# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0354/ # command:# Making conformation for sequence T0354 numbered 1 through 130 Created new target T0354 from T0354.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0354/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0354//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0354/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0354//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0354/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0354/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0354/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gfgA expands to /projects/compbio/data/pdb/2gfg.pdb.gz 2gfgA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 764, because occupancy 0.5 <= existing 0.500 in 2gfgA Skipped atom 768, because occupancy 0.500 <= existing 0.500 in 2gfgA Skipped atom 770, because occupancy 0.500 <= existing 0.500 in 2gfgA Skipped atom 772, because occupancy 0.500 <= existing 0.500 in 2gfgA Skipped atom 774, because occupancy 0.500 <= existing 0.500 in 2gfgA Skipped atom 776, because occupancy 0.500 <= existing 0.500 in 2gfgA Skipped atom 778, because occupancy 0.500 <= existing 0.500 in 2gfgA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0354 read from 2gfgA/merged-good-all-a2m # 2gfgA read from 2gfgA/merged-good-all-a2m # adding 2gfgA to template set # found chain 2gfgA in template set T0354 10 :AIEALEDIKG 2gfgA 101 :VMDALRDLSI # choosing archetypes in rotamer library T0354 26 :DTSKL 2gfgA 111 :PISQL T0354 32 :SLFQRMIVATGDSNRQVKALANSVQV 2gfgA 144 :GIEDYEIEFEGTSEEHATVTFQEILK T0354 61 :EAGVDIVGSE 2gfgA 170 :TFSISQVPTE Number of specific fragments extracted= 4 number of extra gaps= 0 total=4 Number of alignments=1 # 2gfgA read from 2gfgA/merged-good-all-a2m # found chain 2gfgA in template set T0354 9 :LAIEALEDIKG 2gfgA 100 :EVMDALRDLSI T0354 26 :DTSK 2gfgA 111 :PISQ T0354 30 :LTSLFQRMIVATGDSNRQVKALANSVQV 2gfgA 142 :YLGIEDYEIEFEGTSEEHATVTFQEILK T0354 61 :EAGVDIVGS 2gfgA 170 :TFSISQVPT Number of specific fragments extracted= 4 number of extra gaps= 0 total=8 Number of alignments=2 # 2gfgA read from 2gfgA/merged-good-all-a2m # found chain 2gfgA in template set T0354 10 :AIEALEDI 2gfgA 101 :VMDALRDL T0354 18 :KGKDI 2gfgA 114 :QLKHI T0354 23 :IELDTSKL 2gfgA 126 :AEISYEQG T0354 31 :TSLFQRMIVATGDSNRQVKALANSVQV 2gfgA 143 :LGIEDYEIEFEGTSEEHATVTFQEILK T0354 61 :EAGVDIVGSEG 2gfgA 170 :TFSISQVPTEN Number of specific fragments extracted= 5 number of extra gaps= 0 total=13 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vljA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0354 read from 1vljA/merged-good-all-a2m # 1vljA read from 1vljA/merged-good-all-a2m # found chain 1vljA in training set T0354 10 :AIEALEDIKGKDI 1vljA 22 :IGEEIKNAGIRKV T0354 37 :MIVATGDS 1vljA 35 :LFLYGGGS T0354 48 :VKA 1vljA 43 :IKK T0354 51 :LANSVQVKLKEAGVDIVGSEGH 1vljA 48 :VYDQVVDSLKKHGIEWVEVSGV T0354 73 :ESGEWVLVDA 1vljA 157 :KTKEKYGVSS Number of specific fragments extracted= 5 number of extra gaps= 0 total=18 Number of alignments=4 # 1vljA read from 1vljA/merged-good-all-a2m # found chain 1vljA in training set T0354 10 :AIEALEDIKGKDIIELDTSKL 1vljA 22 :IGEEIKNAGIRKVLFLYGGGS T0354 48 :VKA 1vljA 43 :IKK T0354 51 :LANSVQVKLKEAGVDIVGSEG 1vljA 48 :VYDQVVDSLKKHGIEWVEVSG Number of specific fragments extracted= 3 number of extra gaps= 0 total=21 Number of alignments=5 # 1vljA read from 1vljA/merged-good-all-a2m # found chain 1vljA in training set T0354 10 :AIEALEDIKGKDI 1vljA 22 :IGEEIKNAGIRKV T0354 37 :MIVATGD 1vljA 35 :LFLYGGG T0354 47 :QVKA 1vljA 42 :SIKK T0354 51 :LANSVQVKLKEAGVDIVGSEGHESG 1vljA 48 :VYDQVVDSLKKHGIEWVEVSGVKPN Number of specific fragments extracted= 4 number of extra gaps= 0 total=25 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jdqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jdqA expands to /projects/compbio/data/pdb/1jdq.pdb.gz 1jdqA:# T0354 read from 1jdqA/merged-good-all-a2m # 1jdqA read from 1jdqA/merged-good-all-a2m # adding 1jdqA to template set # found chain 1jdqA in template set T0354 6 :ISKLAIE 1jdqA 42 :ETKRALQ T0354 16 :DIKGKDIIELDTSKLT 1jdqA 49 :NMKPGEILEVWIDYPM T0354 52 :ANSVQVKL 1jdqA 65 :SKERIPET T0354 60 :KEAGVDIVGSEGHESGEWVLV 1jdqA 74 :KKLGHEVLEIEEVGPSEWKIY Number of specific fragments extracted= 4 number of extra gaps= 0 total=29 Number of alignments=7 # 1jdqA read from 1jdqA/merged-good-all-a2m # found chain 1jdqA in template set T0354 5 :EISKLAIEALEDIKGKDIIELDTSKLT 1jdqA 38 :VPDVETKRALQNMKPGEILEVWIDYPM T0354 52 :ANSVQVKL 1jdqA 65 :SKERIPET T0354 60 :KEAGVDIVGSEGHESGEWVLV 1jdqA 74 :KKLGHEVLEIEEVGPSEWKIY Number of specific fragments extracted= 3 number of extra gaps= 0 total=32 Number of alignments=8 # 1jdqA read from 1jdqA/merged-good-all-a2m # found chain 1jdqA in template set T0354 4 :QEISKL 1jdqA 40 :DVETKR T0354 13 :ALEDIKGKDIIELDTSKLT 1jdqA 46 :ALQNMKPGEILEVWIDYPM T0354 52 :ANSVQVKL 1jdqA 65 :SKERIPET T0354 60 :KEAGVDIVGSEGHESGEWVLV 1jdqA 74 :KKLGHEVLEIEEVGPSEWKIY Number of specific fragments extracted= 4 number of extra gaps= 0 total=36 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wy7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wy7A expands to /projects/compbio/data/pdb/1wy7.pdb.gz 1wy7A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0354 read from 1wy7A/merged-good-all-a2m # 1wy7A read from 1wy7A/merged-good-all-a2m # adding 1wy7A to template set # found chain 1wy7A in template set T0354 4 :QEISKLAIEALEDIKGK 1wy7A 82 :KEAVDVLIENLGEFKGK T0354 21 :DIIELDTSKLTSLFQRMIVATGDS 1wy7A 100 :KVFIGDVSEFNSRVDIVIMNPPFG T0354 45 :NRQVKALA 1wy7A 131 :RPFLLKAF T0354 53 :NSVQVKLKEAGVDIVGSEGH 1wy7A 156 :RFIEKFSWEHGFVVTHRLTT T0354 73 :ESGEWVLVDA 1wy7A 191 :ERITVDIYRF Number of specific fragments extracted= 5 number of extra gaps= 0 total=41 Number of alignments=10 # 1wy7A read from 1wy7A/merged-good-all-a2m # found chain 1wy7A in template set T0354 3 :IQEISKLAIEALEDIKGK 1wy7A 81 :DKEAVDVLIENLGEFKGK T0354 21 :DIIELDTSKLTSLFQRMIVATGDSN 1wy7A 100 :KVFIGDVSEFNSRVDIVIMNPPFGS T0354 46 :RQVKALA 1wy7A 132 :PFLLKAF T0354 53 :NSVQVKLKEAGVDIVGSEG 1wy7A 156 :RFIEKFSWEHGFVVTHRLT T0354 72 :HESGEWVLVDA 1wy7A 190 :LERITVDIYRF Number of specific fragments extracted= 5 number of extra gaps= 0 total=46 Number of alignments=11 # 1wy7A read from 1wy7A/merged-good-all-a2m # found chain 1wy7A in template set T0354 4 :QEISKLAIEALEDIKGK 1wy7A 82 :KEAVDVLIENLGEFKGK T0354 21 :DIIELDTSKLTSLFQRMIVATGDSN 1wy7A 100 :KVFIGDVSEFNSRVDIVIMNPPFGS T0354 53 :NSVQVKLKEA 1wy7A 131 :RPFLLKAFEI T0354 76 :E 1wy7A 142 :D T0354 78 :VL 1wy7A 143 :VV T0354 85 :VVVHVMLPAVRDYYD 1wy7A 145 :YSIHLAKPEVRRFIE T0354 102 :A 1wy7A 160 :K Number of specific fragments extracted= 7 number of extra gaps= 0 total=53 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1usgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0354 read from 1usgA/merged-good-all-a2m # 1usgA read from 1usgA/merged-good-all-a2m # found chain 1usgA in training set T0354 6 :ISKLAIEALEDI 1usgA 124 :QGPTAAKYILET T0354 18 :KGKDIIELDTSK 1usgA 137 :KPQRIAIIHDKQ T0354 46 :RQVKALANSVQVKLKEAGVDIVGSEGHESGE 1usgA 149 :QYGEGLARSVQDGLKAANANVVFFDGITAGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=56 Number of alignments=13 # 1usgA read from 1usgA/merged-good-all-a2m # found chain 1usgA in training set T0354 6 :ISKLAIEAL 1usgA 124 :QGPTAAKYI T0354 15 :EDIKGKDIIELDTSK 1usgA 134 :ETVKPQRIAIIHDKQ T0354 46 :RQVKALANSVQVKLKEAGVDIVGSEGHESG 1usgA 149 :QYGEGLARSVQDGLKAANANVVFFDGITAG Number of specific fragments extracted= 3 number of extra gaps= 0 total=59 Number of alignments=14 # 1usgA read from 1usgA/merged-good-all-a2m # found chain 1usgA in training set T0354 6 :ISKLAIEAL 1usgA 124 :QGPTAAKYI T0354 15 :EDIKGKDI 1usgA 134 :ETVKPQRI T0354 38 :IVATGDSNRQ 1usgA 142 :AIIHDKQQYG T0354 49 :KALANSVQVKLKEAGVDIVGSEGHESGE 1usgA 152 :EGLARSVQDGLKAANANVVFFDGITAGE Number of specific fragments extracted= 4 number of extra gaps= 0 total=63 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tqjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0354 read from 1tqjA/merged-good-all-a2m # 1tqjA read from 1tqjA/merged-good-all-a2m # found chain 1tqjA in training set Warning: unaligning (T0354)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tqjA)N144 Warning: unaligning (T0354)D43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tqjA)N144 Warning: unaligning (T0354)S44 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1tqjA)Q150 T0354 8 :KLAIEALEDIKGKDIIELD 1tqjA 102 :HRTLCQIRELGKKAGAVLN T0354 27 :TSKLTSLFQRMIVAT 1tqjA 128 :LEYVLPVCDLILIMS T0354 48 :VKALANSVQVKLKEAGVDIV 1tqjA 156 :VLPKIRALRQMCDERGLDPW T0354 85 :VVV 1tqjA 176 :IEV Number of specific fragments extracted= 4 number of extra gaps= 1 total=67 Number of alignments=16 # 1tqjA read from 1tqjA/merged-good-all-a2m # found chain 1tqjA in training set Warning: unaligning (T0354)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tqjA)N144 Warning: unaligning (T0354)D43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tqjA)N144 Warning: unaligning (T0354)S44 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1tqjA)Q150 T0354 8 :KLAIEALEDIKGKDIIELD 1tqjA 102 :HRTLCQIRELGKKAGAVLN T0354 27 :TSKLTSLFQRMIVAT 1tqjA 128 :LEYVLPVCDLILIMS T0354 48 :VKALANSVQVKLKEAGVDIVG 1tqjA 156 :VLPKIRALRQMCDERGLDPWI Number of specific fragments extracted= 3 number of extra gaps= 1 total=70 Number of alignments=17 # 1tqjA read from 1tqjA/merged-good-all-a2m # found chain 1tqjA in training set Warning: unaligning (T0354)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tqjA)N144 Warning: unaligning (T0354)D43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tqjA)N144 Warning: unaligning (T0354)S44 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1tqjA)Q150 T0354 5 :E 1tqjA 103 :R T0354 10 :AIEALEDIKGKDIIELD 1tqjA 104 :TLCQIRELGKKAGAVLN T0354 27 :TSKLTSLFQRMIVAT 1tqjA 128 :LEYVLPVCDLILIMS T0354 46 :RQV 1tqjA 158 :PKI T0354 53 :NSVQVKLKEAGVDIV 1tqjA 161 :RALRQMCDERGLDPW T0354 78 :VLVD 1tqjA 176 :IEVD Number of specific fragments extracted= 6 number of extra gaps= 1 total=76 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dgjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dgjA expands to /projects/compbio/data/pdb/1dgj.pdb.gz 1dgjA:# T0354 read from 1dgjA/merged-good-all-a2m # 1dgjA read from 1dgjA/merged-good-all-a2m # adding 1dgjA to template set # found chain 1dgjA in template set T0354 48 :VKALANSVQV 1dgjA 710 :IRVACEMLIE T0354 58 :KLKEAGVDIVGSEGH 1dgjA 733 :EMKAEGRPMRYDGKW T0354 73 :ESGEWVL 1dgjA 780 :ATGKATV T0354 83 :GDVVVHV 1dgjA 787 :EKMVCVA Number of specific fragments extracted= 4 number of extra gaps= 0 total=80 Number of alignments=19 # 1dgjA read from 1dgjA/merged-good-all-a2m # found chain 1dgjA in template set T0354 47 :QVKALANSVQV 1dgjA 709 :AIRVACEMLIE T0354 58 :KLKEAGVDIVGSEG 1dgjA 733 :EMKAEGRPMRYDGK T0354 72 :HESGEWV 1dgjA 779 :VATGKAT T0354 82 :AGDVVVHV 1dgjA 786 :VEKMVCVA Number of specific fragments extracted= 4 number of extra gaps= 0 total=84 Number of alignments=20 # 1dgjA read from 1dgjA/merged-good-all-a2m # found chain 1dgjA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y2qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y2qA expands to /projects/compbio/data/pdb/1y2q.pdb.gz 1y2qA:# T0354 read from 1y2qA/merged-good-all-a2m # 1y2qA read from 1y2qA/merged-good-all-a2m # adding 1y2qA to template set # found chain 1y2qA in template set T0354 3 :IQEISKLAIEALEDIKGKDIIELDTSKLTSLF 1y2qA 57 :SLKAIEEISKVAEQVKAENVFVYPFAHLSSEL T0354 42 :GDSNRQV 1y2qA 89 :AKPSVAM T0354 50 :ALANSVQVKLKEAGVDIVGS 1y2qA 96 :DILNRVYQGLKERGFNVGKA Number of specific fragments extracted= 3 number of extra gaps= 0 total=87 Number of alignments=21 # 1y2qA read from 1y2qA/merged-good-all-a2m # found chain 1y2qA in template set T0354 3 :IQEISKLAIEALEDIKGKDIIELDTSKLTSLF 1y2qA 57 :SLKAIEEISKVAEQVKAENVFVYPFAHLSSEL T0354 42 :GD 1y2qA 89 :AK T0354 45 :NRQVKALANSVQVKLKEAGVDIVGS 1y2qA 91 :PSVAMDILNRVYQGLKERGFNVGKA Number of specific fragments extracted= 3 number of extra gaps= 0 total=90 Number of alignments=22 # 1y2qA read from 1y2qA/merged-good-all-a2m # found chain 1y2qA in template set T0354 3 :IQEISKLAIEALEDIKGKDIIELDTSKLTSL 1y2qA 57 :SLKAIEEISKVAEQVKAENVFVYPFAHLSSE T0354 41 :TGDSNRQVK 1y2qA 88 :LAKPSVAMD T0354 51 :LANSVQVKLKEAGVDIVGSE 1y2qA 97 :ILNRVYQGLKERGFNVGKAP Number of specific fragments extracted= 3 number of extra gaps= 0 total=93 Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qysA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qysA expands to /projects/compbio/data/pdb/1qys.pdb.gz 1qysA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0354 read from 1qysA/merged-good-all-a2m # 1qysA read from 1qysA/merged-good-all-a2m # adding 1qysA to template set # found chain 1qysA in template set T0354 3 :IQEISKLAIEALEDIKGK 1qysA 29 :LQKVLNELMDYIKKQGAK T0354 35 :QRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSE 1qysA 47 :RVRISITARTKKEAEKFAAILIKVFAELGYNDINVT T0354 72 :HESGEWVL 1qysA 83 :FDGDTVTV Number of specific fragments extracted= 3 number of extra gaps= 0 total=96 Number of alignments=24 # 1qysA read from 1qysA/merged-good-all-a2m # found chain 1qysA in template set T0354 3 :IQEISKLAIEALEDIKGKD 1qysA 29 :LQKVLNELMDYIKKQGAKR T0354 36 :RMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSE 1qysA 48 :VRISITARTKKEAEKFAAILIKVFAELGYNDINVT T0354 72 :HESGEWVL 1qysA 83 :FDGDTVTV Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=25 # 1qysA read from 1qysA/merged-good-all-a2m # found chain 1qysA in template set T0354 2 :EIQEISKLAIEALEDIKGKDII 1qysA 28 :ELQKVLNELMDYIKKQGAKRVR T0354 38 :IVATGDSNRQVKALANSVQVKLKEAGVDIVGSEG 1qysA 50 :ISITARTKKEAEKFAAILIKVFAELGYNDINVTF T0354 73 :ESGE 1qysA 84 :DGDT Number of specific fragments extracted= 3 number of extra gaps= 0 total=102 Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rtxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rtxA expands to /projects/compbio/data/pdb/1rtx.pdb.gz 1rtxA:# T0354 read from 1rtxA/merged-good-all-a2m # 1rtxA read from 1rtxA/merged-good-all-a2m # adding 1rtxA to template set # found chain 1rtxA in template set T0354 2 :EIQEISKLAIEALED 1rtxA 62 :DGRYMREAHKELVEN T0354 41 :TGDSNRQVKALANSVQVKLKEAGVD 1rtxA 77 :HGLNGEHFDAVAEDLLATLKEMGVP Number of specific fragments extracted= 2 number of extra gaps= 0 total=104 Number of alignments=27 # 1rtxA read from 1rtxA/merged-good-all-a2m # found chain 1rtxA in template set T0354 2 :EIQEISKLAIEALED 1rtxA 62 :DGRYMREAHKELVEN T0354 41 :TGDSNRQVKALANSVQVKLKEAGVD 1rtxA 77 :HGLNGEHFDAVAEDLLATLKEMGVP Number of specific fragments extracted= 2 number of extra gaps= 0 total=106 Number of alignments=28 # 1rtxA read from 1rtxA/merged-good-all-a2m # found chain 1rtxA in template set T0354 2 :EIQEISKLAIEALEDIK 1rtxA 62 :DGRYMREAHKELVENHG T0354 43 :DSNRQVKALANSVQVKLKEAGVD 1rtxA 79 :LNGEHFDAVAEDLLATLKEMGVP Number of specific fragments extracted= 2 number of extra gaps= 0 total=108 Number of alignments=29 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vdxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vdxA expands to /projects/compbio/data/pdb/1vdx.pdb.gz 1vdxA:# T0354 read from 1vdxA/merged-good-all-a2m # 1vdxA read from 1vdxA/merged-good-all-a2m # adding 1vdxA to template set # found chain 1vdxA in template set T0354 4 :QEISKLAIEALEDI 1vdxA 51 :EEQAEEIKNILKKI T0354 18 :KGK 1vdxA 67 :KYK T0354 22 :IIELDTSKLTSLFQRMIVATGDSNR 1vdxA 75 :VKGIGVFPNPNYIRVIWAGIENDEI T0354 48 :VKALANSVQVKLKEAGVDIV 1vdxA 100 :IREMAREIEDELAKLGFKKE Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # 1vdxA read from 1vdxA/merged-good-all-a2m # found chain 1vdxA in template set T0354 4 :QEISKLAIEALEDI 1vdxA 51 :EEQAEEIKNILKKI T0354 18 :KGKD 1vdxA 69 :KKHE T0354 22 :IIELDTSKLTSLFQRMIVATGDSNR 1vdxA 75 :VKGIGVFPNPNYIRVIWAGIENDEI T0354 48 :VKALANSVQVKLKEAGVDIV 1vdxA 100 :IREMAREIEDELAKLGFKKE Number of specific fragments extracted= 4 number of extra gaps= 0 total=116 Number of alignments=31 # 1vdxA read from 1vdxA/merged-good-all-a2m # found chain 1vdxA in template set T0354 2 :EIQEISKLAIEALEDIKGKD 1vdxA 53 :QAEEIKNILKKIAEKYKKHE T0354 22 :IIELDTSKLTSLFQRMIVATGDSNR 1vdxA 75 :VKGIGVFPNPNYIRVIWAGIENDEI T0354 48 :VKALANSVQVKLKEAGVDIVGS 1vdxA 100 :IREMAREIEDELAKLGFKKEGN Number of specific fragments extracted= 3 number of extra gaps= 0 total=119 Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ufkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ufkA expands to /projects/compbio/data/pdb/1ufk.pdb.gz 1ufkA:# T0354 read from 1ufkA/merged-good-all-a2m # 1ufkA read from 1ufkA/merged-good-all-a2m # adding 1ufkA to template set # found chain 1ufkA in template set T0354 9 :LAIEALEDIKGK 1ufkA 157 :QAEANAKRNGVR T0354 21 :DIIELDTSKLTSLFQ 1ufkA 170 :RFLEGSLEAALPFGP T0354 36 :RMIVATGDSNRQ 1ufkA 186 :DLLVANLYAELH T0354 50 :ALAN 1ufkA 203 :RYRE T0354 54 :SVQVKLKEAGVDIVGSEGHES 1ufkA 226 :LVREAMAGAGFRPLEEAAEGE T0354 77 :WVLVDAG 1ufkA 247 :WVLLAYG Number of specific fragments extracted= 6 number of extra gaps= 0 total=125 Number of alignments=33 # 1ufkA read from 1ufkA/merged-good-all-a2m # found chain 1ufkA in template set T0354 7 :SKLAIEALEDIKGK 1ufkA 155 :LPQAEANAKRNGVR T0354 21 :DIIELDTSKLTSLFQ 1ufkA 170 :RFLEGSLEAALPFGP T0354 36 :RMIVATGDSNRQ 1ufkA 186 :DLLVANLYAELH T0354 50 :ALAN 1ufkA 203 :RYRE T0354 54 :SVQVKLKEAGVDIVGSEGHES 1ufkA 226 :LVREAMAGAGFRPLEEAAEGE T0354 77 :WVLVDAG 1ufkA 247 :WVLLAYG Number of specific fragments extracted= 6 number of extra gaps= 0 total=131 Number of alignments=34 # 1ufkA read from 1ufkA/merged-good-all-a2m # found chain 1ufkA in template set T0354 4 :QEISKLAIEAL 1ufkA 198 :AALAPRYREAL T0354 32 :SLFQRMIVATGDSNR 1ufkA 209 :VPGGRALLTGILKDR T0354 52 :ANSVQVKLKEAGVDIVGSE 1ufkA 224 :APLVREAMAGAGFRPLEEA T0354 73 :ESGEWVLVDAG 1ufkA 243 :AEGEWVLLAYG Number of specific fragments extracted= 4 number of extra gaps= 0 total=135 Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rz3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1rz3A expands to /projects/compbio/data/pdb/1rz3.pdb.gz 1rz3A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0354 read from 1rz3A/merged-good-all-a2m # 1rz3A read from 1rz3A/merged-good-all-a2m # adding 1rz3A to template set # found chain 1rz3A in template set T0354 1 :MEIQEISKLAIEALEDIKGKDIIEL 1rz3A 1 :MELRDRIDFLCKTILAIKTAGRLVL T0354 37 :MIVATGDSN 1rz3A 26 :GIDGLSRSG T0354 48 :VKALANSVQVKLKEAGVDIVGS 1rz3A 35 :KTTLANQLSQTLREQGISVCVF Number of specific fragments extracted= 3 number of extra gaps= 0 total=138 Number of alignments=36 # 1rz3A read from 1rz3A/merged-good-all-a2m # found chain 1rz3A in template set T0354 1 :MEIQEISKLAIEALEDIKGKDIIEL 1rz3A 1 :MELRDRIDFLCKTILAIKTAGRLVL T0354 37 :MIVATGDSN 1rz3A 26 :GIDGLSRSG T0354 48 :VKALANSVQVKLKEAGVDIVGS 1rz3A 35 :KTTLANQLSQTLREQGISVCVF Number of specific fragments extracted= 3 number of extra gaps= 0 total=141 Number of alignments=37 # 1rz3A read from 1rz3A/merged-good-all-a2m # found chain 1rz3A in template set T0354 1 :MEIQEISKLAIEALEDIKGKDIIEL 1rz3A 1 :MELRDRIDFLCKTILAIKTAGRLVL T0354 39 :VATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHE 1rz3A 26 :GIDGLSRSGKTTLANQLSQTLREQGISVCVFHMDD T0354 88 :HVMLPAVR 1rz3A 61 :HIVERAKR Number of specific fragments extracted= 3 number of extra gaps= 0 total=144 Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vgjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vgjA expands to /projects/compbio/data/pdb/1vgj.pdb.gz 1vgjA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0354 read from 1vgjA/merged-good-all-a2m # 1vgjA read from 1vgjA/merged-good-all-a2m # adding 1vgjA to template set # found chain 1vgjA in template set T0354 4 :QEISKLAIEALEDI 1vgjA 51 :EEQAEEIKNILKKI T0354 18 :KGK 1vgjA 67 :KYK T0354 22 :IIELDTSKLTSLFQRMIVATGDSNR 1vgjA 75 :VKGIGVFPNPNYIRVIWAGIENDEI T0354 48 :VKALANSVQVKLKEAGVDIV 1vgjA 100 :IREMAREIEDELAKLGFKKE Number of specific fragments extracted= 4 number of extra gaps= 0 total=148 Number of alignments=39 # 1vgjA read from 1vgjA/merged-good-all-a2m # found chain 1vgjA in template set T0354 3 :IQEISKLAIEALEDI 1vgjA 50 :TEEQAEEIKNILKKI T0354 22 :IIELDTSKLTSLFQRMIVATGDSNR 1vgjA 75 :VKGIGVFPNPNYIRVIWAGIENDEI T0354 48 :VKALANSVQVKLKEAGVDIV 1vgjA 100 :IREMAREIEDELAKLGFKKE Number of specific fragments extracted= 3 number of extra gaps= 0 total=151 Number of alignments=40 # 1vgjA read from 1vgjA/merged-good-all-a2m # found chain 1vgjA in template set T0354 2 :EIQEISKLAIEALEDIKGKD 1vgjA 53 :QAEEIKNILKKIAEKYKKHE T0354 22 :IIELDTSKLTSLFQRMIVATGDSNR 1vgjA 75 :VKGIGVFPNPNYIRVIWAGIENDEI T0354 48 :VKALANSVQVKLKEAGVDIVGSEG 1vgjA 100 :IREMAREIEDELAKLGFKKEGNFV T0354 78 :VLVDAGDV 1vgjA 124 :AHITLGRV Number of specific fragments extracted= 4 number of extra gaps= 0 total=155 Number of alignments=41 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v6tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v6tA expands to /projects/compbio/data/pdb/1v6t.pdb.gz 1v6tA:# T0354 read from 1v6tA/merged-good-all-a2m # 1v6tA read from 1v6tA/merged-good-all-a2m # adding 1v6tA to template set # found chain 1v6tA in template set T0354 2 :EIQEISKLAIEALED 1v6tA 188 :DKEEIAERVISMVKD T0354 17 :IKG 1v6tA 208 :ING T0354 29 :KLTSLFQRMIVATGDSNRQVK 1v6tA 211 :EWVDLKVDTICVHGDNPKAVE T0354 51 :LANSVQVKLKEAGVDIVG 1v6tA 232 :ITSYIRKVLEEEGVKIVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=159 Number of alignments=42 # 1v6tA read from 1v6tA/merged-good-all-a2m # found chain 1v6tA in template set T0354 1 :MEIQEISKLAIEALED 1v6tA 187 :EDKEEIAERVISMVKD T0354 26 :DTSK 1v6tA 206 :RAIN T0354 30 :LTSLFQRMIVATGDSNRQVK 1v6tA 212 :WVDLKVDTICVHGDNPKAVE T0354 51 :LANSVQVKLKEAGVDIVG 1v6tA 232 :ITSYIRKVLEEEGVKIVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=163 Number of alignments=43 # 1v6tA read from 1v6tA/merged-good-all-a2m # found chain 1v6tA in template set T0354 1 :MEIQEISKLAIEALEDI 1v6tA 187 :EDKEEIAERVISMVKDG T0354 18 :KGKDIIELDT 1v6tA 206 :RAINGEWVDL T0354 34 :FQRMIVATGDSNRQVKA 1v6tA 216 :KVDTICVHGDNPKAVEI T0354 52 :ANSVQVKLKEAGVDIVGSE 1v6tA 233 :TSYIRKVLEEEGVKIVPMK Number of specific fragments extracted= 4 number of extra gaps= 0 total=167 Number of alignments=44 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g7uA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0354/1g7uA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0354/1g7uA/merged-good-all-a2m.gz for input Trying 1g7uA/merged-good-all-a2m Error: Couldn't open file 1g7uA/merged-good-all-a2m or 1g7uA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1e1dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1e1dA expands to /projects/compbio/data/pdb/1e1d.pdb.gz 1e1dA:# T0354 read from 1e1dA/merged-good-all-a2m # 1e1dA read from 1e1dA/merged-good-all-a2m # adding 1e1dA to template set # found chain 1e1dA in template set T0354 2 :EIQEISKLA 1e1dA 350 :DFSALIAQA T0354 17 :IKGKDIIELDTSK 1e1dA 359 :KKCPPPVEIETGS T0354 39 :VATGDSNRQVKALANSVQVKLKEAGV 1e1dA 372 :IVGGFAHHQVLALADKVVEAVKSGAI T0354 83 :GDVVVHVM 1e1dA 398 :KRFVVMAG T0354 91 :LPAVRDYYD 1e1dA 409 :RQKSRSYYT Number of specific fragments extracted= 5 number of extra gaps= 0 total=172 Number of alignments=45 # 1e1dA read from 1e1dA/merged-good-all-a2m # found chain 1e1dA in template set T0354 1 :MEIQEISKLA 1e1dA 349 :KDFSALIAQA T0354 17 :IKGKDIIELDTSK 1e1dA 359 :KKCPPPVEIETGS T0354 39 :VATGDSNRQVKALANSVQVKLKEAGVD 1e1dA 372 :IVGGFAHHQVLALADKVVEAVKSGAIK T0354 84 :DVVVHVM 1e1dA 399 :RFVVMAG T0354 91 :LPAVRDYYD 1e1dA 409 :RQKSRSYYT Number of specific fragments extracted= 5 number of extra gaps= 0 total=177 Number of alignments=46 # 1e1dA read from 1e1dA/merged-good-all-a2m # found chain 1e1dA in template set T0354 2 :EIQEISKLA 1e1dA 350 :DFSALIAQA T0354 17 :IKGKDIIELDTSKL 1e1dA 359 :KKCPPPVEIETGSI T0354 40 :ATGDSNRQVKALANSVQVKLKEAGVD 1e1dA 373 :VGGFAHHQVLALADKVVEAVKSGAIK T0354 84 :DVVVHV 1e1dA 399 :RFVVMA T0354 90 :MLPAVRDYYD 1e1dA 408 :GRQKSRSYYT Number of specific fragments extracted= 5 number of extra gaps= 0 total=182 Number of alignments=47 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wqaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wqaA expands to /projects/compbio/data/pdb/1wqa.pdb.gz 1wqaA:# T0354 read from 1wqaA/merged-good-all-a2m # 1wqaA read from 1wqaA/merged-good-all-a2m # adding 1wqaA to template set # found chain 1wqaA in template set T0354 48 :VKALANSVQVKLKEAGVDIVGSEGH 1wqaA 383 :RHAIVNKVAEMARERGYTVDTTDGA T0354 73 :ESGEWVLVDAGD 1wqaA 411 :FEDGWVLVRASG T0354 85 :VVVHVMLPAVRDYY 1wqaA 429 :IFSEAKSKEKAQEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=185 Number of alignments=48 # 1wqaA read from 1wqaA/merged-good-all-a2m # found chain 1wqaA in template set T0354 48 :VKALANSVQVKLKEAGVDIVGSEG 1wqaA 383 :RHAIVNKVAEMARERGYTVDTTDG T0354 72 :HESGEWVLVDAGD 1wqaA 410 :IFEDGWVLVRASG T0354 85 :VVVHVMLPAVRDYY 1wqaA 429 :IFSEAKSKEKAQEY Number of specific fragments extracted= 3 number of extra gaps= 0 total=188 Number of alignments=49 # 1wqaA read from 1wqaA/merged-good-all-a2m # found chain 1wqaA in template set T0354 12 :EALEDIKGK 1wqaA 362 :ELIDELPKY T0354 23 :IELDTSKL 1wqaA 371 :YQIKTKRH T0354 42 :GDSN 1wqaA 379 :VEGD T0354 48 :VKALANSVQVKLKEAGVDIVGSEGH 1wqaA 383 :RHAIVNKVAEMARERGYTVDTTDGA T0354 73 :ESGEWVLVDAGD 1wqaA 411 :FEDGWVLVRASG T0354 85 :VVVHVMLPAVRDYY 1wqaA 429 :IFSEAKSKEKAQEY Number of specific fragments extracted= 6 number of extra gaps= 0 total=194 Number of alignments=50 