 231 0 8 0.234577
214 233 0 8 0.351692
214 234 0 8 0.201646
214 235 0 8 0.17212
214 237 0 8 0.234735
214 240 0 8 0.289036
214 243 0 8 0.270499
214 251 0 8 0.28711
214 254 0 8 0.415886
216 225 0 8 0.105326
216 226 0 8 0.129766
216 227 0 8 0.131571
216 230 0 8 0.116606
216 233 0 8 0.131776
216 237 0 8 0.14556
216 240 0 8 0.188327
216 243 0 8 0.210528
216 251 0 8 0.235188
218 227 0 8 0.163262
218 230 0 8 0.212299
218 231 0 8 0.188387
218 233 0 8 0.275202
218 237 0 8 0.229599
218 240 0 8 0.281649
218 243 0 8 0.265294
218 251 0 8 0.295508
220 229 0 8 0.131105
220 230 0 8 0.269877
220 231 0 8 0.25122
220 233 0 8 0.351743
220 234 0 8 0.295498
220 235 0 8 0.249267
220 237 0 8 0.374218
220 240 0 8 0.367144
220 243 0 8 0.339121
220 251 0 8 0.364638
220 254 0 8 0.230828
220 255 0 8 0.243206
222 231 0 8 0.214022
222 233 0 8 0.274474
222 234 0 8 0.291423
222 237 0 8 0.31424
222 240 0 8 0.38851
222 243 0 8 0.357543
222 251 0 8 0.391026
223 232 0 8 0.176435
223 233 0 8 0.392458
223 234 0 8 0.352287
223 235 0 8 0.292441
223 237 0 8 0.395492
223 240 0 8 0.452629
223 243 0 8 0.405513
223 251 0 8 0.412713
223 254 0 8 0.298029
223 255 0 8 0.289559
224 233 0 8 0.208037
224 234 0 8 0.241214
224 237 0 8 0.26573
224 240 0 8 0.365648
224 243 0 8 0.259809
224 251 0 8 0.301771
224 254 0 8 0.16463
225 237 0 8 0.180625
225 240 0 8 0.270654
225 243 0 8 0.24282
225 251 0 8 0.284337
226 237 0 8 0.229461
226 240 0 8 0.323801
226 243 0 8 0.302205
226 251 0 8 0.338251
227 237 0 8 0.279838
227 240 0 8 0.369614
227 243 0 8 0.357417
227 251 0 8 0.360093
227 254 0 8 0.252463
227 255 0 8 0.24259
228 237 0 8 0.154286
228 240 0 8 0.243229
228 243 0 8 0.206571
228 251 0 8 0.267793
228 254 0 8 0.131719
229 251 0 8 0.22442
230 240 0 8 0.390997
230 243 0 8 0.370275
230 251 0 8 0.387817
230 254 0 8 0.292013
231 240 0 8 0.34097
231 243 0 8 0.287772
231 251 0 8 0.341853
231 254 0 8 0.223874
231 255 0 8 0.232912
232 243 0 8 0.217648
232 251 0 8 0.272679
233 242 0 8 0.106693
233 243 0 8 0.399718
233 248 0 8 0.234683
233 251 0 8 0.412928
233 254 0 8 0.354536
233 255 0 8 0.313447
234 243 0 8 0.304183
234 248 0 8 0.252761
234 251 0 8 0.318041
234 254 0 8 0.212324
234 255 0 8 0.199541
235 248 0 8 0.206303
235 251 0 8 0.265168
235 254 0 8 0.145755
235 255 0 8 0.159167
237 247 0 8 0.186372
237 248 0 8 0.244221
237 249 0 8 0.177633
237 251 0 8 0.340638
237 254 0 8 0.232083
237 255 0 8 0.21283
240 249 0 8 0.18427
240 251 0 8 0.34974
240 254 0 8 0.245313
240 255 0 8 0.238339
243 254 0 8 0.258478
243 255 0 8 0.248904
251 260 0 8 0.228776
END