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dlyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dlyA expands to /projects/compbio/data/pdb/1dly.pdb.gz 1dlyA:# T0354 read from 1dlyA/merged-good-all-a2m # 1dlyA read from 1dlyA/merged-good-all-a2m # adding 1dlyA to template set # found chain 1dlyA in template set T0354 2 :EIQEISKLAIEALEDIKG 1dlyA 37 :DMKVQRSKQFAFLAYALG T0354 28 :SKLTSLF 1dlyA 69 :KDLVPHL T0354 44 :SNRQVKALANSVQVKLKEAGVD 1dlyA 76 :SDVHFQAVARHLSDTLTELGVP Number of specific fragments extracted= 3 number of extra gaps= 0 total=197 Number of alignments=51 # 1dlyA read from 1dlyA/merged-good-all-a2m # found chain 1dlyA in template set T0354 2 :EIQEISKLAIEALEDIKG 1dlyA 37 :DMKVQRSKQFAFLAYALG T0354 27 :TSK 1dlyA 59 :WKG T0354 30 :LTSLFQ 1dlyA 64 :MRTAHK T0354 44 :SNRQVKALANSVQVKLKEAGVD 1dlyA 76 :SDVHFQAVARHLSDTLTELGVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=201 Number of alignments=52 # 1dlyA read from 1dlyA/merged-good-all-a2m # found chain 1dlyA in template set T0354 2 :EIQEISKLAIEALE 1dlyA 37 :DMKVQRSKQFAFLA T0354 16 :DIKGKD 1dlyA 58 :EWKGKD T0354 28 :SKLTSL 1dlyA 69 :KDLVPH T0354 43 :DSNRQVKALANSVQVKLKEAGVD 1dlyA 75 :LSDVHFQAVARHLSDTLTELGVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=205 Number of alignments=53 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s69A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0354 read from 1s69A/merged-good-all-a2m # 1s69A read from 1s69A/merged-good-all-a2m # found chain 1s69A in training set T0354 1 :MEIQEISKLAIEALEDIKG 1s69A 38 :VDMAKQRAHQKAFLTYAFG T0354 20 :KD 1s69A 58 :TD T0354 26 :DTSKL 1s69A 60 :KYDGR T0354 43 :DSNRQVKALANSVQVKLKEAGVD 1s69A 79 :LNGEHFDAVAEDLLATLKEMGVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=209 Number of alignments=54 # 1s69A read from 1s69A/merged-good-all-a2m # found chain 1s69A in training set T0354 1 :MEIQEISKLAIEALEDIKG 1s69A 38 :VDMAKQRAHQKAFLTYAFG T0354 20 :KD 1s69A 58 :TD T0354 26 :DTSK 1s69A 60 :KYDG T0354 42 :GDSNRQVKALANSVQVKLKEAGVD 1s69A 78 :GLNGEHFDAVAEDLLATLKEMGVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=213 Number of alignments=55 # 1s69A read from 1s69A/merged-good-all-a2m # found chain 1s69A in training set T0354 1 :MEIQEISKLAIEALED 1s69A 38 :VDMAKQRAHQKAFLTY T0354 17 :IKGKD 1s69A 55 :FGGTD T0354 26 :DTSKLTS 1s69A 60 :KYDGRYM T0354 42 :GDSNRQVKALANSVQVKLKEAGVD 1s69A 78 :GLNGEHFDAVAEDLLATLKEMGVP Number of specific fragments extracted= 4 number of extra gaps= 0 total=217 Number of alignments=56 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mp9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1mp9A expands to /projects/compbio/data/pdb/1mp9.pdb.gz 1mp9A:# T0354 read from 1mp9A/merged-good-all-a2m # 1mp9A read from 1mp9A/merged-good-all-a2m # adding 1mp9A to template set # found chain 1mp9A in template set T0354 35 :QRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVL 1mp9A 67 :GKMVVTGAKSTDELIKAVKRIIKTLKKYGMQLTGKPKIQIQNIVA Number of specific fragments extracted= 1 number of extra gaps= 0 total=218 Number of alignments=57 # 1mp9A read from 1mp9A/merged-good-all-a2m # found chain 1mp9A in template set T0354 23 :IELDTSKLTSLF 1mp9A 50 :LIFRLESPKITS T0354 35 :QRMIVATGDSNRQVKALANSVQVKLKEAGVD 1mp9A 67 :GKMVVTGAKSTDELIKAVKRIIKTLKKYGMQ T0354 66 :IVGSEG 1mp9A 103 :KIQIQN T0354 72 :HESGEWVL 1mp9A 155 :FSSGKMVI Number of specific fragments extracted= 4 number of extra gaps= 0 total=222 Number of alignments=58 # 1mp9A read from 1mp9A/merged-good-all-a2m # found chain 1mp9A in template set T0354 20 :KDIIELDTSKL 1mp9A 47 :FPGLIFRLESP T0354 31 :TSLFQRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEWVL 1mp9A 63 :IFKSGKMVVTGAKSTDELIKAVKRIIKTLKKYGMQLTGKPKIQIQNIVA Number of specific fragments extracted= 2 number of extra gaps= 0 total=224 Number of alignments=59 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aisA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1aisA expands to /projects/compbio/data/pdb/1ais.pdb.gz 1aisA:# T0354 read from 1aisA/merged-good-all-a2m # 1aisA read from 1aisA/merged-good-all-a2m # adding 1aisA to template set # found chain 1aisA in template set T0354 35 :QRMIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGH 1aisA 63 :GKLVVTGAKSVQDIERAVAKLAQKLKSIGVKFKRAPQI T0354 73 :ESGEWVL 1aisA 152 :SSGKIVC Number of specific fragments extracted= 2 number of extra gaps= 0 total=226 Number of alignments=60 # 1aisA read from 1aisA/merged-good-all-a2m # found chain 1aisA in template set T0354 35 :QRMIVATGDSNRQVKALANSVQVKLKEAGVDI 1aisA 63 :GKLVVTGAKSVQDIERAVAKLAQKLKSIGVKF T0354 67 :VGSEG 1aisA 98 :PQIDV T0354 72 :HESGEWVL 1aisA 151 :FSSGKIVC Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=61 # 1aisA read from 1aisA/merged-good-all-a2m # found chain 1aisA in template set Warning: unaligning (T0354)K29 because of BadResidue code BAD_PEPTIDE in next template residue (1aisA)P53 Warning: unaligning (T0354)L30 because of BadResidue code BAD_PEPTIDE at template residue (1aisA)P53 T0354 21 :DIIELDTS 1aisA 44 :PGIICHLD T0354 31 :TSLFQR 1aisA 54 :KVALLI T0354 37 :MIVATGDSNRQVKALANSVQVKLKEAGVDIVGSEGHESGEW 1aisA 65 :LVVTGAKSVQDIERAVAKLAQKLKSIGVKFKRAPQIDVQNM Number of specific fragments extracted= 3 number of extra gaps= 1 total=232 Number of alignments=62 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0354//projects/compbio/experiments/protein-predict/casp7/T0354/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0354//projects/compbio/experiments/protein-predict/casp7/T0354/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0354/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0354/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0354)Q56.CB, (T0354)I66.CB) [> 3.5673 = 5.9455 < 7.7292] w=1.0000 to align # Constraint # added constraint: constraint((T0354)A10.CB, (T0354)V55.CB) [> 3.7412 = 6.2353 < 8.1059] w=0.5270 to align # Constraint # added constraint: constraint((T0354)S7.CB, (T0354)S54.CB) [> 3.6598 = 6.0998 < 7.9297] w=0.4927 to align # Constraint # added constraint: constraint((T0354)S7.CB, (T0354)K58.CB) [> 3.2613 = 5.4355 < 7.0662] w=0.4645 to align # Constraint # added constraint: constraint((T0354)I11.CB, (T0354)K58.CB) [> 2.9041 = 4.8402 < 6.2922] w=0.4543 to align # Constraint # added constraint: constraint((T0354)A10.CB, (T0354)L59.CB) [> 4.1083 = 6.8471 < 8.9012] w=0.4225 to align # Constraint # added constraint: constraint((T0354)G42.CA, (T0354)L51.CB) [> 4.2291 = 7.0486 < 9.1631] w=0.3863 to align # Constraint # added constraint: constraint((T0354)S7.CB, (T0354)V55.CB) [> 3.5782 = 5.9637 < 7.7529] w=0.3825 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)V55.CB) [> 4.1264 = 6.8773 < 8.9405] w=0.3797 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)L51.CB) [> 3.9191 = 6.5319 < 8.4914] w=0.3759 to align # Constraint # added constraint: constraint((T0354)E70.CB, (T0354)L79.CB) [> 3.9426 = 6.5710 < 8.5423] w=0.3726 to align # Constraint # added constraint: constraint((T0354)E15.CB, (T0354)A62.CB) [> 3.5809 = 5.9682 < 7.7586] w=0.3697 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)V67.CB) [> 4.2506 = 7.0844 < 9.2097] w=0.3652 to align # Constraint # added constraint: constraint((T0354)L14.CB, (T0354)V64.CB) [> 3.7298 = 6.2164 < 8.0813] w=0.3616 to align # Constraint # added constraint: constraint((T0354)I11.CB, (T0354)L59.CB) [> 3.4912 = 5.8187 < 7.5643] w=0.3478 to align # Constraint # added constraint: constraint((T0354)A10.CB, (T0354)K58.CB) [> 3.9841 = 6.6401 < 8.6321] w=0.3463 to align # Constraint # added constraint: constraint((T0354)L14.CB, (T0354)L59.CB) [> 4.2045 = 7.0074 < 9.1097] w=0.3434 to align # Constraint # added constraint: constraint((T0354)L14.CB, (T0354)V55.CB) [> 4.3588 = 7.2647 < 9.4441] w=0.3353 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)A52.CB) [> 3.1604 = 5.2673 < 6.8475] w=0.2992 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)V64.CB) [> 3.4363 = 5.7272 < 7.4453] w=0.2960 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)L59.CB) [> 3.8221 = 6.3702 < 8.2812] w=0.2960 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)V55.CB) [> 3.9241 = 6.5401 < 8.5021] w=0.2948 to align # Constraint # added constraint: constraint((T0354)Q56.CB, (T0354)G68.CA) [> 3.7989 = 6.3316 < 8.2310] w=0.2922 to align # Constraint # added constraint: constraint((T0354)S69.CB, (T0354)V78.CB) [> 4.1468 = 6.9113 < 8.9847] w=0.2864 to align # Constraint # added constraint: constraint((T0354)S69.CB, (T0354)L79.CB) [> 3.7708 = 6.2846 < 8.1700] w=0.2864 to align # Constraint # added constraint: constraint((T0354)Q56.CB, (T0354)V67.CB) [> 3.9377 = 6.5628 < 8.5317] w=0.2831 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)V67.CB) [> 4.0176 = 6.6960 < 8.7048] w=0.2687 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)D65.CB) [> 2.9859 = 4.9766 < 6.4696] w=0.2687 to align # Constraint # added constraint: constraint((T0354)G19.CA, (T0354)V64.CB) [> 4.5998 = 7.6663 < 9.9662] w=0.2687 to align # Constraint # added constraint: constraint((T0354)V55.CB, (T0354)V64.CB) [> 4.3049 = 7.1749 < 9.3274] w=0.2610 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)L51.CB) [> 3.5714 = 5.9524 < 7.7381] w=0.2447 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)V48.CB) [> 3.7357 = 6.2263 < 8.0941] w=0.2445 to align # Constraint # added constraint: constraint((T0354)I6.CB, (T0354)L51.CB) [> 3.9289 = 6.5481 < 8.5126] w=0.2428 to align # Constraint # added constraint: constraint((T0354)A10.CB, (T0354)I22.CB) [> 3.7591 = 6.2651 < 8.1446] w=0.2407 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)I38.CB) [> 4.1115 = 6.8524 < 8.9082] w=0.2347 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)M37.CB) [> 3.8470 = 6.4116 < 8.3351] w=0.2347 to align # Constraint # added constraint: constraint((T0354)S69.CB, (T0354)V80.CB) [> 3.6971 = 6.1619 < 8.0105] w=0.2318 to align # Constraint # added constraint: constraint((T0354)G68.CA, (T0354)V80.CB) [> 3.4839 = 5.8065 < 7.5484] w=0.2318 to align # Constraint # added constraint: constraint((T0354)I66.CB, (T0354)V80.CB) [> 4.2139 = 7.0232 < 9.1301] w=0.2318 to align # Constraint # added constraint: constraint((T0354)V55.CB, (T0354)V80.CB) [> 3.4112 = 5.6854 < 7.3910] w=0.2312 to align # Constraint # added constraint: constraint((T0354)A13.CB, (T0354)V55.CB) [> 4.4356 = 7.3928 < 9.6106] w=0.2300 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)E70.CB) [> 3.8893 = 6.4821 < 8.4268] w=0.2280 to align # Constraint # added constraint: constraint((T0354)K49.CB, (T0354)H72.CB) [> 4.4429 = 7.4049 < 9.6264] w=0.2278 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)A52.CB) [> 3.7989 = 6.3315 < 8.2309] w=0.2164 to align # Constraint # added constraint: constraint((T0354)I11.CB, (T0354)V64.CB) [> 3.8200 = 6.3666 < 8.2766] w=0.2148 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)A40.CB) [> 4.3703 = 7.2838 < 9.4690] w=0.2083 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)V39.CB) [> 3.6332 = 6.0554 < 7.8720] w=0.2083 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)V64.CB) [> 4.1203 = 6.8672 < 8.9273] w=0.2021 to align # Constraint # added constraint: constraint((T0354)I17.CB, (T0354)K58.CB) [> 4.0160 = 6.6934 < 8.7014] w=0.2016 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)V39.CB) [> 3.1358 = 5.2263 < 6.7941] w=0.2000 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)V39.CB) [> 4.4562 = 7.4269 < 9.6550] w=0.1995 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)V39.CB) [> 4.1325 = 6.8874 < 8.9537] w=0.1986 to align # Constraint # added constraint: constraint((T0354)H88.CB, (T0354)Y98.CB) [> 4.0535 = 6.7559 < 8.7827] w=0.1949 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)V55.CB) [> 4.3495 = 7.2491 < 9.4238] w=0.1918 to align # Constraint # added constraint: constraint((T0354)I11.CB, (T0354)V55.CB) [> 3.4482 = 5.7471 < 7.4712] w=0.1916 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)V55.CB) [> 3.9290 = 6.5483 < 8.5127] w=0.1906 to align # Constraint # added constraint: constraint((T0354)I6.CB, (T0354)V55.CB) [> 3.5043 = 5.8405 < 7.5926] w=0.1902 to align # Constraint # added constraint: constraint((T0354)I3.CB, (T0354)V55.CB) [> 3.8121 = 6.3535 < 8.2596] w=0.1902 to align # Constraint # added constraint: constraint((T0354)I3.CB, (T0354)S54.CB) [> 2.4072 = 4.0119 < 5.2155] w=0.1902 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)L51.CB) [> 4.3184 = 7.1973 < 9.3565] w=0.1852 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)I66.CB) [> 4.4033 = 7.3388 < 9.5404] w=0.1851 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)V64.CB) [> 4.3284 = 7.2139 < 9.3781] w=0.1851 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)I38.CB) [> 3.9055 = 6.5092 < 8.4619] w=0.1842 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)S69.CB) [> 3.9006 = 6.5010 < 8.4514] w=0.1830 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)L51.CB) [> 4.1458 = 6.9097 < 8.9826] w=0.1829 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)A52.CB) [> 3.3104 = 5.5173 < 7.1725] w=0.1823 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)S69.CB) [> 3.5685 = 5.9475 < 7.7318] w=0.1823 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)S69.CB) [> 3.9409 = 6.5682 < 8.5387] w=0.1823 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)G68.CA) [> 3.2141 = 5.3569 < 6.9640] w=0.1823 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)L59.CB) [> 4.4858 = 7.4764 < 9.7193] w=0.1823 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)V55.CB) [> 3.7190 = 6.1983 < 8.0578] w=0.1823 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)S69.CB) [> 4.3885 = 7.3142 < 9.5085] w=0.1823 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)G68.CA) [> 3.3861 = 5.6436 < 7.3366] w=0.1823 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)V67.CB) [> 3.0132 = 5.0220 < 6.5287] w=0.1823 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)A40.CB) [> 2.3851 = 3.9752 < 5.1677] w=0.1819 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)A40.CB) [> 3.2965 = 5.4942 < 7.1425] w=0.1819 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)M37.CB) [> 3.6573 = 6.0954 < 7.9241] w=0.1819 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)T41.CB) [> 4.6793 = 7.7988 < 10.1384] w=0.1766 to align # Constraint # added constraint: constraint((T0354)V48.CB, (T0354)H72.CB) [> 3.7910 = 6.3183 < 8.2138] w=0.1761 to align # Constraint # added constraint: constraint((T0354)A10.CB, (T0354)I38.CB) [> 4.1723 = 6.9538 < 9.0399] w=0.1749 to align # Constraint # added constraint: constraint((T0354)I6.CB, (T0354)A62.CB) [> 4.1573 = 6.9289 < 9.0075] w=0.1722 to align # Constraint # added constraint: constraint((T0354)A13.CB, (T0354)K58.CB) [> 3.3996 = 5.6660 < 7.3658] w=0.1722 to align # Constraint # added constraint: constraint((T0354)I17.CB, (T0354)L51.CB) [> 3.7889 = 6.3149 < 8.2093] w=0.1722 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)A40.CB) [> 4.0421 = 6.7369 < 8.7579] w=0.1722 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)T41.CB) [> 3.3636 = 5.6060 < 7.2878] w=0.1722 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)G42.CA) [> 4.3452 = 7.2420 < 9.4146] w=0.1722 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)A40.CB) [> 3.1475 = 5.2458 < 6.8196] w=0.1722 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)T41.CB) [> 4.2740 = 7.1234 < 9.2604] w=0.1722 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)G42.CA) [> 3.0597 = 5.0995 < 6.6294] w=0.1722 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)M37.CB) [> 4.6266 = 7.7110 < 10.0243] w=0.1722 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)I38.CB) [> 2.4682 = 4.1137 < 5.3478] w=0.1722 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)V39.CB) [> 4.3587 = 7.2645 < 9.4439] w=0.1722 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)R36.CB) [> 4.0979 = 6.8298 < 8.8787] w=0.1722 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)I38.CB) [> 4.2159 = 7.0266 < 9.1346] w=0.1722 to align # Constraint # added constraint: constraint((T0354)S28.CB, (T0354)I38.CB) [> 4.5690 = 7.6150 < 9.8995] w=0.1722 to align # Constraint # added constraint: constraint((T0354)E12.CB, (T0354)K58.CB) [> 4.3270 = 7.2117 < 9.3752] w=0.1714 to align # Constraint # added constraint: constraint((T0354)S7.CB, (T0354)L51.CB) [> 3.4884 = 5.8140 < 7.5582] w=0.1626 to align # Constraint # added constraint: constraint((T0354)K8.CB, (T0354)K58.CB) [> 3.7751 = 6.2919 < 8.1794] w=0.1626 to align # Constraint # added constraint: constraint((T0354)I3.CB, (T0354)L51.CB) [> 2.8749 = 4.7914 < 6.2288] w=0.1592 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)G68.CA) [> 4.3270 = 7.2117 < 9.3752] w=0.1547 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)A52.CB) [> 3.4590 = 5.7651 < 7.4946] w=0.1530 to align # Constraint # added constraint: constraint((T0354)T31.CB, (T0354)N53.CB) [> 4.2284 = 7.0473 < 9.1614] w=0.1460 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)L79.CB) [> 4.2893 = 7.1488 < 9.2935] w=0.1452 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)L79.CB) [> 3.4757 = 5.7928 < 7.5307] w=0.1452 to align # Constraint # added constraint: constraint((T0354)L59.CB, (T0354)A82.CB) [> 3.1846 = 5.3077 < 6.9001] w=0.1450 to align # Constraint # added constraint: constraint((T0354)V64.CB, (T0354)A82.CB) [> 2.4204 = 4.0340 < 5.2442] w=0.1450 to align # Constraint # added constraint: constraint((T0354)D65.CB, (T0354)A82.CB) [> 3.8859 = 6.4766 < 8.4195] w=0.1450 to align # Constraint # added constraint: constraint((T0354)I66.CB, (T0354)D81.CB) [> 4.2662 = 7.1103 < 9.2434] w=0.1450 to align # Constraint # added constraint: constraint((T0354)I66.CB, (T0354)A82.CB) [> 3.5109 = 5.8514 < 7.6069] w=0.1450 to align # Constraint # added constraint: constraint((T0354)V67.CB, (T0354)A82.CB) [> 3.8485 = 6.4142 < 8.3384] w=0.1450 to align # Constraint # added constraint: constraint((T0354)G68.CA, (T0354)D81.CB) [> 2.5835 = 4.3059 < 5.5976] w=0.1450 to align # Constraint # added constraint: constraint((T0354)S69.CB, (T0354)D81.CB) [> 4.3292 = 7.2153 < 9.3799] w=0.1450 to align # Constraint # added constraint: constraint((T0354)A13.CB, (T0354)T27.CB) [> 3.1769 = 5.2948 < 6.8833] w=0.1446 to align # Constraint # added constraint: constraint((T0354)I11.CB, (T0354)I22.CB) [> 3.9551 = 6.5918 < 8.5693] w=0.1434 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)A52.CB) [> 4.2729 = 7.1216 < 9.2580] w=0.1425 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)A82.CB) [> 3.5736 = 5.9560 < 7.7428] w=0.1423 to align # Constraint # added constraint: constraint((T0354)L51.CB, (T0354)A82.CB) [> 4.3756 = 7.2927 < 9.4805] w=0.1423 to align # Constraint # added constraint: constraint((T0354)G68.CA, (T0354)L79.CB) [> 4.0849 = 6.8082 < 8.8507] w=0.1415 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)L79.CB) [> 3.5232 = 5.8720 < 7.6336] w=0.1415 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)L59.CB) [> 4.6618 = 7.7696 < 10.1005] w=0.1406 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)V55.CB) [> 3.9842 = 6.6403 < 8.6324] w=0.1325 to align # Constraint # added constraint: constraint((T0354)Q4.CB, (T0354)K58.CB) [> 3.6975 = 6.1625 < 8.0112] w=0.1269 to align # Constraint # added constraint: constraint((T0354)S7.CB, (T0354)L59.CB) [> 3.4806 = 5.8009 < 7.5412] w=0.1269 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)S69.CB) [> 3.8146 = 6.3576 < 8.2649] w=0.1266 to align # Constraint # added constraint: constraint((T0354)L30.CB, (T0354)G42.CA) [> 3.5935 = 5.9892 < 7.7860] w=0.1235 to align # Constraint # added constraint: constraint((T0354)G42.CA, (T0354)A52.CB) [> 3.7101 = 6.1834 < 8.0385] w=0.1226 to align # Constraint # added constraint: constraint((T0354)L14.CB, (T0354)Q35.CB) [> 2.9412 = 4.9021 < 6.3727] w=0.1226 to align # Constraint # added constraint: constraint((T0354)A13.CB, (T0354)Q35.CB) [> 3.3803 = 5.6338 < 7.3240] w=0.1226 to align # Constraint # added constraint: constraint((T0354)L30.CB, (T0354)T41.CB) [> 3.8709 = 6.4516 < 8.3870] w=0.1216 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)A52.CB) [> 3.4117 = 5.6861 < 7.3919] w=0.1208 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)V48.CB) [> 3.2564 = 5.4273 < 7.0555] w=0.1174 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)V80.CB) [> 4.4228 = 7.3713 < 9.5828] w=0.1163 to align # Constraint # added constraint: constraint((T0354)I17.CB, (T0354)T27.CB) [> 4.2607 = 7.1012 < 9.2315] w=0.1163 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)S32.CB) [> 4.7638 = 7.9396 < 10.3215] w=0.1159 to align # Constraint # added constraint: constraint((T0354)V64.CB, (T0354)G83.CA) [> 3.2875 = 5.4791 < 7.1229] w=0.1158 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)V80.CB) [> 3.5288 = 5.8813 < 7.6458] w=0.1158 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)A50.CB) [> 3.2217 = 5.3695 < 6.9803] w=0.1154 to align # Constraint # added constraint: constraint((T0354)I17.CB, (T0354)V55.CB) [> 3.7489 = 6.2481 < 8.1225] w=0.1148 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)V78.CB) [> 4.5433 = 7.5722 < 9.8438] w=0.1139 to align # Constraint # added constraint: constraint((T0354)S7.CB, (T0354)E24.CB) [> 3.4711 = 5.7852 < 7.5207] w=0.1138 to align # Constraint # added constraint: constraint((T0354)L9.CB, (T0354)K29.CB) [> 3.2934 = 5.4889 < 7.1356] w=0.1136 to align # Constraint # added constraint: constraint((T0354)D16.CB, (T0354)T27.CB) [> 2.4515 = 4.0858 < 5.3116] w=0.1136 to align # Constraint # added constraint: constraint((T0354)E73.CB, (T0354)V89.CB) [> 4.6212 = 7.7019 < 10.0125] w=0.1125 to align # Constraint # added constraint: constraint((T0354)N45.CB, (T0354)H72.CB) [> 4.1889 = 6.9815 < 9.0759] w=0.1125 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)L51.CB) [> 3.5980 = 5.9967 < 7.7957] w=0.1120 to align # Constraint # added constraint: constraint((T0354)L9.CB, (T0354)G19.CA) [> 4.4513 = 7.4188 < 9.6444] w=0.1094 to align # Constraint # added constraint: constraint((T0354)K49.CB, (T0354)E70.CB) [> 3.9588 = 6.5980 < 8.5774] w=0.1066 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)L33.CB) [> 4.3075 = 7.1792 < 9.3329] w=0.1008 to align # Constraint # added constraint: constraint((T0354)L33.CB, (T0354)G42.CA) [> 4.6462 = 7.7437 < 10.0668] w=0.0973 to align # Constraint # added constraint: constraint((T0354)I6.CB, (T0354)K58.CB) [> 4.7019 = 7.8366 < 10.1875] w=0.0973 to align # Constraint # added constraint: constraint((T0354)I3.CB, (T0354)K58.CB) [> 3.7055 = 6.1759 < 8.0286] w=0.0973 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)M37.CB) [> 3.7902 = 6.3169 < 8.2120] w=0.0972 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)V64.CB) [> 4.0183 = 6.6972 < 8.7064] w=0.0935 to align # Constraint # added constraint: constraint((T0354)I6.CB, (T0354)S54.CB) [> 4.6189 = 7.6982 < 10.0076] w=0.0929 to align # Constraint # added constraint: constraint((T0354)V48.CB, (T0354)S74.CB) [> 4.7451 = 7.9085 < 10.2811] w=0.0925 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)V55.CB) [> 4.0230 = 6.7049 < 8.7164] w=0.0925 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)G68.CA) [> 3.0282 = 5.0469 < 6.5610] w=0.0896 to align # Constraint # added constraint: constraint((T0354)L59.CB, (T0354)V80.CB) [> 4.2981 = 7.1636 < 9.3126] w=0.0889 to align # Constraint # added constraint: constraint((T0354)V67.CB, (T0354)G83.CA) [> 3.2855 = 5.4758 < 7.1185] w=0.0889 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)G42.CA) [> 4.7491 = 7.9152 < 10.2898] w=0.0887 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)L79.CB) [> 4.7413 = 7.9021 < 10.2728] w=0.0868 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)W77.CB) [> 4.3503 = 7.2504 < 9.4256] w=0.0868 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)E76.CB) [> 4.5097 = 7.5162 < 9.7710] w=0.0868 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)V78.CB) [> 3.4892 = 5.8153 < 7.5599] w=0.0868 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)V80.CB) [> 4.3512 = 7.2519 < 9.4275] w=0.0868 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)L79.CB) [> 2.5566 = 4.2610 < 5.5394] w=0.0868 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)V78.CB) [> 4.3387 = 7.2311 < 9.4004] w=0.0868 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)V80.CB) [> 3.6273 = 6.0456 < 7.8593] w=0.0868 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)L79.CB) [> 4.6019 = 7.6698 < 9.9707] w=0.0868 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)V78.CB) [> 4.6366 = 7.7276 < 10.0459] w=0.0868 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)V80.CB) [> 4.5657 = 7.6095 < 9.8924] w=0.0868 to align # Constraint # added constraint: constraint((T0354)V67.CB, (T0354)V80.CB) [> 2.8879 = 4.8133 < 6.2572] w=0.0868 to align # Constraint # added constraint: constraint((T0354)T31.CB, (T0354)L79.CB) [> 4.0528 = 6.7546 < 8.7810] w=0.0868 to align # Constraint # added constraint: constraint((T0354)L30.CB, (T0354)L79.CB) [> 3.3878 = 5.6464 < 7.3403] w=0.0868 to align # Constraint # added constraint: constraint((T0354)L30.CB, (T0354)W77.CB) [> 4.0727 = 6.7878 < 8.8241] w=0.0868 to align # Constraint # added constraint: constraint((T0354)S28.CB, (T0354)W77.CB) [> 4.4165 = 7.3609 < 9.5691] w=0.0868 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)A52.CB) [> 4.4769 = 7.4614 < 9.6998] w=0.0867 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)E70.CB) [> 3.4612 = 5.7686 < 7.4992] w=0.0864 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)E70.CB) [> 4.4420 = 7.4033 < 9.6243] w=0.0864 to align # Constraint # added constraint: constraint((T0354)D43.CB, (T0354)G71.CA) [> 4.2476 = 7.0793 < 9.2031] w=0.0864 to align # Constraint # added constraint: constraint((T0354)G75.CA, (T0354)M90.CB) [> 3.0883 = 5.1472 < 6.6914] w=0.0862 to align # Constraint # added constraint: constraint((T0354)G75.CA, (T0354)V89.CB) [> 3.6586 = 6.0977 < 7.9269] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E73.CB, (T0354)V94.CB) [> 4.5732 = 7.6220 < 9.9085] w=0.0862 to align # Constraint # added constraint: constraint((T0354)G71.CA, (T0354)A82.CB) [> 4.1931 = 6.9886 < 9.0851] w=0.0862 to align # Constraint # added constraint: constraint((T0354)G71.CA, (T0354)D81.CB) [> 2.4753 = 4.1255 < 5.3631] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E70.CB, (T0354)D81.CB) [> 3.6084 = 6.0140 < 7.8182] w=0.0862 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)D81.CB) [> 3.8400 = 6.3999 < 8.3199] w=0.0862 to align # Constraint # added constraint: constraint((T0354)V48.CB, (T0354)G83.CA) [> 4.4949 = 7.4916 < 9.7391] w=0.0862 to align # Constraint # added constraint: constraint((T0354)V48.CB, (T0354)A82.CB) [> 2.8177 = 4.6962 < 6.1050] w=0.0862 to align # Constraint # added constraint: constraint((T0354)V89.CB, (T0354)Y98.CB) [> 3.6378 = 6.0631 < 7.8820] w=0.0862 to align # Constraint # added constraint: constraint((T0354)V78.CB, (T0354)Y98.CB) [> 2.6013 = 4.3355 < 5.6362] w=0.0862 to align # Constraint # added constraint: constraint((T0354)V78.CB, (T0354)V87.CB) [> 2.9708 = 4.9514 < 6.4368] w=0.0862 to align # Constraint # added constraint: constraint((T0354)W77.CB, (T0354)Y98.CB) [> 4.0240 = 6.7067 < 8.7187] w=0.0862 to align # Constraint # added constraint: constraint((T0354)W77.CB, (T0354)H88.CB) [> 3.3723 = 5.6205 < 7.3066] w=0.0862 to align # Constraint # added constraint: constraint((T0354)W77.CB, (T0354)V87.CB) [> 4.3134 = 7.1890 < 9.3457] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E76.CB, (T0354)R95.CB) [> 3.9197 = 6.5328 < 8.4926] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E76.CB, (T0354)V94.CB) [> 3.2590 = 5.4317 < 7.0611] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E76.CB, (T0354)M90.CB) [> 3.9169 = 6.5282 < 8.4867] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E76.CB, (T0354)V89.CB) [> 2.3035 = 3.8392 < 4.9909] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E76.CB, (T0354)H88.CB) [> 2.9128 = 4.8546 < 6.3110] w=0.0862 to align # Constraint # added constraint: constraint((T0354)E76.CB, (T0354)V87.CB) [> 4.0886 = 6.8144 < 8.8587] w=0.0862 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)L79.CB) [> 3.8805 = 6.4676 < 8.4078] w=0.0860 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)V78.CB) [> 3.9537 = 6.5896 < 8.5664] w=0.0860 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)L59.CB) [> 4.3745 = 7.2908 < 9.4780] w=0.0855 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)E70.CB) [> 4.0093 = 6.6822 < 8.6868] w=0.0850 to align # Constraint # added constraint: constraint((T0354)G42.CA, (T0354)W77.CB) [> 4.1738 = 6.9564 < 9.0433] w=0.0843 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)W77.CB) [> 3.5112 = 5.8520 < 7.6076] w=0.0843 to align # Constraint # added constraint: constraint((T0354)L14.CB, (T0354)R36.CB) [> 3.7591 = 6.2651 < 8.1446] w=0.0843 to align # Constraint # added constraint: constraint((T0354)A10.CB, (T0354)L51.CB) [> 4.5851 = 7.6418 < 9.9343] w=0.0835 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)K58.CB) [> 4.7432 = 7.9053 < 10.2769] w=0.0820 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)E76.CB) [> 3.4606 = 5.7677 < 7.4980] w=0.0820 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)E76.CB) [> 4.2222 = 7.0370 < 9.1481] w=0.0820 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)E76.CB) [> 2.7037 = 4.5062 < 5.8581] w=0.0820 to align # Constraint # added constraint: constraint((T0354)G42.CA, (T0354)E76.CB) [> 4.1454 = 6.9089 < 8.9816] w=0.0820 to align # Constraint # added constraint: constraint((T0354)D43.CB, (T0354)G75.CA) [> 4.6373 = 7.7288 < 10.0475] w=0.0820 to align # Constraint # added constraint: constraint((T0354)Q47.CB, (T0354)G75.CA) [> 4.6256 = 7.7094 < 10.0222] w=0.0820 to align # Constraint # added constraint: constraint((T0354)L9.CB, (T0354)K18.CB) [> 3.6344 = 6.0574 < 7.8746] w=0.0807 to align # Constraint # added constraint: constraint((T0354)V64.CB, (T0354)D84.CB) [> 4.3380 = 7.2300 < 9.3990] w=0.0807 to align # Constraint # added constraint: constraint((T0354)V64.CB, (T0354)V85.CB) [> 4.4603 = 7.4339 < 9.6640] w=0.0807 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)Q47.CB) [> 4.4744 = 7.4574 < 9.6946] w=0.0649 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)K58.CB) [> 4.7571 = 7.9285 < 10.3071] w=0.0636 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)M37.CB) [> 4.3405 = 7.2342 < 9.4045] w=0.0625 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)V80.CB) [> 2.7770 = 4.6283 < 6.0168] w=0.0624 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)D81.CB) [> 3.3707 = 5.6178 < 7.3031] w=0.0624 to align # Constraint # added constraint: constraint((T0354)F34.CB, (T0354)V48.CB) [> 4.2151 = 7.0252 < 9.1328] w=0.0611 to align # Constraint # added constraint: constraint((T0354)F34.CB, (T0354)Q47.CB) [> 3.6943 = 6.1572 < 8.0043] w=0.0611 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)V85.CB) [> 4.0285 = 6.7141 < 8.7283] w=0.0609 to align # Constraint # added constraint: constraint((T0354)R36.CB, (T0354)V85.CB) [> 4.2091 = 7.0153 < 9.1198] w=0.0609 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)L33.CB) [> 4.1121 = 6.8536 < 8.9096] w=0.0607 to align # Constraint # added constraint: constraint((T0354)F34.CB, (T0354)L51.CB) [> 4.2217 = 7.0361 < 9.1469] w=0.0607 to align # Constraint # added constraint: constraint((T0354)F34.CB, (T0354)V55.CB) [> 3.4650 = 5.7751 < 7.5076] w=0.0607 to align # Constraint # added constraint: constraint((T0354)V55.CB, (T0354)V78.CB) [> 4.5721 = 7.6202 < 9.9062] w=0.0593 to align # Constraint # added constraint: constraint((T0354)Q47.CB, (T0354)K58.CB) [> 4.0490 = 6.7484 < 8.7729] w=0.0593 to align # Constraint # added constraint: constraint((T0354)Q47.CB, (T0354)L59.CB) [> 4.6108 = 7.6846 < 9.9900] w=0.0593 to align # Constraint # added constraint: constraint((T0354)L51.CB, (T0354)V64.CB) [> 4.6326 = 7.7210 < 10.0373] w=0.0593 to align # Constraint # added constraint: constraint((T0354)R36.CB, (T0354)D81.CB) [> 3.9092 = 6.5153 < 8.4698] w=0.0592 to align # Constraint # added constraint: constraint((T0354)R36.CB, (T0354)G83.CA) [> 3.5192 = 5.8654 < 7.6250] w=0.0592 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)D81.CB) [> 4.4930 = 7.4884 < 9.7349] w=0.0592 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)A82.CB) [> 2.7899 = 4.6498 < 6.0447] w=0.0592 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)G83.CA) [> 3.4615 = 5.7692 < 7.5000] w=0.0592 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)A82.CB) [> 4.2918 = 7.1529 < 9.2988] w=0.0592 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)A82.CB) [> 3.9667 = 6.6111 < 8.5944] w=0.0592 to align # Constraint # added constraint: constraint((T0354)G42.CA, (T0354)V78.CB) [> 3.9930 = 6.6550 < 8.6515] w=0.0592 to align # Constraint # added constraint: constraint((T0354)S44.CB, (T0354)V78.CB) [> 2.8912 = 4.8186 < 6.2642] w=0.0592 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)V78.CB) [> 4.0178 = 6.6964 < 8.7053] w=0.0592 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)L59.CB) [> 3.5114 = 5.8523 < 7.6080] w=0.0577 to align # Constraint # added constraint: constraint((T0354)I6.CB, (T0354)L59.CB) [> 4.0362 = 6.7270 < 8.7451] w=0.0574 to align # Constraint # added constraint: constraint((T0354)L33.CB, (T0354)S44.CB) [> 4.1895 = 6.9824 < 9.0772] w=0.0574 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)Q47.CB) [> 3.1897 = 5.3162 < 6.9110] w=0.0561 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)L51.CB) [> 2.5417 = 4.2362 < 5.5070] w=0.0561 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)L51.CB) [> 4.4163 = 7.3606 < 9.5688] w=0.0557 to align # Constraint # added constraint: constraint((T0354)G19.CA, (T0354)R36.CB) [> 3.8786 = 6.4643 < 8.4036] w=0.0547 to align # Constraint # added constraint: constraint((T0354)R36.CB, (T0354)L59.CB) [> 4.3437 = 7.2396 < 9.4114] w=0.0547 to align # Constraint # added constraint: constraint((T0354)R36.CB, (T0354)V64.CB) [> 3.7941 = 6.3236 < 8.2206] w=0.0547 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)W77.CB) [> 3.8816 = 6.4693 < 8.4101] w=0.0547 to align # Constraint # added constraint: constraint((T0354)D65.CB, (T0354)D84.CB) [> 2.8670 = 4.7784 < 6.2119] w=0.0538 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)A52.CB) [> 2.9902 = 4.9837 < 6.4788] w=0.0527 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)Q35.CB) [> 2.8280 = 4.7133 < 6.1273] w=0.0386 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)K58.CB) [> 3.3844 = 5.6407 < 7.3329] w=0.0378 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)I38.CB) [> 3.6966 = 6.1610 < 8.0093] w=0.0371 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)R36.CB) [> 3.7379 = 6.2298 < 8.0988] w=0.0371 to align # Constraint # added constraint: constraint((T0354)G19.CA, (T0354)Q35.CB) [> 4.1786 = 6.9644 < 9.0537] w=0.0371 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)S32.CB) [> 3.8198 = 6.3664 < 8.2763] w=0.0318 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)V86.CB) [> 4.6387 = 7.7312 < 10.0505] w=0.0313 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)V86.CB) [> 4.4950 = 7.4916 < 9.7391] w=0.0313 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)V85.CB) [> 4.2651 = 7.1085 < 9.2411] w=0.0313 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)V86.CB) [> 3.2772 = 5.4620 < 7.1006] w=0.0313 to align # Constraint # added constraint: constraint((T0354)V39.CB, (T0354)V87.CB) [> 4.2251 = 7.0418 < 9.1543] w=0.0313 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)V87.CB) [> 3.1182 = 5.1969 < 6.7560] w=0.0313 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)V87.CB) [> 4.2669 = 7.1115 < 9.2449] w=0.0313 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)A40.CB) [> 4.3438 = 7.2396 < 9.4115] w=0.0312 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)A50.CB) [> 4.4901 = 7.4836 < 9.7287] w=0.0310 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)A50.CB) [> 4.1195 = 6.8657 < 8.9255] w=0.0310 to align # Constraint # added constraint: constraint((T0354)Q35.CB, (T0354)G83.CA) [> 4.0284 = 6.7140 < 8.7282] w=0.0296 to align # Constraint # added constraint: constraint((T0354)F34.CB, (T0354)G83.CA) [> 4.5879 = 7.6465 < 9.9405] w=0.0296 to align # Constraint # added constraint: constraint((T0354)L14.CB, (T0354)L33.CB) [> 4.1785 = 6.9641 < 9.0533] w=0.0296 to align # Constraint # added constraint: constraint((T0354)A10.CB, (T0354)V64.CB) [> 4.6326 = 7.7210 < 10.0373] w=0.0296 to align # Constraint # added constraint: constraint((T0354)E5.CB, (T0354)K58.CB) [> 4.5497 = 7.5828 < 9.8577] w=0.0296 to align # Constraint # added constraint: constraint((T0354)S44.CB, (T0354)W77.CB) [> 4.6535 = 7.7558 < 10.0826] w=0.0296 to align # Constraint # added constraint: constraint((T0354)S44.CB, (T0354)E76.CB) [> 3.1871 = 5.3119 < 6.9055] w=0.0296 to align # Constraint # added constraint: constraint((T0354)D43.CB, (T0354)E76.CB) [> 3.4386 = 5.7310 < 7.4503] w=0.0296 to align # Constraint # added constraint: constraint((T0354)D43.CB, (T0354)A52.CB) [> 4.3946 = 7.3244 < 9.5218] w=0.0296 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)V64.CB) [> 3.9450 = 6.5750 < 8.5475] w=0.0296 to align # Constraint # added constraint: constraint((T0354)K18.CB, (T0354)R46.CB) [> 4.7401 = 7.9001 < 10.2702] w=0.0296 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)A82.CB) [> 4.6292 = 7.7153 < 10.0299] w=0.0296 to align # Constraint # added constraint: constraint((T0354)Q35.CB, (T0354)D84.CB) [> 4.0214 = 6.7023 < 8.7130] w=0.0296 to align # Constraint # added constraint: constraint((T0354)Q35.CB, (T0354)V85.CB) [> 3.3209 = 5.5348 < 7.1953] w=0.0296 to align # Constraint # added constraint: constraint((T0354)R36.CB, (T0354)D84.CB) [> 3.3497 = 5.5828 < 7.2576] w=0.0296 to align # Constraint # added constraint: constraint((T0354)M37.CB, (T0354)D84.CB) [> 4.6608 = 7.7680 < 10.0984] w=0.0296 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)Q35.CB) [> 3.8553 = 6.4255 < 8.3532] w=0.0289 to align # Constraint # added constraint: constraint((T0354)T31.CB, (T0354)Q47.CB) [> 4.5560 = 7.5933 < 9.8713] w=0.0289 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)V86.CB) [> 3.9249 = 6.5416 < 8.5040] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)R95.CB) [> 2.5851 = 4.3085 < 5.6011] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)V94.CB) [> 4.5367 = 7.5611 < 9.8294] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)P92.CB) [> 2.9650 = 4.9417 < 6.4241] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)L91.CB) [> 3.6367 = 6.0612 < 7.8796] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)M90.CB) [> 4.2837 = 7.1396 < 9.2814] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)V89.CB) [> 3.0605 = 5.1009 < 6.6311] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)H88.CB) [> 4.0951 = 6.8252 < 8.8728] w=0.0287 to align # Constraint # added constraint: constraint((T0354)K20.CB, (T0354)M90.CB) [> 3.8285 = 6.3808 < 8.2950] w=0.0287 to align # Constraint # added constraint: constraint((T0354)K20.CB, (T0354)V89.CB) [> 4.1410 = 6.9017 < 8.9722] w=0.0287 to align # Constraint # added constraint: constraint((T0354)K20.CB, (T0354)H88.CB) [> 3.3298 = 5.5496 < 7.2145] w=0.0287 to align # Constraint # added constraint: constraint((T0354)G19.CA, (T0354)M90.CB) [> 4.1658 = 6.9430 < 9.0259] w=0.0287 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)V87.CB) [> 3.4751 = 5.7918 < 7.5294] w=0.0287 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)H88.CB) [> 2.4988 = 4.1646 < 5.4140] w=0.0287 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)V89.CB) [> 4.4436 = 7.4061 < 9.6279] w=0.0287 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)V86.CB) [> 4.5025 = 7.5041 < 9.7554] w=0.0287 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)V87.CB) [> 2.8822 = 4.8036 < 6.2447] w=0.0287 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)V85.CB) [> 4.1067 = 6.8446 < 8.8979] w=0.0287 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)V86.CB) [> 3.1156 = 5.1926 < 6.7504] w=0.0287 to align # Constraint # added constraint: constraint((T0354)D26.CB, (T0354)V87.CB) [> 4.5542 = 7.5903 < 9.8674] w=0.0287 to align # Constraint # added constraint: constraint((T0354)T27.CB, (T0354)V85.CB) [> 2.5675 = 4.2791 < 5.5628] w=0.0287 to align # Constraint # added constraint: constraint((T0354)L33.CB, (T0354)D43.CB) [> 3.4505 = 5.7508 < 7.4760] w=0.0287 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)V85.CB) [> 2.7166 = 4.5277 < 5.8860] w=0.0280 to align # Constraint # added constraint: constraint((T0354)A40.CB, (T0354)V86.CB) [> 4.6446 = 7.7411 < 10.0634] w=0.0280 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)V55.CB) [> 2.2901 = 3.8169 < 4.9620] w=0.0280 to align # Constraint # added constraint: constraint((T0354)L59.CB, (T0354)V86.CB) [> 4.1652 = 6.9420 < 9.0246] w=0.0280 to align # Constraint # added constraint: constraint((T0354)V55.CB, (T0354)V86.CB) [> 4.5201 = 7.5335 < 9.7936] w=0.0280 to align # Constraint # added constraint: constraint((T0354)N45.CB, (T0354)V89.CB) [> 4.7454 = 7.9090 < 10.2817] w=0.0280 to align # Constraint # added constraint: constraint((T0354)D43.CB, (T0354)V89.CB) [> 3.0036 = 5.0060 < 6.5078] w=0.0280 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)H88.CB) [> 4.7561 = 7.9269 < 10.3050] w=0.0280 to align # Constraint # added constraint: constraint((T0354)T41.CB, (T0354)V86.CB) [> 3.8152 = 6.3587 < 8.2663] w=0.0280 to align # Constraint # added constraint: constraint((T0354)D21.CB, (T0354)I38.CB) [> 4.5759 = 7.6266 < 9.9145] w=0.0278 to align # Constraint # added constraint: constraint((T0354)S44.CB, (T0354)S74.CB) [> 3.8572 = 6.4286 < 8.3572] w=0.0278 to align # Constraint # added constraint: constraint((T0354)K18.CB, (T0354)D43.CB) [> 3.6472 = 6.0787 < 7.9023] w=0.0271 to align # Constraint # added constraint: constraint((T0354)K18.CB, (T0354)S44.CB) [> 4.0068 = 6.6780 < 8.6813] w=0.0271 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)F34.CB) [> 3.8842 = 6.4737 < 8.4158] w=0.0097 to align # Constraint # added constraint: constraint((T0354)I23.CB, (T0354)M37.CB) [> 3.2498 = 5.4163 < 7.0412] w=0.0097 to align # Constraint # added constraint: constraint((T0354)E24.CB, (T0354)I38.CB) [> 2.6734 = 4.4557 < 5.7924] w=0.0097 to align # Constraint # added constraint: constraint((T0354)L25.CB, (T0354)L51.CB) [> 4.4849 = 7.4748 < 9.7172] w=0.0065 to align # Constraint # added constraint: constraint((T0354)I22.CB, (T0354)V86.CB) [> 4.3026 = 7.1710 < 9.3223] w=0.0032 to align # Constraint # added constraint: constraint((T0354)I38.CB, (T0354)V87.CB) [> 4.2878 = 7.1464 < 9.2903] w=0.0032 to align # Constraint # added constraint: constraint((T0354)A52.CB, (T0354)V85.CB) [> 3.9159 = 6.5264 < 8.4844] w=0.0032 to align # Constraint # added constraint: constraint((T0354)V55.CB, (T0354)V85.CB) [> 3.6275 = 6.0458 < 7.8596] w=0.0032 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0354/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0354/decoys/ # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 63 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 17 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 16 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 119 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 115 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 116 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 36 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 36 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 126 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 116 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0354)S28.C and (T0354)K29.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.CA only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.CA only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)K29.CB only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.CB only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.CB only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)K29.CG only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)K29.CG only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.CG only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.CG only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)K29.CD only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)K29.CD only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)K29.CD only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.CD only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.CD only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)K29.CE only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)K29.CE only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)K29.CE only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)K29.CE only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.CE only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.CE only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)K29.NZ only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)K29.NZ only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)K29.NZ only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)K29.NZ only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)K29.NZ only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.NZ only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.NZ only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.O only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)K29.C only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.CA only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.CB only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.CG only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.CD1 only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.CD2 only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.O only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L30.C only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T31.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T31.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T31.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T31.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T31.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T31.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T31.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T31.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T31.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T31.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T31.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T31.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T31.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T31.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T31.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T31.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T31.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T31.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T31.CA only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T31.CB only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T31.CG2 only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T31.OG1 only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T31.O only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T31.C only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)S32.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)S32.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)S32.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)S32.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)S32.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)S32.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)S32.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)S32.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)S32.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)S32.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)S32.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)S32.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)S32.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)S32.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)S32.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)S32.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)S32.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)S32.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)S32.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)S32.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)S32.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)S32.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)S32.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)S32.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)S32.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)S32.N and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)S32.CA only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)S32.CB only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.N and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)T31.C and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)T31.O and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)T31.N and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.C and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.O and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)S32.OG only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)S32.O only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)S32.C only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)L33.N and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.CA only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.CB only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.N and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.CG only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.CD1 only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.CD2 only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.O only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)L33.C only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CA only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CB only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CG only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CD1 only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CD2 only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CE1 only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CE2 only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.CZ only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.O only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)F34.C only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.CA only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.CB only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.CG only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.CD only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.OE1 only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.NE2 only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.O only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)Q35.C only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.CA only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.CB only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.CG only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.CD only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.NE only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.CZ only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.NH1 only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.NH2 only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.O only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)R36.C only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.N only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.N only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.N only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.N only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.N only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.N only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.N only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.N only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.N only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.N only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.N only 0.000 apart, marking (T0354)M37.N as missing WARNING: atoms too close: (T0354)M37.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.CA only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.CB only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.CG only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.SD only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.CE only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.O only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)M37.C only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.N only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.N only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.N only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.N only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.N only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.N only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.N only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.N only 0.000 apart, marking (T0354)M37.N as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.N only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.N only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.N only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.N only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.N only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.N only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.N only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.N only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.N only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.N only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.N only 0.000 apart, marking (T0354)I38.N as missing WARNING: atoms too close: (T0354)I38.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.CA only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)I38.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.CB only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.CG1 only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.CG2 only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.CD1 only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.O only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)M37.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)I38.C only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.C and (T0354)V39.N only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)V39.N only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)V39.N only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)V39.N only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)V39.N only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)V39.N only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)V39.N only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)V39.N only 0.000 apart, marking (T0354)I38.N as missing WARNING: atoms too close: (T0354)M37.C and (T0354)V39.N only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)V39.N only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)V39.N only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)V39.N only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)V39.N only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)V39.N only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)V39.N only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)V39.N only 0.000 apart, marking (T0354)M37.N as missing WARNING: atoms too close: (T0354)R36.C and (T0354)V39.N only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)V39.N only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)V39.N only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)V39.N only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)V39.N only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)V39.N only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)V39.N only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)V39.N only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)V39.N only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)V39.N only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)V39.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)V39.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)V39.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)V39.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)V39.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)V39.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)V39.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)V39.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)V39.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)V39.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)V39.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)V39.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)V39.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)V39.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)V39.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)V39.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)V39.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)V39.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)V39.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)V39.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)V39.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)V39.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)V39.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)V39.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)V39.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)V39.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)V39.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)V39.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)V39.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)V39.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)V39.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)V39.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)V39.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)V39.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)V39.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)V39.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)V39.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)V39.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)V39.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)V39.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)V39.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)V39.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)V39.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)V39.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)V39.N only 0.000 apart, marking (T0354)V39.N as missing WARNING: atoms too close: (T0354)V39.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)V39.CA only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)V39.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)I38.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)M37.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)R36.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)V39.CB only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)V39.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)V39.CG1 only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)V39.CG2 only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)I38.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)M37.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)V39.O only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)I38.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)M37.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)V39.C only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.C and (T0354)A40.N only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)A40.N only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)A40.N only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)A40.N only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)A40.N only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)A40.N only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)A40.N only 0.000 apart, marking (T0354)V39.N as missing WARNING: atoms too close: (T0354)I38.C and (T0354)A40.N only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)A40.N only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)A40.N only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)A40.N only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)A40.N only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)A40.N only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)A40.N only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)A40.N only 0.000 apart, marking (T0354)I38.N as missing WARNING: atoms too close: (T0354)M37.C and (T0354)A40.N only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)A40.N only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)A40.N only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)A40.N only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)A40.N only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)A40.N only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)A40.N only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)A40.N only 0.000 apart, marking (T0354)M37.N as missing WARNING: atoms too close: (T0354)R36.C and (T0354)A40.N only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)A40.N only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)A40.N only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)A40.N only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)A40.N only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)A40.N only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)A40.N only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)A40.N only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)A40.N only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)A40.N only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)A40.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)A40.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)A40.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)A40.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)A40.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)A40.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)A40.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)A40.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)A40.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)A40.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)A40.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)A40.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)A40.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)A40.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)A40.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)A40.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)A40.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)A40.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)A40.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)A40.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)A40.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)A40.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)A40.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)A40.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)A40.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)A40.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)A40.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)A40.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)A40.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)A40.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)A40.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)A40.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)A40.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)A40.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)A40.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)A40.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)A40.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)A40.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)A40.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)A40.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)A40.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)A40.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)A40.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)A40.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)A40.N only 0.000 apart, marking (T0354)A40.N as missing WARNING: atoms too close: (T0354)A40.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)V39.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)V39.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)A40.CA only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)A40.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)V39.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)V39.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)V39.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)I38.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)M37.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)R36.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)A40.CB only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)A40.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)V39.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)V39.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)V39.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)I38.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)M37.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)A40.O only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)A40.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)A40.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)V39.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)V39.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)I38.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)M37.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)A40.C only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)A40.C and (T0354)T41.N only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)A40.O and (T0354)T41.N only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)T41.N only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)T41.N only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)A40.N and (T0354)T41.N only 0.000 apart, marking (T0354)A40.N as missing WARNING: atoms too close: (T0354)V39.C and (T0354)T41.N only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)T41.N only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)T41.N only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)T41.N only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)T41.N only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)T41.N only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)T41.N only 0.000 apart, marking (T0354)V39.N as missing WARNING: atoms too close: (T0354)I38.C and (T0354)T41.N only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)T41.N only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)T41.N only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)T41.N only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)T41.N only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)T41.N only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)T41.N only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)T41.N only 0.000 apart, marking (T0354)I38.N as missing WARNING: atoms too close: (T0354)M37.C and (T0354)T41.N only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)T41.N only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)T41.N only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)T41.N only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)T41.N only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)T41.N only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)T41.N only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)T41.N only 0.000 apart, marking (T0354)M37.N as missing WARNING: atoms too close: (T0354)R36.C and (T0354)T41.N only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)T41.N only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)T41.N only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)T41.N only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)T41.N only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)T41.N only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)T41.N only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)T41.N only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)T41.N only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)T41.N only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)T41.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)T41.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)T41.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)T41.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)T41.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)T41.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)T41.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)T41.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)T41.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)T41.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)T41.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)T41.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)T41.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)T41.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)T41.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)T41.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)T41.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)T41.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)T41.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)T41.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)T41.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T41.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T41.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T41.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T41.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T41.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T41.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T41.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T41.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T41.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T41.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T41.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T41.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T41.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T41.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T41.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T41.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T41.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T41.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T41.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T41.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T41.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T41.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T41.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T41.N only 0.000 apart, marking (T0354)T41.N as missing WARNING: atoms too close: (T0354)T41.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)A40.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)A40.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)A40.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)V39.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)V39.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T41.CA only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T41.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)A40.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)A40.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)A40.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)V39.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)V39.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)V39.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)I38.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)M37.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)R36.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T41.CB only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T41.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)A40.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)A40.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)A40.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)V39.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)V39.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)V39.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T41.CG2 only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T41.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)A40.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)A40.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)A40.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)V39.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)V39.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)V39.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T41.OG1 only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T41.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)A40.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)A40.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)A40.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)V39.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)V39.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)V39.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)I38.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)M37.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T41.O only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T41.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)A40.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)A40.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)A40.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)V39.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)V39.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)I38.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)M37.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)T41.C only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.C and (T0354)G42.N only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.O and (T0354)G42.N only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)G42.N only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)G42.N only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)G42.N only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)G42.N only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T41.N and (T0354)G42.N only 0.000 apart, marking (T0354)T41.N as missing WARNING: atoms too close: (T0354)A40.C and (T0354)G42.N only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)A40.O and (T0354)G42.N only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)G42.N only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)G42.N only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)A40.N and (T0354)G42.N only 0.000 apart, marking (T0354)A40.N as missing WARNING: atoms too close: (T0354)V39.C and (T0354)G42.N only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)G42.N only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)G42.N only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)G42.N only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)G42.N only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)G42.N only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)G42.N only 0.000 apart, marking (T0354)V39.N as missing WARNING: atoms too close: (T0354)I38.C and (T0354)G42.N only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)G42.N only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)G42.N only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)G42.N only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)G42.N only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)G42.N only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)G42.N only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)G42.N only 0.000 apart, marking (T0354)I38.N as missing WARNING: atoms too close: (T0354)M37.C and (T0354)G42.N only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)G42.N only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)G42.N only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)G42.N only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)G42.N only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)G42.N only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)G42.N only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)G42.N only 0.000 apart, marking (T0354)M37.N as missing WARNING: atoms too close: (T0354)R36.C and (T0354)G42.N only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)G42.N only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)G42.N only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)G42.N only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)G42.N only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)G42.N only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)G42.N only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)G42.N only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)G42.N only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)G42.N only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)G42.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)G42.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)G42.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)G42.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)G42.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)G42.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)G42.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)G42.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)G42.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)G42.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)G42.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)G42.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)G42.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)G42.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)G42.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)G42.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)G42.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)G42.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)G42.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)G42.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)G42.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)G42.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)G42.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)G42.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)G42.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)G42.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)G42.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)G42.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)G42.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)G42.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)G42.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)G42.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)G42.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)G42.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)G42.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)G42.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)G42.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)G42.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)G42.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)G42.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)G42.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)G42.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)G42.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)G42.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)G42.N only 0.000 apart, marking (T0354)G42.N as missing WARNING: atoms too close: (T0354)G42.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T41.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T41.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T41.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)A40.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)A40.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)A40.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)V39.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)V39.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)G42.CA only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)G42.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T41.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T41.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T41.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)A40.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)A40.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)A40.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)V39.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)V39.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)V39.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)I38.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)M37.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)G42.O only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)G42.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)G42.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T41.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T41.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T41.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)A40.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)A40.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)A40.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)V39.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)V39.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)I38.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)M37.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)G42.C only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.N only 0.000 apart, marking (T0354)G42.C as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.N only 0.000 apart, marking (T0354)G42.O as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.N only 0.000 apart, marking (T0354)G42.CA as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.N only 0.000 apart, marking (T0354)G42.N as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.N only 0.000 apart, marking (T0354)T41.C as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.N only 0.000 apart, marking (T0354)T41.O as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.N only 0.000 apart, marking (T0354)T41.OG1 as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.N only 0.000 apart, marking (T0354)T41.CG2 as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.N only 0.000 apart, marking (T0354)T41.CB as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.N only 0.000 apart, marking (T0354)T41.CA as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.N only 0.000 apart, marking (T0354)T41.N as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.N only 0.000 apart, marking (T0354)A40.C as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.N only 0.000 apart, marking (T0354)A40.O as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.N only 0.000 apart, marking (T0354)A40.CB as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.N only 0.000 apart, marking (T0354)A40.CA as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.N only 0.000 apart, marking (T0354)A40.N as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.N only 0.000 apart, marking (T0354)V39.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.N only 0.000 apart, marking (T0354)V39.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.N only 0.000 apart, marking (T0354)V39.CG2 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.N only 0.000 apart, marking (T0354)V39.CG1 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.N only 0.000 apart, marking (T0354)V39.CB as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.N only 0.000 apart, marking (T0354)V39.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.N only 0.000 apart, marking (T0354)V39.N as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.N only 0.000 apart, marking (T0354)I38.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.N only 0.000 apart, marking (T0354)I38.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.N only 0.000 apart, marking (T0354)I38.CD1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.N only 0.000 apart, marking (T0354)I38.CG2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.N only 0.000 apart, marking (T0354)I38.CG1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.N only 0.000 apart, marking (T0354)I38.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.N only 0.000 apart, marking (T0354)I38.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.N only 0.000 apart, marking (T0354)I38.N as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.N only 0.000 apart, marking (T0354)M37.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.N only 0.000 apart, marking (T0354)M37.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.N only 0.000 apart, marking (T0354)M37.CE as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.N only 0.000 apart, marking (T0354)M37.SD as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.N only 0.000 apart, marking (T0354)M37.CG as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.N only 0.000 apart, marking (T0354)M37.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.N only 0.000 apart, marking (T0354)M37.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.N only 0.000 apart, marking (T0354)M37.N as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.N only 0.000 apart, marking (T0354)R36.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.N only 0.000 apart, marking (T0354)R36.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.N only 0.000 apart, marking (T0354)R36.NH2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.N only 0.000 apart, marking (T0354)R36.NH1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.N only 0.000 apart, marking (T0354)R36.CZ as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.N only 0.000 apart, marking (T0354)R36.NE as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.N only 0.000 apart, marking (T0354)R36.CD as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.N only 0.000 apart, marking (T0354)R36.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.N only 0.000 apart, marking (T0354)R36.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.N only 0.000 apart, marking (T0354)R36.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.N only 0.000 apart, marking (T0354)R36.N as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.NE2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.OE1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.CD as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.N only 0.000 apart, marking (T0354)Q35.N as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.N only 0.000 apart, marking (T0354)F34.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.N only 0.000 apart, marking (T0354)F34.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CZ as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CE2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CE1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.N only 0.000 apart, marking (T0354)F34.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.N only 0.000 apart, marking (T0354)F34.N as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.N only 0.000 apart, marking (T0354)L33.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.N only 0.000 apart, marking (T0354)L33.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.N only 0.000 apart, marking (T0354)L33.CD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.N only 0.000 apart, marking (T0354)L33.CD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.N only 0.000 apart, marking (T0354)L33.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.N only 0.000 apart, marking (T0354)L33.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.N only 0.000 apart, marking (T0354)L33.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.N only 0.000 apart, marking (T0354)L33.N as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.N only 0.000 apart, marking (T0354)S32.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.N only 0.000 apart, marking (T0354)S32.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.N only 0.000 apart, marking (T0354)S32.OG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.N only 0.000 apart, marking (T0354)S32.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.N only 0.000 apart, marking (T0354)S32.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.N only 0.000 apart, marking (T0354)S32.N as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.N only 0.000 apart, marking (T0354)T31.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.N only 0.000 apart, marking (T0354)T31.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.N only 0.000 apart, marking (T0354)T31.OG1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.N only 0.000 apart, marking (T0354)T31.CG2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.N only 0.000 apart, marking (T0354)T31.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.N only 0.000 apart, marking (T0354)T31.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.N only 0.000 apart, marking (T0354)T31.N as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.N only 0.000 apart, marking (T0354)L30.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.N only 0.000 apart, marking (T0354)L30.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.N only 0.000 apart, marking (T0354)L30.CD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.N only 0.000 apart, marking (T0354)L30.CD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.N only 0.000 apart, marking (T0354)L30.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.N only 0.000 apart, marking (T0354)L30.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.N only 0.000 apart, marking (T0354)L30.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.N only 0.000 apart, marking (T0354)L30.N as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.N only 0.000 apart, marking (T0354)K29.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.N only 0.000 apart, marking (T0354)K29.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.N only 0.000 apart, marking (T0354)K29.NZ as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.N only 0.000 apart, marking (T0354)K29.CE as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.N only 0.000 apart, marking (T0354)K29.CD as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.N only 0.000 apart, marking (T0354)K29.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.N only 0.000 apart, marking (T0354)K29.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.N only 0.000 apart, marking (T0354)K29.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.N only 0.000 apart, marking (T0354)K29.N as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.N only 0.000 apart, marking (T0354)D43.N as missing WARNING: atoms too close: (T0354)D43.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.CA only 0.000 apart, marking (T0354)D43.CA as missing WARNING: atoms too close: (T0354)D43.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)D43.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.CB only 0.000 apart, marking (T0354)D43.CB as missing WARNING: atoms too close: (T0354)D43.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)D43.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)D43.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.CG only 0.000 apart, marking (T0354)D43.CG as missing WARNING: atoms too close: (T0354)D43.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)D43.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)D43.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)D43.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.OD1 only 0.000 apart, marking (T0354)D43.OD1 as missing WARNING: atoms too close: (T0354)D43.OD1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)D43.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)D43.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)D43.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)D43.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.OD2 only 0.000 apart, marking (T0354)D43.OD2 as missing WARNING: atoms too close: (T0354)D43.OD2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)D43.OD1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)D43.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)D43.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)D43.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)D43.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.O only 0.000 apart, marking (T0354)D43.O as missing WARNING: atoms too close: (T0354)D43.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)D43.OD2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)D43.OD1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)D43.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)D43.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)D43.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)D43.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)G42.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)G42.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)G42.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)G42.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T41.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T41.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T41.OG1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T41.CG2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T41.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T41.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T41.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)A40.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)A40.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)A40.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)A40.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)A40.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)V39.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)V39.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)V39.CG2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)V39.CG1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)V39.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)V39.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)V39.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.CD1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.CG2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.CG1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)I38.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.CE and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.SD and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)M37.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.NH2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.NH1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.CZ and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.NE and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.CD and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)R36.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.NE2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.OE1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.CD and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)Q35.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CZ and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CE2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CE1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CD2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CD1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)F34.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.CD2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.CD1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L33.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)S32.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)S32.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)S32.OG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)S32.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)S32.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)S32.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T31.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T31.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T31.OG1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T31.CG2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T31.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T31.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)T31.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.CD2 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.CD1 and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)L30.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.O and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.NZ and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.CE and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.CD and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.CG and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.CB and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.CA and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)K29.N and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing WARNING: atoms too close: (T0354)S28.C and (T0354)D43.C only 0.000 apart, marking (T0354)D43.C as missing # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0354)L91.C and (T0354)P92.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)P92.N and (T0354)P92.CA only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)P92.CA only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)P92.CB only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)P92.CB only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)P92.CB only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)P92.CG only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)P92.CG only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)P92.CG only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)P92.CG only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)P92.CD only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)P92.CD only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)P92.CD only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.N and (T0354)P92.CD only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)L91.C and (T0354)P92.CD only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)P92.O only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)P92.O only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)P92.O only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)P92.O only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)P92.O only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)P92.O only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)P92.C only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)P92.C only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)P92.C only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)P92.C only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)P92.C only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)P92.C only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)P92.C only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A93.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A93.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A93.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A93.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A93.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A93.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A93.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A93.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A93.CA only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A93.CB only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A93.O only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A93.C only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)V94.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)V94.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)V94.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)V94.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)V94.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)V94.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)V94.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)V94.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)V94.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)V94.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)V94.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)V94.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)V94.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)V94.N and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)V94.CA only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)V94.CB only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)V94.CG1 only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)V94.CG2 only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)V94.O only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)V94.C only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.CA only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.CB only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.CG only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.CD only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.NE only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.CZ only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.NH1 only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.NH2 only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.O only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)R95.C only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.CA only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.CB only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.CG only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.OD1 only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.OD2 only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.O only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D96.C only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CA only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CB only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CG only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CD1 only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CD2 only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CE1 only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CE2 only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.CZ only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.OH only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.O only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y97.C only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CA only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CB only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CG only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CD1 only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CD2 only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CE1 only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CE2 only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.CZ only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.OH only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.O only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Y98.C only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)D99.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.CA only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.CB only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.CG only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.OD1 only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.OD2 only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.O only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)D99.C only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)I100.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.CA only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.CB only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.CG1 only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.CG2 only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.CD1 only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.O only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)I100.C only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.CA only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.CB only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.CG only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.CD only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.OE1 only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.OE2 only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.O only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)E101.C only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)A102.N only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)A102.N only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)A102.N only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)A102.N only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)A102.N only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)A102.N only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)A102.N only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)A102.N only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)A102.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)I100.C and (T0354)A102.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)A102.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)A102.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)A102.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)A102.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)A102.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)A102.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)A102.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)A102.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)A102.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)A102.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)A102.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)A102.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)A102.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)A102.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)A102.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)A102.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)A102.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)A102.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)A102.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)A102.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)A102.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)A102.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)A102.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)A102.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)A102.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)A102.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)A102.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)A102.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)A102.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)A102.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)A102.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)A102.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)A102.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)A102.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)A102.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)A102.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)A102.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)A102.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)A102.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)A102.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)A102.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)A102.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)A102.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)A102.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)A102.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)A102.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A102.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A102.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A102.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A102.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A102.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A102.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A102.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A102.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A102.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A102.N only 0.000 apart, marking (T0354)A102.N as missing WARNING: atoms too close: (T0354)A102.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A102.CA only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)E101.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)I100.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A102.CB only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A102.O only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)A102.C only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.N only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.N only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.N only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.N only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.N only 0.000 apart, marking (T0354)A102.N as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.N only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.N only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.N only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.N only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.N only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.N only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.N only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.N only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.N only 0.000 apart, marking (T0354)L103.N as missing WARNING: atoms too close: (T0354)L103.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.CA only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L103.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.CB only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.CG only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.CD1 only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.CD2 only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.O only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A102.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A102.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)L103.C only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.N only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.N only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.N only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.N only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.N only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.N only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.N only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.N only 0.000 apart, marking (T0354)L103.N as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.N only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.N only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.N only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.N only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.N only 0.000 apart, marking (T0354)A102.N as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.N only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.N only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.N only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.N only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.N only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.N only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.N only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.N only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.N only 0.000 apart, marking (T0354)W104.N as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CA only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CB only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CG only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CD1 only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CD2 only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CE2 only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CE3 only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.NE1 only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CZ2 only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CZ3 only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.CH2 only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.O only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L103.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A102.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A102.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)W104.C only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G105.N only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G105.N only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G105.N only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G105.N only 0.000 apart, marking (T0354)W104.N as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G105.N only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G105.N only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G105.N only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G105.N only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G105.N only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G105.N only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G105.N only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G105.N only 0.000 apart, marking (T0354)L103.N as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G105.N only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G105.N only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G105.N only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G105.N only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G105.N only 0.000 apart, marking (T0354)A102.N as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G105.N only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G105.N only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G105.N only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G105.N only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G105.N only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G105.N only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G105.N only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G105.N only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G105.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G105.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G105.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G105.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G105.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G105.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G105.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G105.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G105.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G105.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G105.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G105.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G105.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G105.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G105.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G105.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G105.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G105.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G105.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G105.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G105.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G105.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G105.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G105.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G105.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G105.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G105.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G105.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G105.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G105.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G105.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G105.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G105.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G105.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G105.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G105.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G105.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G105.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G105.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G105.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G105.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G105.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G105.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G105.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G105.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G105.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G105.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G105.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G105.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G105.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G105.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G105.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G105.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G105.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G105.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G105.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G105.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G105.N only 0.000 apart, marking (T0354)G105.N as missing WARNING: atoms too close: (T0354)G105.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G105.CA only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)G105.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G105.O only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)G105.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)G105.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G105.C only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)G105.C and (T0354)G106.N only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)G105.O and (T0354)G106.N only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)G106.N only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)G105.N and (T0354)G106.N only 0.000 apart, marking (T0354)G105.N as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G106.N only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G106.N only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G106.N only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G106.N only 0.000 apart, marking (T0354)W104.N as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G106.N only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G106.N only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G106.N only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G106.N only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G106.N only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G106.N only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G106.N only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G106.N only 0.000 apart, marking (T0354)L103.N as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G106.N only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G106.N only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G106.N only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G106.N only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G106.N only 0.000 apart, marking (T0354)A102.N as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G106.N only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G106.N only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G106.N only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G106.N only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G106.N only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G106.N only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G106.N only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G106.N only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G106.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G106.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G106.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G106.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G106.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G106.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G106.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G106.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G106.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G106.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G106.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G106.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G106.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G106.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G106.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G106.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G106.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G106.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G106.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G106.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G106.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G106.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G106.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G106.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G106.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G106.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G106.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G106.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G106.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G106.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G106.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G106.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G106.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G106.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G106.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G106.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G106.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G106.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G106.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G106.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G106.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G106.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G106.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G106.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G106.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G106.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G106.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G106.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G106.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G106.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G106.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G106.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G106.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G106.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G106.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G106.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G106.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G106.N only 0.000 apart, marking (T0354)G106.N as missing WARNING: atoms too close: (T0354)G106.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)G105.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)G105.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)G105.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G106.CA only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G106.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G105.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G105.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G105.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G106.O only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G106.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G106.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G105.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G105.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G105.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)W104.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L103.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A102.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A102.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)G106.C only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.N only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.N only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.N only 0.000 apart, marking (T0354)G106.N as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.N only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.N only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.N only 0.000 apart, marking (T0354)G105.N as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.N only 0.000 apart, marking (T0354)W104.N as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.N only 0.000 apart, marking (T0354)L103.N as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.N only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.N only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.N only 0.000 apart, marking (T0354)A102.N as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.N only 0.000 apart, marking (T0354)Q107.N as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.CA only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.CB only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.CG only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.CD only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.OE1 only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.NE2 only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.O only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G106.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G106.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G106.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G105.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G105.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)G105.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)W104.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L103.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A102.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A102.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)Q107.C only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.C as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.O as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.NE2 as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.OE1 as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.CD as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.CG as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.CB as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.CA as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.N only 0.000 apart, marking (T0354)Q107.N as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.N only 0.000 apart, marking (T0354)G106.C as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.N only 0.000 apart, marking (T0354)G106.O as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.N only 0.000 apart, marking (T0354)G106.CA as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.N only 0.000 apart, marking (T0354)G106.N as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.N only 0.000 apart, marking (T0354)G105.C as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.N only 0.000 apart, marking (T0354)G105.O as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.N only 0.000 apart, marking (T0354)G105.CA as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.N only 0.000 apart, marking (T0354)G105.N as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.N only 0.000 apart, marking (T0354)W104.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.N only 0.000 apart, marking (T0354)W104.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CH2 as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CZ3 as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CZ2 as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.NE1 as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CE3 as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CE2 as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CD2 as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CD1 as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CG as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CB as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.N only 0.000 apart, marking (T0354)W104.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.N only 0.000 apart, marking (T0354)W104.N as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.N only 0.000 apart, marking (T0354)L103.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.N only 0.000 apart, marking (T0354)L103.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.N only 0.000 apart, marking (T0354)L103.CD2 as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.N only 0.000 apart, marking (T0354)L103.CD1 as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.N only 0.000 apart, marking (T0354)L103.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.N only 0.000 apart, marking (T0354)L103.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.N only 0.000 apart, marking (T0354)L103.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.N only 0.000 apart, marking (T0354)L103.N as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.N only 0.000 apart, marking (T0354)A102.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.N only 0.000 apart, marking (T0354)A102.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.N only 0.000 apart, marking (T0354)A102.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.N only 0.000 apart, marking (T0354)A102.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.N only 0.000 apart, marking (T0354)A102.N as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.N only 0.000 apart, marking (T0354)E101.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.N only 0.000 apart, marking (T0354)E101.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.N only 0.000 apart, marking (T0354)E101.OE2 as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.N only 0.000 apart, marking (T0354)E101.OE1 as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.N only 0.000 apart, marking (T0354)E101.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.N only 0.000 apart, marking (T0354)E101.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.N only 0.000 apart, marking (T0354)E101.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.N only 0.000 apart, marking (T0354)E101.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.N only 0.000 apart, marking (T0354)E101.N as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.N only 0.000 apart, marking (T0354)I100.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.N only 0.000 apart, marking (T0354)I100.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.N only 0.000 apart, marking (T0354)I100.CD1 as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.N only 0.000 apart, marking (T0354)I100.CG2 as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.N only 0.000 apart, marking (T0354)I100.CG1 as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.N only 0.000 apart, marking (T0354)I100.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.N only 0.000 apart, marking (T0354)I100.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.N only 0.000 apart, marking (T0354)I100.N as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.N only 0.000 apart, marking (T0354)D99.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.N only 0.000 apart, marking (T0354)D99.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.N only 0.000 apart, marking (T0354)D99.OD2 as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.N only 0.000 apart, marking (T0354)D99.OD1 as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.N only 0.000 apart, marking (T0354)D99.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.N only 0.000 apart, marking (T0354)D99.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.N only 0.000 apart, marking (T0354)D99.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.N only 0.000 apart, marking (T0354)D99.N as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.OH as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CE2 as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CE1 as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CD2 as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CD1 as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.N only 0.000 apart, marking (T0354)Y98.N as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.OH as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CE2 as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CE1 as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CD2 as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CD1 as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.N only 0.000 apart, marking (T0354)Y97.N as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.N only 0.000 apart, marking (T0354)D96.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.N only 0.000 apart, marking (T0354)D96.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.N only 0.000 apart, marking (T0354)D96.OD2 as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.N only 0.000 apart, marking (T0354)D96.OD1 as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.N only 0.000 apart, marking (T0354)D96.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.N only 0.000 apart, marking (T0354)D96.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.N only 0.000 apart, marking (T0354)D96.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.N only 0.000 apart, marking (T0354)D96.N as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.N only 0.000 apart, marking (T0354)R95.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.N only 0.000 apart, marking (T0354)R95.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.N only 0.000 apart, marking (T0354)R95.NH2 as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.N only 0.000 apart, marking (T0354)R95.NH1 as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.N only 0.000 apart, marking (T0354)R95.CZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.N only 0.000 apart, marking (T0354)R95.NE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.N only 0.000 apart, marking (T0354)R95.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.N only 0.000 apart, marking (T0354)R95.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.N only 0.000 apart, marking (T0354)R95.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.N only 0.000 apart, marking (T0354)R95.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.N only 0.000 apart, marking (T0354)R95.N as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.N only 0.000 apart, marking (T0354)V94.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.N only 0.000 apart, marking (T0354)V94.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.N only 0.000 apart, marking (T0354)V94.CG2 as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.N only 0.000 apart, marking (T0354)V94.CG1 as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.N only 0.000 apart, marking (T0354)V94.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.N only 0.000 apart, marking (T0354)V94.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.N only 0.000 apart, marking (T0354)V94.N as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.N only 0.000 apart, marking (T0354)A93.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.N only 0.000 apart, marking (T0354)A93.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.N only 0.000 apart, marking (T0354)A93.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.N only 0.000 apart, marking (T0354)A93.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.N only 0.000 apart, marking (T0354)A93.N as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.N only 0.000 apart, marking (T0354)P92.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.N only 0.000 apart, marking (T0354)P92.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.N only 0.000 apart, marking (T0354)P92.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.N only 0.000 apart, marking (T0354)P92.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.N only 0.000 apart, marking (T0354)P92.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.N only 0.000 apart, marking (T0354)P92.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.N only 0.000 apart, marking (T0354)P92.N as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.N only 0.000 apart, marking (T0354)K108.N as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.CA only 0.000 apart, marking (T0354)K108.CA as missing WARNING: atoms too close: (T0354)K108.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.CB only 0.000 apart, marking (T0354)K108.CB as missing WARNING: atoms too close: (T0354)K108.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)K108.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.CG only 0.000 apart, marking (T0354)K108.CG as missing WARNING: atoms too close: (T0354)K108.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)K108.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)K108.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.CD only 0.000 apart, marking (T0354)K108.CD as missing WARNING: atoms too close: (T0354)K108.CD and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)K108.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)K108.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)K108.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.CE only 0.000 apart, marking (T0354)K108.CE as missing WARNING: atoms too close: (T0354)K108.CE and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)K108.CD and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)K108.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)K108.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)K108.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.NZ only 0.000 apart, marking (T0354)K108.NZ as missing WARNING: atoms too close: (T0354)K108.NZ and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)K108.CE and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)K108.CD and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)K108.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)K108.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)K108.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.O only 0.000 apart, marking (T0354)K108.O as missing WARNING: atoms too close: (T0354)K108.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)K108.NZ and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)K108.CE and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)K108.CD and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)K108.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)K108.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)K108.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)K108.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.NE2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.OE1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.CD and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Q107.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G106.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G106.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G106.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G106.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G105.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G105.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G105.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)G105.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CH2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CZ3 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CZ2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.NE1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CE3 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CE2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CD2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CD1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)W104.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.CD2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.CD1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L103.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A102.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A102.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A102.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A102.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A102.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.OE2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.OE1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.CD and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)E101.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.CD1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.CG2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.CG1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)I100.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.OD2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.OD1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D99.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.OH and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CZ and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CE2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CE1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CD2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CD1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y98.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.OH and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CZ and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CE2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CE1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CD2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CD1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)Y97.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.OD2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.OD1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)D96.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.NH2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.NH1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.CZ and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.NE and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.CD and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)R95.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)V94.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)V94.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)V94.CG2 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)V94.CG1 and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)V94.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)V94.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)V94.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A93.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A93.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A93.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A93.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)A93.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)P92.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)P92.O and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)P92.CD and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)P92.CG and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)P92.CB and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)P92.CA and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)P92.N and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing WARNING: atoms too close: (T0354)L91.C and (T0354)K108.C only 0.000 apart, marking (T0354)K108.C as missing # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # Found a chain break before 113 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # Found a chain break before 117 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # Found a chain break before 115 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # Found a chain break before 116 # copying to AlignedFragments data structure # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 100 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 110 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 84 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 120 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 Skipped atom 179, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL2.pdb.gz # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 Skipped atom 179, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL2.pdb.gz # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 112 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 38 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 63 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 65 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # Found a chain break before 62 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # Found a chain break before 75 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 Skipped atom 395, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL5.pdb.gz Skipped atom 397, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL5.pdb.gz Skipped atom 399, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL5.pdb.gz Skipped atom 401, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL5.pdb.gz Skipped atom 403, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL5.pdb.gz # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 117 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 124 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/Frankenstein_TS1.pdb.gz looking for model 1 # Found a chain break before 92 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS1 # ReadConformPDB reading from PDB file servers/Frankenstein_TS2.pdb.gz looking for model 1 # Found a chain break before 33 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS2 # ReadConformPDB reading from PDB file servers/Frankenstein_TS3.pdb.gz looking for model 1 # naming current conformation Frankenstein_TS3 # ReadConformPDB reading from PDB file servers/Frankenstein_TS4.pdb.gz looking for model 1 # Found a chain break before 90 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS1.pdb.gz looking for model 1 # Found a chain break before 17 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS2.pdb.gz looking for model 1 # Found a chain break before 114 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS3.pdb.gz looking for model 1 # Found a chain break before 36 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS4.pdb.gz looking for model 1 # Found a chain break before 85 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS5.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server2_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 103 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 114 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 118 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # Found a chain break before 109 # copying to AlignedFragments data structure # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS1.pdb.gz looking for model 1 # Found a chain break before 115 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS2.pdb.gz looking for model 1 # Found a chain break before 117 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS2 # ReadConformPDB reading from PDB file servers/POMYSL_TS3.pdb.gz looking for model 1 # Found a chain break before 98 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS3 # ReadConformPDB reading from PDB file servers/POMYSL_TS4.pdb.gz looking for model 1 # Found a chain break before 99 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS4 # ReadConformPDB reading from PDB file servers/POMYSL_TS5.pdb.gz looking for model 1 # Found a chain break before 86 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # Found a chain break before 91 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # Found a chain break before 124 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # Found a chain break before 114 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # Found a chain break before 96 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 114 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 71 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 105 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 103 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 121 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 123 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 107 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 24 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 122 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 92 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 99 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 113 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 96 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 107 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM-T99_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 119 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 45 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 105 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 108 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 82 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 38 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 109 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 43 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 45 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 128 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 124 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 111 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 111 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 124 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 125 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 126 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # Found a chain break before 125 # copying to AlignedFragments data structure # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 97 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 97 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 97 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 97 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0354)A121.O and (T0354)V122.N only 0.000 apart, marking (T0354)V122.N as missing # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 # Found a chain break before 124 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 # Found a chain break before 127 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0354)H88.O and (T0354)V89.N only 0.000 apart, marking (T0354)V89.N as missing # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # Found a chain break before 101 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 130 in servers/nFOLD_TS2.pdb.gz # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/panther2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation panther2_TS1 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0354 can't currently be optimized by undertaker # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score 2.1780 model score 1.9020 model score 2.2642 model score 2.1372 model score 2.2441 model score 1.0508 model score 0.9907 model score 1.1445 model score 0.9907 model score 0.9903 model score 1.6119 model score 2.1113 model score 2.1023 model score 1.8916 model score 0.9907 model score 1.4166 model score 1.1379 model score 1.3865 model score 1.5774 model score 1.3972 model score 1.1379 model score 1.3865 model score 1.1853 model score 1.1926 model score 1.3590 model score 1.2280 model score 2.0012 model score 2.0596 model score 1.7747 model score 1.7708 model score 1.8082 model score 1.7441 model score 1.4088 model score 1.7665 model score 1.5769 model score 1.2841 model score 1.2965 model score 1.6303 model score 1.2324 model score 1.2141 model score 1.6585 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.5908 model score 1.5784 model score 1.7179 model score 1.5568 model score 1.5079 model score 1.4630 model score 1.4088 model score 1.7665 model score 1.5079 model score 1.5769 model score 1.5736 model score 1.9642 model score 1.4606 model score 1.8081 model score 1.5163 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.8574 model score 1.9663 model score 1.9761 model score 2.0224 model score 1.9546 model score 2.1078 model score 1.5629 model score 1.7140 model score 1.2944 model score 1.7993 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.5190 model score 1.5361 model score 1.5630 model score 1.7038 model score 1.5058 model score 1.9071 model score 2.1975 model score 2.2101 model score 1.5454 model score 1.2905 model score 1.0518 model score 1.7811 model score 1.3514 model score 2.0113 model score 1.3822 model score 1.3822 model score 1.3582 model score 1.2771 model score 1.6375 model score 1.3521 model score 1.5153 model score 1.2688 model score 1.8492 model score 1.2651 model score 1.3301 model score 1.4236 model score 1.4573 model score 2.0909 model score 1.9862 model score 1.0690 model score 1.4708 model score 1.2573 model score 1.7762 model score 2.0241 model score 1.1403 model score 1.8506 model score 1.4526 model score 0.8277 model score 0.8273 model score 0.6412 model score 0.7676 model score 0.7393 model score 1.8375 model score 1.2220 model score 1.7184 model score 1.3157 model score 1.3972 model score 1.5877 model score 1.5407 model score 1.5212 model score 1.4983 model score 1.5040 model score 1.5741 model score 1.4929 model score 1.5660 model score 1.5119 model score 1.6510 model score 1.5764 model score 1.5755 model score 1.2839 model score 1.2452 model score 1.4779 model score 1.2839 model score 1.2565 model score 2.3072 model score 1.7963 model score 2.2803 model score 1.9174 model score 1.8372 model score 1.1927 model score 1.3439 model score 0.9016 model score 0.8436 model score 1.3444 model score 1.7744 model score 1.6776 model score 1.5247 model score 1.7622 model score 1.4758 model score 1.7370 model score 1.0045 model score 1.5215 model score 1.5055 model score 1.3524 model score 1.7449 model score 1.0698 model score 1.5206 model score 1.5548 model score 1.3688 model score 1.4042 model score 1.2650 model score 1.4856 model score 1.1927 model score 1.3351 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.4591 model score 0.8255 model score 1.1654 model score 1.4239 model score 1.1127 model score 2.0003 model score 1.7622 model score 1.5247 model score 1.7475 model score 1.5492 model score 1.7852 model score 1.7475 model score 1.6947 model score 1.4864 model score 0.9447 model score 1.8375 model score 1.7663 model score 1.6616 model score 1.5350 model score 1.9588 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.6803 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 0.8052 model score 0.5819 model score 0.7732 model score 0.9401 model score 0.5390 model score 1.2242 model score 1.4329 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.5905 model score 1.4164 model score 1.8582 model score 1.1003 model score 1.2638 model score 2.2384 model score 2.2692 model score 1.8964 model score 1.6728 model score 1.8576 model score 1.1466 model score 1.3126 model score 1.7659 model score 1.5071 model score 1.7048 model score 1.9879 model score 1.9563 model score 1.7905 model score 2.1487 model score 1.6362 model score 1.6161 model score 1.5511 model score 1.4512 model score 1.3761 model score 1.5298 model score 1.5999 model score 1.3520 model score 1.9327 USE_META, weight: 0.1657 cost: 2.1780 min: 0.5390 max: 2.3072 USE_META, weight: 0.3062 cost: 1.9020 min: 0.5390 max: 2.3072 USE_META, weight: 0.1219 cost: 2.2642 min: 0.5390 max: 2.3072 USE_META, weight: 0.1865 cost: 2.1372 min: 0.5390 max: 2.3072 USE_META, weight: 0.1321 cost: 2.2441 min: 0.5390 max: 2.3072 USE_META, weight: 0.7395 cost: 1.0508 min: 0.5390 max: 2.3072 USE_META, weight: 0.7701 cost: 0.9907 min: 0.5390 max: 2.3072 USE_META, weight: 0.6918 cost: 1.1445 min: 0.5390 max: 2.3072 USE_META, weight: 0.7701 cost: 0.9907 min: 0.5390 max: 2.3072 USE_META, weight: 0.7703 cost: 0.9903 min: 0.5390 max: 2.3072 USE_META, weight: 0.4539 cost: 1.6119 min: 0.5390 max: 2.3072 USE_META, weight: 0.1997 cost: 2.1113 min: 0.5390 max: 2.3072 USE_META, weight: 0.2043 cost: 2.1023 min: 0.5390 max: 2.3072 USE_META, weight: 0.3115 cost: 1.8916 min: 0.5390 max: 2.3072 USE_META, weight: 0.7701 cost: 0.9907 min: 0.5390 max: 2.3072 USE_META, weight: 0.5533 cost: 1.4166 min: 0.5390 max: 2.3072 USE_META, weight: 0.6952 cost: 1.1379 min: 0.5390 max: 2.3072 USE_META, weight: 0.5687 cost: 1.3865 min: 0.5390 max: 2.3072 USE_META, weight: 0.4715 cost: 1.5774 min: 0.5390 max: 2.3072 USE_META, weight: 0.5632 cost: 1.3972 min: 0.5390 max: 2.3072 USE_META, weight: 0.6952 cost: 1.1379 min: 0.5390 max: 2.3072 USE_META, weight: 0.5687 cost: 1.3865 min: 0.5390 max: 2.3072 USE_META, weight: 0.6711 cost: 1.1853 min: 0.5390 max: 2.3072 USE_META, weight: 0.6673 cost: 1.1926 min: 0.5390 max: 2.3072 USE_META, weight: 0.5826 cost: 1.3590 min: 0.5390 max: 2.3072 USE_META, weight: 0.6493 cost: 1.2280 min: 0.5390 max: 2.3072 USE_META, weight: 0.2558 cost: 2.0012 min: 0.5390 max: 2.3072 USE_META, weight: 0.2260 cost: 2.0596 min: 0.5390 max: 2.3072 USE_META, weight: 0.3711 cost: 1.7747 min: 0.5390 max: 2.3072 USE_META, weight: 0.3730 cost: 1.7708 min: 0.5390 max: 2.3072 USE_META, weight: 0.3540 cost: 1.8082 min: 0.5390 max: 2.3072 USE_META, weight: 0.3866 cost: 1.7441 min: 0.5390 max: 2.3072 USE_META, weight: 0.5573 cost: 1.4088 min: 0.5390 max: 2.3072 USE_META, weight: 0.3752 cost: 1.7665 min: 0.5390 max: 2.3072 USE_META, weight: 0.4717 cost: 1.5769 min: 0.5390 max: 2.3072 USE_META, weight: 0.6207 cost: 1.2841 min: 0.5390 max: 2.3072 USE_META, weight: 0.6145 cost: 1.2965 min: 0.5390 max: 2.3072 USE_META, weight: 0.4445 cost: 1.6303 min: 0.5390 max: 2.3072 USE_META, weight: 0.6471 cost: 1.2324 min: 0.5390 max: 2.3072 USE_META, weight: 0.6564 cost: 1.2141 min: 0.5390 max: 2.3072 USE_META, weight: 0.4302 cost: 1.6585 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.4646 cost: 1.5908 min: 0.5390 max: 2.3072 USE_META, weight: 0.4710 cost: 1.5784 min: 0.5390 max: 2.3072 USE_META, weight: 0.4000 cost: 1.7179 min: 0.5390 max: 2.3072 USE_META, weight: 0.4819 cost: 1.5568 min: 0.5390 max: 2.3072 USE_META, weight: 0.5068 cost: 1.5079 min: 0.5390 max: 2.3072 USE_META, weight: 0.5297 cost: 1.4630 min: 0.5390 max: 2.3072 USE_META, weight: 0.5573 cost: 1.4088 min: 0.5390 max: 2.3072 USE_META, weight: 0.3752 cost: 1.7665 min: 0.5390 max: 2.3072 USE_META, weight: 0.5068 cost: 1.5079 min: 0.5390 max: 2.3072 USE_META, weight: 0.4717 cost: 1.5769 min: 0.5390 max: 2.3072 USE_META, weight: 0.4734 cost: 1.5736 min: 0.5390 max: 2.3072 USE_META, weight: 0.2746 cost: 1.9642 min: 0.5390 max: 2.3072 USE_META, weight: 0.5309 cost: 1.4606 min: 0.5390 max: 2.3072 USE_META, weight: 0.3540 cost: 1.8081 min: 0.5390 max: 2.3072 USE_META, weight: 0.5026 cost: 1.5163 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.3289 cost: 1.8574 min: 0.5390 max: 2.3072 USE_META, weight: 0.2735 cost: 1.9663 min: 0.5390 max: 2.3072 USE_META, weight: 0.2685 cost: 1.9761 min: 0.5390 max: 2.3072 USE_META, weight: 0.2450 cost: 2.0224 min: 0.5390 max: 2.3072 USE_META, weight: 0.2795 cost: 1.9546 min: 0.5390 max: 2.3072 USE_META, weight: 0.2015 cost: 2.1078 min: 0.5390 max: 2.3072 USE_META, weight: 0.4788 cost: 1.5629 min: 0.5390 max: 2.3072 USE_META, weight: 0.4020 cost: 1.7140 min: 0.5390 max: 2.3072 USE_META, weight: 0.6155 cost: 1.2944 min: 0.5390 max: 2.3072 USE_META, weight: 0.3585 cost: 1.7993 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.5012 cost: 1.5190 min: 0.5390 max: 2.3072 USE_META, weight: 0.4925 cost: 1.5361 min: 0.5390 max: 2.3072 USE_META, weight: 0.4788 cost: 1.5630 min: 0.5390 max: 2.3072 USE_META, weight: 0.4071 cost: 1.7038 min: 0.5390 max: 2.3072 USE_META, weight: 0.5079 cost: 1.5058 min: 0.5390 max: 2.3072 USE_META, weight: 0.3037 cost: 1.9071 min: 0.5390 max: 2.3072 USE_META, weight: 0.1558 cost: 2.1975 min: 0.5390 max: 2.3072 USE_META, weight: 0.1494 cost: 2.2101 min: 0.5390 max: 2.3072 USE_META, weight: 0.4878 cost: 1.5454 min: 0.5390 max: 2.3072 USE_META, weight: 0.6175 cost: 1.2905 min: 0.5390 max: 2.3072 USE_META, weight: 0.7390 cost: 1.0518 min: 0.5390 max: 2.3072 USE_META, weight: 0.3678 cost: 1.7811 min: 0.5390 max: 2.3072 USE_META, weight: 0.5865 cost: 1.3514 min: 0.5390 max: 2.3072 USE_META, weight: 0.2506 cost: 2.0113 min: 0.5390 max: 2.3072 USE_META, weight: 0.5708 cost: 1.3822 min: 0.5390 max: 2.3072 USE_META, weight: 0.5708 cost: 1.3822 min: 0.5390 max: 2.3072 USE_META, weight: 0.5830 cost: 1.3582 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.4409 cost: 1.6375 min: 0.5390 max: 2.3072 USE_META, weight: 0.5861 cost: 1.3521 min: 0.5390 max: 2.3072 USE_META, weight: 0.5031 cost: 1.5153 min: 0.5390 max: 2.3072 USE_META, weight: 0.6285 cost: 1.2688 min: 0.5390 max: 2.3072 USE_META, weight: 0.3331 cost: 1.8492 min: 0.5390 max: 2.3072 USE_META, weight: 0.6304 cost: 1.2651 min: 0.5390 max: 2.3072 USE_META, weight: 0.5973 cost: 1.3301 min: 0.5390 max: 2.3072 USE_META, weight: 0.5497 cost: 1.4236 min: 0.5390 max: 2.3072 USE_META, weight: 0.5326 cost: 1.4573 min: 0.5390 max: 2.3072 USE_META, weight: 0.2101 cost: 2.0909 min: 0.5390 max: 2.3072 USE_META, weight: 0.2634 cost: 1.9862 min: 0.5390 max: 2.3072 USE_META, weight: 0.7302 cost: 1.0690 min: 0.5390 max: 2.3072 USE_META, weight: 0.5257 cost: 1.4708 min: 0.5390 max: 2.3072 USE_META, weight: 0.6344 cost: 1.2573 min: 0.5390 max: 2.3072 USE_META, weight: 0.3703 cost: 1.7762 min: 0.5390 max: 2.3072 USE_META, weight: 0.2441 cost: 2.0241 min: 0.5390 max: 2.3072 USE_META, weight: 0.6939 cost: 1.1403 min: 0.5390 max: 2.3072 USE_META, weight: 0.3324 cost: 1.8506 min: 0.5390 max: 2.3072 USE_META, weight: 0.5350 cost: 1.4526 min: 0.5390 max: 2.3072 USE_META, weight: 0.8531 cost: 0.8277 min: 0.5390 max: 2.3072 USE_META, weight: 0.8533 cost: 0.8273 min: 0.5390 max: 2.3072 USE_META, weight: 0.9480 cost: 0.6412 min: 0.5390 max: 2.3072 USE_META, weight: 0.8837 cost: 0.7676 min: 0.5390 max: 2.3072 USE_META, weight: 0.8981 cost: 0.7393 min: 0.5390 max: 2.3072 USE_META, weight: 0.3391 cost: 1.8375 min: 0.5390 max: 2.3072 USE_META, weight: 0.6524 cost: 1.2220 min: 0.5390 max: 2.3072 USE_META, weight: 0.3997 cost: 1.7184 min: 0.5390 max: 2.3072 USE_META, weight: 0.6047 cost: 1.3157 min: 0.5390 max: 2.3072 USE_META, weight: 0.5632 cost: 1.3972 min: 0.5390 max: 2.3072 USE_META, weight: 0.4662 cost: 1.5877 min: 0.5390 max: 2.3072 USE_META, weight: 0.4901 cost: 1.5407 min: 0.5390 max: 2.3072 USE_META, weight: 0.5001 cost: 1.5212 min: 0.5390 max: 2.3072 USE_META, weight: 0.5117 cost: 1.4983 min: 0.5390 max: 2.3072 USE_META, weight: 0.5088 cost: 1.5040 min: 0.5390 max: 2.3072 USE_META, weight: 0.4732 cost: 1.5741 min: 0.5390 max: 2.3072 USE_META, weight: 0.5145 cost: 1.4929 min: 0.5390 max: 2.3072 USE_META, weight: 0.4773 cost: 1.5660 min: 0.5390 max: 2.3072 USE_META, weight: 0.5048 cost: 1.5119 min: 0.5390 max: 2.3072 USE_META, weight: 0.4340 cost: 1.6510 min: 0.5390 max: 2.3072 USE_META, weight: 0.4720 cost: 1.5764 min: 0.5390 max: 2.3072 USE_META, weight: 0.4725 cost: 1.5755 min: 0.5390 max: 2.3072 USE_META, weight: 0.6209 cost: 1.2839 min: 0.5390 max: 2.3072 USE_META, weight: 0.6406 cost: 1.2452 min: 0.5390 max: 2.3072 USE_META, weight: 0.5221 cost: 1.4779 min: 0.5390 max: 2.3072 USE_META, weight: 0.6209 cost: 1.2839 min: 0.5390 max: 2.3072 USE_META, weight: 0.6348 cost: 1.2565 min: 0.5390 max: 2.3072 USE_META, weight: 0.1000 cost: 2.3072 min: 0.5390 max: 2.3072 USE_META, weight: 0.3600 cost: 1.7963 min: 0.5390 max: 2.3072 USE_META, weight: 0.1137 cost: 2.2803 min: 0.5390 max: 2.3072 USE_META, weight: 0.2984 cost: 1.9174 min: 0.5390 max: 2.3072 USE_META, weight: 0.3392 cost: 1.8372 min: 0.5390 max: 2.3072 USE_META, weight: 0.6673 cost: 1.1927 min: 0.5390 max: 2.3072 USE_META, weight: 0.5903 cost: 1.3439 min: 0.5390 max: 2.3072 USE_META, weight: 0.8155 cost: 0.9016 min: 0.5390 max: 2.3072 USE_META, weight: 0.8450 cost: 0.8436 min: 0.5390 max: 2.3072 USE_META, weight: 0.5901 cost: 1.3444 min: 0.5390 max: 2.3072 USE_META, weight: 0.3712 cost: 1.7744 min: 0.5390 max: 2.3072 USE_META, weight: 0.4205 cost: 1.6776 min: 0.5390 max: 2.3072 USE_META, weight: 0.4983 cost: 1.5247 min: 0.5390 max: 2.3072 USE_META, weight: 0.3774 cost: 1.7622 min: 0.5390 max: 2.3072 USE_META, weight: 0.5232 cost: 1.4758 min: 0.5390 max: 2.3072 USE_META, weight: 0.3903 cost: 1.7370 min: 0.5390 max: 2.3072 USE_META, weight: 0.7631 cost: 1.0045 min: 0.5390 max: 2.3072 USE_META, weight: 0.4999 cost: 1.5215 min: 0.5390 max: 2.3072 USE_META, weight: 0.5080 cost: 1.5055 min: 0.5390 max: 2.3072 USE_META, weight: 0.5860 cost: 1.3524 min: 0.5390 max: 2.3072 USE_META, weight: 0.3862 cost: 1.7449 min: 0.5390 max: 2.3072 USE_META, weight: 0.7298 cost: 1.0698 min: 0.5390 max: 2.3072 USE_META, weight: 0.5004 cost: 1.5206 min: 0.5390 max: 2.3072 USE_META, weight: 0.4830 cost: 1.5548 min: 0.5390 max: 2.3072 USE_META, weight: 0.5777 cost: 1.3688 min: 0.5390 max: 2.3072 USE_META, weight: 0.5596 cost: 1.4042 min: 0.5390 max: 2.3072 USE_META, weight: 0.6305 cost: 1.2650 min: 0.5390 max: 2.3072 USE_META, weight: 0.5182 cost: 1.4856 min: 0.5390 max: 2.3072 USE_META, weight: 0.6673 cost: 1.1927 min: 0.5390 max: 2.3072 USE_META, weight: 0.5948 cost: 1.3351 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.5317 cost: 1.4591 min: 0.5390 max: 2.3072 USE_META, weight: 0.8542 cost: 0.8255 min: 0.5390 max: 2.3072 USE_META, weight: 0.6812 cost: 1.1654 min: 0.5390 max: 2.3072 USE_META, weight: 0.5496 cost: 1.4239 min: 0.5390 max: 2.3072 USE_META, weight: 0.7080 cost: 1.1127 min: 0.5390 max: 2.3072 USE_META, weight: 0.2562 cost: 2.0003 min: 0.5390 max: 2.3072 USE_META, weight: 0.3774 cost: 1.7622 min: 0.5390 max: 2.3072 USE_META, weight: 0.4983 cost: 1.5247 min: 0.5390 max: 2.3072 USE_META, weight: 0.3849 cost: 1.7475 min: 0.5390 max: 2.3072 USE_META, weight: 0.4858 cost: 1.5492 min: 0.5390 max: 2.3072 USE_META, weight: 0.3657 cost: 1.7852 min: 0.5390 max: 2.3072 USE_META, weight: 0.3849 cost: 1.7475 min: 0.5390 max: 2.3072 USE_META, weight: 0.4118 cost: 1.6947 min: 0.5390 max: 2.3072 USE_META, weight: 0.5178 cost: 1.4864 min: 0.5390 max: 2.3072 USE_META, weight: 0.7935 cost: 0.9447 min: 0.5390 max: 2.3072 USE_META, weight: 0.3391 cost: 1.8375 min: 0.5390 max: 2.3072 USE_META, weight: 0.3753 cost: 1.7663 min: 0.5390 max: 2.3072 USE_META, weight: 0.4286 cost: 1.6616 min: 0.5390 max: 2.3072 USE_META, weight: 0.4930 cost: 1.5350 min: 0.5390 max: 2.3072 USE_META, weight: 0.2774 cost: 1.9588 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.4191 cost: 1.6803 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.8645 cost: 0.8052 min: 0.5390 max: 2.3072 USE_META, weight: 0.9782 cost: 0.5819 min: 0.5390 max: 2.3072 USE_META, weight: 0.8808 cost: 0.7732 min: 0.5390 max: 2.3072 USE_META, weight: 0.7959 cost: 0.9401 min: 0.5390 max: 2.3072 USE_META, weight: 1.0000 cost: 0.5390 min: 0.5390 max: 2.3072 USE_META, weight: 0.6513 cost: 1.2242 min: 0.5390 max: 2.3072 USE_META, weight: 0.5450 cost: 1.4329 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.6243 cost: 1.2771 min: 0.5390 max: 2.3072 USE_META, weight: 0.4648 cost: 1.5905 min: 0.5390 max: 2.3072 USE_META, weight: 0.5534 cost: 1.4164 min: 0.5390 max: 2.3072 USE_META, weight: 0.3285 cost: 1.8582 min: 0.5390 max: 2.3072 USE_META, weight: 0.7143 cost: 1.1003 min: 0.5390 max: 2.3072 USE_META, weight: 0.6311 cost: 1.2638 min: 0.5390 max: 2.3072 USE_META, weight: 0.1350 cost: 2.2384 min: 0.5390 max: 2.3072 USE_META, weight: 0.1194 cost: 2.2692 min: 0.5390 max: 2.3072 USE_META, weight: 0.3091 cost: 1.8964 min: 0.5390 max: 2.3072 USE_META, weight: 0.4229 cost: 1.6728 min: 0.5390 max: 2.3072 USE_META, weight: 0.3288 cost: 1.8576 min: 0.5390 max: 2.3072 USE_META, weight: 0.6907 cost: 1.1466 min: 0.5390 max: 2.3072 USE_META, weight: 0.6063 cost: 1.3126 min: 0.5390 max: 2.3072 USE_META, weight: 0.3755 cost: 1.7659 min: 0.5390 max: 2.3072 USE_META, weight: 0.5073 cost: 1.5071 min: 0.5390 max: 2.3072 USE_META, weight: 0.4066 cost: 1.7048 min: 0.5390 max: 2.3072 USE_META, weight: 0.2625 cost: 1.9879 min: 0.5390 max: 2.3072 USE_META, weight: 0.2786 cost: 1.9563 min: 0.5390 max: 2.3072 USE_META, weight: 0.3630 cost: 1.7905 min: 0.5390 max: 2.3072 USE_META, weight: 0.1807 cost: 2.1487 min: 0.5390 max: 2.3072 USE_META, weight: 0.4416 cost: 1.6362 min: 0.5390 max: 2.3072 USE_META, weight: 0.4518 cost: 1.6161 min: 0.5390 max: 2.3072 USE_META, weight: 0.4849 cost: 1.5511 min: 0.5390 max: 2.3072 USE_META, weight: 0.5357 cost: 1.4512 min: 0.5390 max: 2.3072 USE_META, weight: 0.5739 cost: 1.3761 min: 0.5390 max: 2.3072 USE_META, weight: 0.4957 cost: 1.5298 min: 0.5390 max: 2.3072 USE_META, weight: 0.4600 cost: 1.5999 min: 0.5390 max: 2.3072 USE_META, weight: 0.5862 cost: 1.3520 min: 0.5390 max: 2.3072 USE_META, weight: 0.2906 cost: 1.9327 min: 0.5390 max: 2.3072 USE_EVALUE, weight: 0.9609 eval: 1.7540 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9609 eval: 1.7540 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9609 eval: 1.7540 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9027 eval: 3.7713 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9027 eval: 3.7713 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9027 eval: 3.7713 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8918 eval: 4.1519 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8918 eval: 4.1519 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8918 eval: 4.1519 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8648 eval: 5.0853 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8648 eval: 5.0853 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8648 eval: 5.0853 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8584 eval: 5.3074 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8584 eval: 5.3074 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8584 eval: 5.3074 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.1000 eval: 31.6000 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.1000 eval: 31.6000 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.1000 eval: 31.6000 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.7813 eval: 7.9800 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.7813 eval: 7.9800 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 1.0000 eval: 0.3992 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 1.0000 eval: 0.3992 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 1.0000 eval: 0.3992 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8430 eval: 5.8421 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8430 eval: 5.8421 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8430 eval: 5.8421 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8368 eval: 6.0562 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8368 eval: 6.0562 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8368 eval: 6.0562 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8579 eval: 5.3239 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8579 eval: 5.3239 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8579 eval: 5.3239 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9136 eval: 3.3948 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9136 eval: 3.3948 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9136 eval: 3.3948 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8132 eval: 6.8759 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8132 eval: 6.8759 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8132 eval: 6.8759 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9119 eval: 3.4546 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9119 eval: 3.4546 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9119 eval: 3.4546 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9550 eval: 1.9603 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9550 eval: 1.9603 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9550 eval: 1.9603 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8295 eval: 6.3107 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8295 eval: 6.3107 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8295 eval: 6.3107 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8855 eval: 4.3671 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8855 eval: 4.3671 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8855 eval: 4.3671 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8849 eval: 4.3899 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8849 eval: 4.3899 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8849 eval: 4.3899 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8723 eval: 4.8252 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8723 eval: 4.8252 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8723 eval: 4.8252 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9801 eval: 1.0879 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9801 eval: 1.0879 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.9801 eval: 1.0879 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8911 eval: 4.1757 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8911 eval: 4.1757 min: 0.3992 max: 31.6000 USE_EVALUE, weight: 0.8911 eval: 4.1757 min: 0.3992 max: 31.6000 Number of contacts in models: 260 Number of contacts in alignments: 62 NUMB_ALIGNS: 62 Adding 6174 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -225.9059, CN propb: -225.9059 weights: 0.2079 constraints: 488 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 488 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 488 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 5686 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 5686 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 6174 # command: