# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0328/ # command:# Making conformation for sequence T0328 numbered 1 through 311 Created new target T0328 from T0328.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0328/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0328//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0328/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0328//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0328/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0328/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0328/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1aoeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1aoeA/merged-good-all-a2m # 1aoeA read from 1aoeA/merged-good-all-a2m # found chain 1aoeA in training set Warning: unaligning (T0328)D142 because of BadResidue code BAD_PEPTIDE in next template residue (1aoeA)G114 Warning: unaligning (T0328)S143 because of BadResidue code BAD_PEPTIDE at template residue (1aoeA)G114 T0328 34 :SQLRPC 1aoeA 30 :RKEIRY # choosing archetypes in rotamer library T0328 47 :IYELTDQYSDSAFNGFVAIGANYWDSLYPESRP 1aoeA 36 :FKDVTTRTTKPNTRNAVIMGRKTWESIPQKFRP T0328 85 :FPAM 1aoeA 69 :LPDR T0328 90 :EGNREAPAIE 1aoeA 78 :SRSYENEIID T0328 105 :HLRCDR 1aoeA 90 :IIHASS T0328 118 :ANEISQMFEDLVELVEE 1aoeA 96 :IESSLNLVSDVERVFII T0328 157 :KGRHRQEVALV 1aoeA 123 :NNSLVSHLLIT T0328 168 :GSEDPEFK 1aoeA 136 :EHPSPESI T0328 188 :NLSKWHRLPLKKQEDIIGRTKQ 1aoeA 152 :PLESWTKQPKSELQKFVGDTVL T0328 210 :DNIEYES 1aoeA 175 :DDIKEGD Number of specific fragments extracted= 10 number of extra gaps= 1 total=10 Number of alignments=1 # 1aoeA read from 1aoeA/merged-good-all-a2m # found chain 1aoeA in training set Warning: unaligning (T0328)S143 because of BadResidue code BAD_PEPTIDE at template residue (1aoeA)G114 T0328 42 :NVAQYIYELTDQYSDSAFNGFVAIGANYWDSLYPESRP 1aoeA 31 :KEIRYFKDVTTRTTKPNTRNAVIMGRKTWESIPQKFRP T0328 85 :FPAM 1aoeA 69 :LPDR T0328 90 :EGNREAPAIEY 1aoeA 78 :SRSYENEIIDD T0328 105 :HLRCDR 1aoeA 90 :IIHASS T0328 118 :ANEISQMFEDLVELV 1aoeA 96 :IESSLNLVSDVERVF T0328 157 :KGRHRQEVALV 1aoeA 123 :NNSLVSHLLIT T0328 168 :GSEDPEFK 1aoeA 136 :EHPSPESI T0328 188 :NLSKWHRLPLKKQEDIIG 1aoeA 152 :PLESWTKQPKSELQKFVG T0328 211 :NIEYESE 1aoeA 170 :DTVLEDD Number of specific fragments extracted= 9 number of extra gaps= 1 total=19 Number of alignments=2 # 1aoeA read from 1aoeA/merged-good-all-a2m # found chain 1aoeA in training set Warning: unaligning (T0328)D142 because of BadResidue code BAD_PEPTIDE in next template residue (1aoeA)G114 Warning: unaligning (T0328)S143 because of BadResidue code BAD_PEPTIDE at template residue (1aoeA)G114 T0328 32 :VESQLRPCIANVA 1aoeA 28 :RLRKEIRYFKDVT T0328 52 :DQYSDSAFNGFVAIGANYWDSLYP 1aoeA 41 :TRTTKPNTRNAVIMGRKTWESIPQ T0328 81 :MLKPFPAMQ 1aoeA 65 :KFRPLPDRL T0328 90 :EGNREAPAIEYD 1aoeA 78 :SRSYENEIIDDN T0328 105 :HLRCDRYDILH 1aoeA 90 :IIHASSIESSL T0328 123 :QMFEDL 1aoeA 101 :NLVSDV T0328 136 :RGFRFM 1aoeA 107 :ERVFII T0328 144 :RDLTG 1aoeA 115 :AEIYN T0328 156 :PKG 1aoeA 122 :INN T0328 160 :HRQEVALV 1aoeA 125 :SLVSHLLI T0328 168 :GSEDPEFKG 1aoeA 136 :EHPSPESIE T0328 188 :NLSKWHRLPLKKQEDIIG 1aoeA 152 :PLESWTKQPKSELQKFVG T0328 211 :NIEYESEDKPLTSHIKRVNLK 1aoeA 170 :DTVLEDDIKEGDFTYNYTLWT Number of specific fragments extracted= 13 number of extra gaps= 1 total=32 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gvkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gvkA expands to /projects/compbio/data/pdb/2gvk.pdb.gz 2gvkA:Skipped atom 32, because occupancy 0.5 <= existing 0.500 in 2gvkA Skipped atom 36, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 38, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 40, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 61, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 65, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 67, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 69, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 71, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 108, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 112, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 114, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 116, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 118, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 120, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 131, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 135, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 137, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 139, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 211, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 215, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 217, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 219, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 221, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 292, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 296, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 298, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 300, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 302, because occupancy 0.300 <= existing 0.700 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 417, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 419, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 421, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 423, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 425, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 427, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 429, because occupancy 0.500 <= existing 0.500 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 486, because occupancy 0.250 <= existing 0.250 in 2gvkA Skipped atom 491, because occupancy 0.250 <= existing 0.250 in 2gvkA Skipped atom 494, because occupancy 0.250 <= existing 0.250 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 677, because occupancy 0.350 <= existing 0.350 in 2gvkA Skipped atom 678, because occupancy 0.300 <= existing 0.350 in 2gvkA Skipped atom 682, because occupancy 0.350 <= existing 0.350 in 2gvkA Skipped atom 683, because occupancy 0.300 <= existing 0.350 in 2gvkA Skipped atom 685, because occupancy 0.350 <= existing 0.350 in 2gvkA Skipped atom 686, because occupancy 0.300 <= existing 0.350 in 2gvkA Skipped atom 707, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 711, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 713, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 868, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 872, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 874, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 876, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 878, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 880, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 882, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 884, because occupancy 0.500 <= existing 0.500 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 970, because occupancy 0.250 <= existing 0.500 in 2gvkA Skipped atom 971, because occupancy 0.250 <= existing 0.500 in 2gvkA Skipped atom 975, because occupancy 0.250 <= existing 0.500 in 2gvkA Skipped atom 976, because occupancy 0.250 <= existing 0.500 in 2gvkA Skipped atom 978, because occupancy 0.250 <= existing 0.500 in 2gvkA Skipped atom 979, because occupancy 0.250 <= existing 0.500 in 2gvkA Skipped atom 982, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 986, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 988, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 990, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 992, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1060, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1064, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1066, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1068, because occupancy 0.500 <= existing 0.500 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1228, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1232, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1234, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1236, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1238, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1252, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1256, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1258, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1260, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1262, because occupancy 0.400 <= existing 0.600 in 2gvkA Skipped atom 1264, because occupancy 0.400 <= existing 0.600 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1545, because occupancy 0.500 <= existing 0.500 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1549, because occupancy 0.500 <= existing 0.500 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1551, because occupancy 0.500 <= existing 0.500 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1553, because occupancy 0.350 <= existing 0.350 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1555, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1597, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1601, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1603, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1605, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1607, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1624, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1628, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1630, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1632, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1634, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1636, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1639, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1643, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1645, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1647, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1649, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1651, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1729, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1731, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1733, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1735, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1737, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1739, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1741, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1743, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1745, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1747, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1749, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1784, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1788, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1790, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1792, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 1794, because occupancy 0.500 <= existing 0.500 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2015, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2019, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2021, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2023, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2025, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2052, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2056, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2058, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2060, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2062, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2064, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2186, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 2190, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 2192, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 2194, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 2196, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 2198, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 2200, because occupancy 0.300 <= existing 0.700 in 2gvkA Skipped atom 2202, because occupancy 0.300 <= existing 0.700 in 2gvkA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2273, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2277, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2279, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2281, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2283, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2335, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2339, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2341, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2343, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2345, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2347, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2349, because occupancy 0.500 <= existing 0.500 in 2gvkA Skipped atom 2351, because occupancy 0.500 <= existing 0.500 in 2gvkA # T0328 read from 2gvkA/merged-good-all-a2m # 2gvkA read from 2gvkA/merged-good-all-a2m # adding 2gvkA to template set # found chain 2gvkA in template set Warning: unaligning (T0328)R242 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gvkA)A246 Warning: unaligning (T0328)Q243 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gvkA)A246 T0328 9 :EQLGVCAEGNLHSVYLMFNANDN 2gvkA 12 :IPQDVAGKQGENVIFIVYNLTDS T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSAFNGFVAIGANYWDSLYPE 2gvkA 37 :TVDKVKDVCANFSAMIRSMRNRFPDMQFSCTMGFGADAWTRLFPD T0328 77 :SRPEMLKPFPAMQEGNREAPAIEYDLFVHLRCDRYDILHLVANEISQMFEDLVELVEEERGFRFMDSRDLTGFVDGTENPKGRH 2gvkA 83 :GKPKELSTFSEIKGEKYTAVSTPGDLLFHIRAKQMGLCFEFASILDEKLKGAVVSVDETHGFRYMDGKAIIGFVDGTENPAVDE T0328 161 :RQEVALVGSEDPEFKGGSYIHVQKYAHNLSKWHRLPLKKQEDIIGRTKQDNIEYESEDKPLTSHIKRVNLK 2gvkA 168 :PYHFAVIGEEDADFAGGSYVFVQKYIHDMVAWNALPVEQQEKVIGRHKFNDVELSDEEKPGNAHNAVTNIG T0328 234 :NG 2gvkA 239 :DD T0328 238 :IEIL 2gvkA 241 :LKIV T0328 244 :SMPY 2gvkA 247 :NMPF T0328 248 :GSLKEQGLMFISTCRTPDHFEKMLHSMVFGDGAGNHDHLMHFTSALTGSSFFAPSLDFLMQF 2gvkA 253 :TSKGEYGTYFIGYASTFSTTRRMLENMFIGSPAGNTDRLLDFSTAITGTLFFVPSYDLLGEL Number of specific fragments extracted= 8 number of extra gaps= 1 total=40 Number of alignments=4 # 2gvkA read from 2gvkA/merged-good-all-a2m # found chain 2gvkA in template set Warning: unaligning (T0328)R242 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gvkA)A246 Warning: unaligning (T0328)Q243 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gvkA)A246 T0328 9 :EQLGVCAEGNLHSVYLMFNANDN 2gvkA 12 :IPQDVAGKQGENVIFIVYNLTDS T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSAFNGFVAIGANYWDSLYPE 2gvkA 37 :TVDKVKDVCANFSAMIRSMRNRFPDMQFSCTMGFGADAWTRLFPD T0328 77 :SRPEMLKPFPAMQEGNREAPAIEYDLFVHLRCDRYDILHLVANEISQMFEDLVELVEEERGFRFMDSRDLTGFVDGTENPKGRH 2gvkA 83 :GKPKELSTFSEIKGEKYTAVSTPGDLLFHIRAKQMGLCFEFASILDEKLKGAVVSVDETHGFRYMDGKAIIGFVDGTENPAVDE T0328 162 :QEVALVGSEDPEFKGGSYIHVQKYAHNLSKWHRLPLKKQEDIIGRTKQDNIEYESEDKPLTSHIKRVNLK 2gvkA 169 :YHFAVIGEEDADFAGGSYVFVQKYIHDMVAWNALPVEQQEKVIGRHKFNDVELSDEEKPGNAHNAVTNIG T0328 233 :ENG 2gvkA 239 :DDL T0328 239 :EIL 2gvkA 242 :KIV T0328 244 :SMPYGSLK 2gvkA 247 :NMPFANTS T0328 252 :EQGLMFISTCRTPDHFEKMLHSMVFGDGAGNHDHLMHFTSALTGSSFFAPSLDFLMQFDN 2gvkA 257 :EYGTYFIGYASTFSTTRRMLENMFIGSPAGNTDRLLDFSTAITGTLFFVPSYDLLGELGE Number of specific fragments extracted= 8 number of extra gaps= 1 total=48 Number of alignments=5 # 2gvkA read from 2gvkA/merged-good-all-a2m # found chain 2gvkA in template set Warning: unaligning (T0328)N5 because first residue in template chain is (2gvkA)F8 Warning: unaligning (T0328)R242 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gvkA)A246 Warning: unaligning (T0328)Q243 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gvkA)A246 T0328 6 :MPREQLGVCAEGNLHSVYLMFNANDN 2gvkA 9 :GGHIPQDVAGKQGENVIFIVYNLTDS T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSAFNGFVAIGANYWDSLYPE 2gvkA 37 :TVDKVKDVCANFSAMIRSMRNRFPDMQFSCTMGFGADAWTRLFPD T0328 77 :SRPEMLKPFPAMQEGNREAPAIEYDLFVHLRCDRYDILHLVANEISQMFEDLVELVEEERGFRFMDSRDLTGFVDGTENPKGRHR 2gvkA 83 :GKPKELSTFSEIKGEKYTAVSTPGDLLFHIRAKQMGLCFEFASILDEKLKGAVVSVDETHGFRYMDGKAIIGFVDGTENPAVDEN T0328 162 :QEVALVGSEDPEFKGGSYIHVQKYAHNLSKWHRLPLKKQEDIIGRTKQDNIEYESEDKPL 2gvkA 169 :YHFAVIGEEDADFAGGSYVFVQKYIHDMVAWNALPVEQQEKVIGRHKFNDVELSDEEKPG T0328 239 :EIL 2gvkA 242 :KIV T0328 244 :SMPYGSL 2gvkA 247 :NMPFANT T0328 251 :KEQGLMFISTCRTPDHFEKMLHSMVFGDGAGNHDHLMHFTSALTGSSFFAPSLDFLMQFDN 2gvkA 256 :GEYGTYFIGYASTFSTTRRMLENMFIGSPAGNTDRLLDFSTAITGTLFFVPSYDLLGELGE Number of specific fragments extracted= 7 number of extra gaps= 1 total=55 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vdwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1vdwA/merged-good-all-a2m # 1vdwA read from 1vdwA/merged-good-all-a2m # found chain 1vdwA in training set Warning: unaligning (T0328)V32 because first residue in template chain is (1vdwA)S2 Warning: unaligning (T0328)A87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vdwA)E42 Warning: unaligning (T0328)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vdwA)E42 T0328 33 :ESQLRPCIANVAQYIYE 1vdwA 3 :VKTWRKIAIDIIRDFDH T0328 68 :NYWDSL 1vdwA 20 :NIMPLF T0328 77 :SRPEMLKPFP 1vdwA 26 :GNPKASETIS T0328 94 :E 1vdwA 43 :T T0328 111 :YDILHLVANEISQMFEDL 1vdwA 44 :KVVDKVAENIIISKFKDL T0328 129 :VELVEEERGFRFMD 1vdwA 63 :VNVVSEEIGRIDQG T0328 157 :KGRHRQEVALVGSED 1vdwA 144 :ELAEKPSISFYTKGK T0328 176 :GGSYIHVQKYAHN 1vdwA 173 :GAIALELAYLARG T0328 194 :RL 1vdwA 186 :AL T0328 223 :SHIKRVNLKDENGKSI 1vdwA 209 :AREAGAIVKDLDGKDV T0328 244 :SMPYGSLKEQGLMFI 1vdwA 225 :EITFSATEKVNIIAA T0328 262 :RTPDHFEKMLH 1vdwA 240 :NNEELLETILR Number of specific fragments extracted= 12 number of extra gaps= 0 total=67 Number of alignments=7 # 1vdwA read from 1vdwA/merged-good-all-a2m # found chain 1vdwA in training set Warning: unaligning (T0328)V32 because first residue in template chain is (1vdwA)S2 Warning: unaligning (T0328)A87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vdwA)E42 Warning: unaligning (T0328)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vdwA)E42 T0328 33 :ESQLRPCIANVAQYIYE 1vdwA 3 :VKTWRKIAIDIIRDFDH T0328 68 :NYWDSL 1vdwA 20 :NIMPLF T0328 77 :SRPEMLKPFP 1vdwA 26 :GNPKASETIS T0328 94 :E 1vdwA 43 :T T0328 111 :YDILHLVANEISQMFEDL 1vdwA 44 :KVVDKVAENIIISKFKDL T0328 129 :VELVEEERGFRFMD 1vdwA 63 :VNVVSEEIGRIDQG T0328 157 :KGRHR 1vdwA 144 :ELAEK T0328 227 :RVNLKDENGKSI 1vdwA 213 :GAIVKDLDGKDV T0328 244 :SMPYGSLKEQGLMF 1vdwA 225 :EITFSATEKVNIIA T0328 261 :CRTPDHFEKMLH 1vdwA 239 :ANNEELLETILR Number of specific fragments extracted= 10 number of extra gaps= 0 total=77 Number of alignments=8 # 1vdwA read from 1vdwA/merged-good-all-a2m # found chain 1vdwA in training set Warning: unaligning (T0328)V32 because first residue in template chain is (1vdwA)S2 Warning: unaligning (T0328)A87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1vdwA)E42 Warning: unaligning (T0328)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vdwA)E42 T0328 33 :ESQLRPCIANVAQYIYE 1vdwA 3 :VKTWRKIAIDIIRDFDH T0328 68 :NYWDSL 1vdwA 20 :NIMPLF T0328 77 :SRPEMLKPFP 1vdwA 26 :GNPKASETIS T0328 94 :E 1vdwA 43 :T T0328 111 :YDILHLVANEISQMFEDL 1vdwA 44 :KVVDKVAENIIISKFKDL T0328 129 :VELVEEERGFRFM 1vdwA 63 :VNVVSEEIGRIDQ T0328 158 :GRHRQEVALV 1vdwA 108 :EKDPIYAFIY T0328 176 :GGSY 1vdwA 131 :KGSY T0328 210 :DN 1vdwA 136 :NG T0328 212 :IEYESEDKPL 1vdwA 140 :IKVRELAEKP T0328 222 :TSH 1vdwA 213 :GAI T0328 230 :LKDENGKSIE 1vdwA 216 :VKDLDGKDVE T0328 245 :MPYGSLKEQGLMFI 1vdwA 226 :ITFSATEKVNIIAA T0328 262 :RTPDHFEKMLH 1vdwA 240 :NNEELLETILR Number of specific fragments extracted= 14 number of extra gaps= 0 total=91 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1uc2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1uc2A expands to /projects/compbio/data/pdb/1uc2.pdb.gz 1uc2A:# T0328 read from 1uc2A/merged-good-all-a2m # 1uc2A read from 1uc2A/merged-good-all-a2m # adding 1uc2A to template set # found chain 1uc2A in template set T0328 10 :QLGVCAE 1uc2A 89 :PGGIGYD T0328 19 :LHSVYLMFNANDN 1uc2A 96 :INCGVRLIRTNLT T0328 32 :VESQLRPCIANVAQY 1uc2A 112 :VRPRIKQLVDTLFKN T0328 53 :QYSDS 1uc2A 128 :PSGVG T0328 68 :NYWDSL 1uc2A 164 :RDLERL T0328 74 :YPESRPEMLK 1uc2A 175 :MEGADPEAVS T0328 84 :PFPAMQEGNR 1uc2A 194 :QLGSLGSGNH T0328 97 :AIEYDLFVHLRCDRYDILHLVANEISQMFEDLVEL 1uc2A 224 :LFEGQVVVMVHTGSRGLGHQVASDYLRIMERAIRK T0328 151 :DGTENP 1uc2A 259 :YRIPWP T0328 159 :RHRQEVALVGSE 1uc2A 265 :DRELVSVPFQSE T0328 172 :PEFKGGSYIHVQKYAHNL 1uc2A 286 :KAAANFAWANRQMITHWV T0328 197 :LKKQEDIIGRTKQDNIEYE 1uc2A 304 :RESFQEVFKQDPEGDLGMD T0328 221 :LTSH 1uc2A 326 :DVAH T0328 225 :IKRVNLK 1uc2A 332 :GKVEEHE T0328 233 :ENGKSIE 1uc2A 339 :VDGKRVK T0328 256 :MFISTCR 1uc2A 346 :VIVHRKG T0328 263 :T 1uc2A 358 :P T0328 277 :GDGAGNHDHLMH 1uc2A 359 :PGHEAVPRLYRD T0328 294 :TGSSFFAPS 1uc2A 371 :VGQPVLIPG Number of specific fragments extracted= 19 number of extra gaps= 0 total=110 Number of alignments=10 # 1uc2A read from 1uc2A/merged-good-all-a2m # found chain 1uc2A in template set T0328 10 :QLGVCAE 1uc2A 89 :PGGIGYD T0328 19 :LHSVYLMFNAN 1uc2A 96 :INCGVRLIRTN T0328 30 :DNVESQLRPCIANVAQYI 1uc2A 110 :KEVRPRIKQLVDTLFKNV T0328 57 :SAF 1uc2A 163 :ERD T0328 66 :GANYW 1uc2A 166 :LERLE T0328 71 :DSLYPESRPEML 1uc2A 172 :GGRMEGADPEAV T0328 83 :KPFPAMQEGNR 1uc2A 193 :PQLGSLGSGNH T0328 96 :PAIEYDLFVHLRCDRYDILHLVANEISQMFEDLVEL 1uc2A 223 :GLFEGQVVVMVHTGSRGLGHQVASDYLRIMERAIRK T0328 151 :DGTENP 1uc2A 259 :YRIPWP T0328 160 :HRQEVALVGSE 1uc2A 266 :RELVSVPFQSE T0328 174 :FKGGSYIHVQKYAHNL 1uc2A 288 :AANFAWANRQMITHWV T0328 197 :LKKQEDIIGRTKQDNIEYE 1uc2A 304 :RESFQEVFKQDPEGDLGMD T0328 222 :TSH 1uc2A 327 :VAH T0328 225 :IKRVNLK 1uc2A 332 :GKVEEHE T0328 233 :ENGKSIE 1uc2A 339 :VDGKRVK T0328 255 :LMFISTC 1uc2A 346 :VIVHRKG Number of specific fragments extracted= 16 number of extra gaps= 0 total=126 Number of alignments=11 # 1uc2A read from 1uc2A/merged-good-all-a2m # found chain 1uc2A in template set T0328 10 :QLGVCAEGNLHSVYLMFNANDN 1uc2A 89 :PGGIGYDINCGVRLIRTNLTEK T0328 32 :VESQLRPCIANVAQY 1uc2A 112 :VRPRIKQLVDTLFKN T0328 50 :LTDQ 1uc2A 129 :SGVG T0328 54 :YSDSAF 1uc2A 161 :GWERDL T0328 67 :ANYWDSLYP 1uc2A 167 :ERLEEGGRM T0328 76 :ESRPEMLK 1uc2A 177 :GADPEAVS T0328 85 :FPAMQEGNR 1uc2A 195 :LGSLGSGNH T0328 96 :PAIEYDLFVHLRCDRYDILHLVANEISQMFEDLVEL 1uc2A 223 :GLFEGQVVVMVHTGSRGLGHQVASDYLRIMERAIRK T0328 153 :TENPKGRHRQEVALV 1uc2A 259 :YRIPWPDRELVSVPF T0328 174 :FKGGSYIHVQKYAHNL 1uc2A 288 :AANFAWANRQMITHWV T0328 197 :LKKQEDIIGRTKQDNIEYE 1uc2A 304 :RESFQEVFKQDPEGDLGMD T0328 222 :TSHIKRVN 1uc2A 329 :HNIGKVEE T0328 231 :KDENGKSIEIL 1uc2A 337 :HEVDGKRVKVI T0328 242 :RQSMPYGSL 1uc2A 354 :TRAFPPGHE T0328 251 :KEQGLMFIS 1uc2A 381 :MGTASYILA Number of specific fragments extracted= 15 number of extra gaps= 0 total=141 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zvdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zvdA expands to /projects/compbio/data/pdb/1zvd.pdb.gz 1zvdA:Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 100, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 102, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 104, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 106, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 108, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 110, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 112, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 114, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 116, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 344, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 348, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 350, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 352, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 354, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 356, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 358, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 360, because occupancy 0.500 <= existing 0.500 in 1zvdA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1552, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1556, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1558, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1560, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1562, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1564, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1566, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1696, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1700, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 1702, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 2319, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 2323, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 2325, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 2327, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 2329, because occupancy 0.500 <= existing 0.500 in 1zvdA Skipped atom 2331, because occupancy 0.500 <= existing 0.500 in 1zvdA # T0328 read from 1zvdA/merged-good-all-a2m # 1zvdA read from 1zvdA/merged-good-all-a2m # adding 1zvdA to template set # found chain 1zvdA in template set Warning: unaligning (T0328)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1zvdA)D433 Warning: unaligning (T0328)D109 because of BadResidue code BAD_PEPTIDE at template residue (1zvdA)D433 Warning: unaligning (T0328)D218 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zvdA)K569 Warning: unaligning (T0328)K219 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zvdA)K569 Warning: unaligning (T0328)P220 because of BadResidue code BAD_PEPTIDE at template residue (1zvdA)S570 Warning: unaligning (T0328)L221 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zvdA)P572 Warning: unaligning (T0328)L230 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zvdA)P572 Warning: unaligning (T0328)D232 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zvdA)E575 Warning: unaligning (T0328)E233 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zvdA)E575 Warning: unaligning (T0328)N234 because of BadResidue code BAD_PEPTIDE at template residue (1zvdA)E576 Warning: unaligning (T0328)G235 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zvdA)N577 T0328 36 :LRPCIANVAQYIYE 1zvdA 372 :LVQKLKILRQELSQ T0328 53 :QYSDSAFNGFVAIGANYWDSLYP 1zvdA 386 :QQPQAGHCRIEVSREEIFEESYR T0328 76 :ESRPEMLKP 1zvdA 412 :KMRPKDLWK T0328 87 :AMQEGNR 1zvdA 425 :KFRGEEG T0328 110 :RYDILHLVANEI 1zvdA 434 :YGGVAREWLYLL T0328 122 :SQMFEDLVELVEEE 1zvdA 447 :HEMLNPYYGLFQYS T0328 158 :GRHRQEVALVGSEDPEFKGGSYIHVQKYAHNLSKWHRL 1zvdA 461 :RDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGH T0328 196 :PLKKQEDIIGRTKQ 1zvdA 505 :TLPFYKQLLGKSIT T0328 211 :NIEYESE 1zvdA 561 :QHELKPN T0328 231 :K 1zvdA 573 :V T0328 238 :IEILRQS 1zvdA 582 :VRLYVNW T0328 260 :TCRTP 1zvdA 590 :FLRGI T0328 265 :DHFEKMLHSMV 1zvdA 596 :AQFLALQKGFN T0328 300 :APSLDFLMQFD 1zvdA 608 :VIPQHLLKTFD Number of specific fragments extracted= 14 number of extra gaps= 3 total=155 Number of alignments=13 # 1zvdA read from 1zvdA/merged-good-all-a2m # found chain 1zvdA in template set Warning: unaligning (T0328)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1zvdA)D433 Warning: unaligning (T0328)D109 because of BadResidue code BAD_PEPTIDE at template residue (1zvdA)D433 T0328 36 :LRPCIANVAQYIYE 1zvdA 372 :LVQKLKILRQELSQ T0328 53 :QYSDSAFNGFVAIGANYWDSLYP 1zvdA 386 :QQPQAGHCRIEVSREEIFEESYR T0328 76 :ESRPEML 1zvdA 412 :KMRPKDL T0328 87 :AMQEGNR 1zvdA 425 :KFRGEEG T0328 110 :RYDILHLVANEIS 1zvdA 434 :YGGVAREWLYLLS T0328 123 :QMFEDLVELVEEERGF 1zvdA 448 :EMLNPYYGLFQYSRDD T0328 155 :NP 1zvdA 470 :NP T0328 173 :EFKGGSYIHVQKYAHNL 1zvdA 592 :RGIEAQFLALQKGFNEV T0328 190 :SKWHRLPLKKQEDIIGRTK 1zvdA 612 :HLLKTFDEKELELIICGLG T0328 217 :ED 1zvdA 631 :KI T0328 220 :PLTSHIKRVNLK 1zvdA 710 :LPKAHTCFNRID T0328 258 :ISTCRTPDHFEKMLHSMV 1zvdA 722 :IPPYESYEKLYEKLLTAI Number of specific fragments extracted= 12 number of extra gaps= 1 total=167 Number of alignments=14 # 1zvdA read from 1zvdA/merged-good-all-a2m # found chain 1zvdA in template set Warning: unaligning (T0328)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1zvdA)D433 Warning: unaligning (T0328)D109 because of BadResidue code BAD_PEPTIDE at template residue (1zvdA)D433 Warning: unaligning (T0328)G235 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zvdA)K569 Warning: unaligning (T0328)K236 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zvdA)K569 Warning: unaligning (T0328)S237 because of BadResidue code BAD_PEPTIDE at template residue (1zvdA)S570 Warning: unaligning (T0328)I238 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zvdA)P572 Warning: unaligning (T0328)P246 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zvdA)P572 Warning: unaligning (T0328)G248 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zvdA)E575 Warning: unaligning (T0328)S249 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zvdA)E575 Warning: unaligning (T0328)L250 because of BadResidue code BAD_PEPTIDE at template residue (1zvdA)E576 T0328 36 :LRPCIANVAQYIYEL 1zvdA 372 :LVQKLKILRQELSQQ T0328 53 :QYSDSAFNGFV 1zvdA 387 :QPQAGHCRIEV T0328 66 :GANYWDSLYP 1zvdA 399 :REEIFEESYR T0328 76 :ESRPEMLKP 1zvdA 412 :KMRPKDLWK T0328 87 :AMQEGNR 1zvdA 425 :KFRGEEG T0328 110 :RYDILHLVANEISQMFEDL 1zvdA 434 :YGGVAREWLYLLSHEMLNP T0328 134 :EERGFRFM 1zvdA 453 :YYGLFQYS T0328 159 :RHRQEVALVGSEDPEFKG 1zvdA 461 :RDDIYTLQINPDSAVNPE T0328 177 :GSYIHVQKYAHNLSKWHR 1zvdA 480 :LSYFHFVGRIMGMAVFHG T0328 195 :LPLKKQEDIIGRTKQDN 1zvdA 504 :FTLPFYKQLLGKSITLD T0328 224 :HIKR 1zvdA 558 :EIIQ T0328 229 :NLKDEN 1zvdA 562 :HELKPN T0328 247 :Y 1zvdA 573 :V T0328 265 :DHFEKMLHSMVFGDGAGNHDHLMHFTS 1zvdA 580 :EYVRLYVNWRFLRGIEAQFLALQKGFN T0328 300 :APSLDFLMQFD 1zvdA 608 :VIPQHLLKTFD Number of specific fragments extracted= 15 number of extra gaps= 3 total=182 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cb2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cb2A expands to /projects/compbio/data/pdb/2cb2.pdb.gz 2cb2A:Skipped atom 164, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 166, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 168, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 170, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 172, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 174, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 176, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 178, because occupancy 0.430 <= existing 0.570 in 2cb2A Skipped atom 262, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 264, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 266, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 369, because occupancy 0.480 <= existing 0.520 in 2cb2A Skipped atom 371, because occupancy 0.480 <= existing 0.520 in 2cb2A Skipped atom 373, because occupancy 0.480 <= existing 0.520 in 2cb2A Skipped atom 375, because occupancy 0.480 <= existing 0.520 in 2cb2A Skipped atom 542, because occupancy 0.310 <= existing 0.690 in 2cb2A Skipped atom 544, because occupancy 0.310 <= existing 0.690 in 2cb2A Skipped atom 847, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 849, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 851, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 853, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 855, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 857, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 859, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 861, because occupancy 0.490 <= existing 0.510 in 2cb2A Skipped atom 1372, because occupancy 0.410 <= existing 0.590 in 2cb2A Skipped atom 1374, because occupancy 0.410 <= existing 0.590 in 2cb2A Skipped atom 1462, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1464, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1466, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1468, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1495, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1497, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1499, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1501, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1503, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1505, because occupancy 0.380 <= existing 0.620 in 2cb2A Skipped atom 1702, because occupancy 0.450 <= existing 0.550 in 2cb2A Skipped atom 1704, because occupancy 0.450 <= existing 0.550 in 2cb2A Skipped atom 1706, because occupancy 0.450 <= existing 0.550 in 2cb2A Skipped atom 1958, because occupancy 0.420 <= existing 0.580 in 2cb2A Skipped atom 1960, because occupancy 0.420 <= existing 0.580 in 2cb2A Skipped atom 1962, because occupancy 0.420 <= existing 0.580 in 2cb2A Skipped atom 1964, because occupancy 0.420 <= existing 0.580 in 2cb2A Skipped atom 2015, because occupancy 0.340 <= existing 0.660 in 2cb2A Skipped atom 2018, because occupancy 0.340 <= existing 0.660 in 2cb2A Skipped atom 2401, because occupancy 0.500 <= existing 0.500 in 2cb2A Skipped atom 2403, because occupancy 0.500 <= existing 0.500 in 2cb2A Skipped atom 2405, because occupancy 0.500 <= existing 0.500 in 2cb2A Skipped atom 2407, because occupancy 0.500 <= existing 0.500 in 2cb2A # T0328 read from 2cb2A/merged-good-all-a2m # 2cb2A read from 2cb2A/merged-good-all-a2m # adding 2cb2A to template set # found chain 2cb2A in template set Warning: unaligning (T0328)G17 because first residue in template chain is (2cb2A)P2 Warning: unaligning (T0328)I47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2cb2A)M32 Warning: unaligning (T0328)E49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2cb2A)M32 Warning: unaligning (T0328)E213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cb2A)P229 Warning: unaligning (T0328)Y214 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cb2A)P229 Warning: unaligning (T0328)K251 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cb2A)T244 T0328 18 :NLHSVYLMFNANDN 2cb2A 3 :KPYVAINMAELKNE T0328 34 :SQLRPCIANVAQY 2cb2A 17 :PKTFEMFASVGPK T0328 50 :LTDQYSDS 2cb2A 33 :VTARHPGF T0328 74 :YPE 2cb2A 54 :FGN T0328 87 :AMQEGNREA 2cb2A 57 :RYGGAKMDM T0328 96 :PAIEYDLFVHLRCDRYDILHLVANE 2cb2A 68 :ESSTVRVLQYTFWKDWKDHEEMHRQ T0328 121 :ISQMFEDL 2cb2A 97 :LFRLCYSC T0328 129 :VELVEEERGF 2cb2A 106 :SQMIWGPWEP T0328 144 :RD 2cb2A 147 :LD T0328 150 :VDGTENPKGRHRQEVALV 2cb2A 149 :IPVISQPYGKRVVAFAEH T0328 169 :SED 2cb2A 170 :PGK T0328 178 :SYIHVQKYAHNLSKWHRL 2cb2A 173 :EKQFEDAIVRTLEMLKKA T0328 196 :PLKKQEDII 2cb2A 213 :GAKGFHQVL T0328 207 :TKQDNI 2cb2A 222 :ENPGSL T0328 215 :ESEDKPLT 2cb2A 230 :DPNNVMYS T0328 248 :GSL 2cb2A 239 :PEA T0328 252 :EQGLMFISTCRTPDHFEKMLHSMVF 2cb2A 245 :PQQYIVHVEWANTDALMFGMGRVLL Number of specific fragments extracted= 17 number of extra gaps= 2 total=199 Number of alignments=16 # 2cb2A read from 2cb2A/merged-good-all-a2m # found chain 2cb2A in template set Warning: unaligning (T0328)G17 because first residue in template chain is (2cb2A)P2 Warning: unaligning (T0328)I47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2cb2A)M32 Warning: unaligning (T0328)E49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2cb2A)M32 Warning: unaligning (T0328)K219 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cb2A)P229 Warning: unaligning (T0328)P220 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cb2A)P229 T0328 18 :NLHSVYLMFNANDN 2cb2A 3 :KPYVAINMAELKNE T0328 34 :SQLRPCIANVAQY 2cb2A 17 :PKTFEMFASVGPK T0328 50 :LTDQYSD 2cb2A 33 :VTARHPG T0328 86 :PAMQEGNREA 2cb2A 56 :NRYGGAKMDM T0328 96 :PAIEYDLFVHLRCDRYDILHLVANE 2cb2A 68 :ESSTVRVLQYTFWKDWKDHEEMHRQ T0328 121 :ISQMFEDLV 2cb2A 97 :LFRLCYSCA T0328 130 :ELVEEERGF 2cb2A 107 :QMIWGPWEP T0328 143 :SRD 2cb2A 146 :PLD T0328 150 :VDGTENPKGRHRQEVALVG 2cb2A 149 :IPVISQPYGKRVVAFAEHS T0328 169 :SED 2cb2A 170 :PGK T0328 178 :SYIHVQKYAHNLSKWHRL 2cb2A 173 :EKQFEDAIVRTLEMLKKA T0328 196 :PLKKQEDIIG 2cb2A 213 :GAKGFHQVLE T0328 214 :YESED 2cb2A 223 :NPGSL T0328 229 :NLK 2cb2A 230 :DPN T0328 244 :SMPYGSLK 2cb2A 233 :NVMYSVPE T0328 252 :EQGLMFISTCRTPDHFEKMLHSMVF 2cb2A 245 :PQQYIVHVEWANTDALMFGMGRVLL Number of specific fragments extracted= 16 number of extra gaps= 1 total=215 Number of alignments=17 # 2cb2A read from 2cb2A/merged-good-all-a2m # found chain 2cb2A in template set Warning: unaligning (T0328)G17 because first residue in template chain is (2cb2A)P2 Warning: unaligning (T0328)I47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2cb2A)M32 Warning: unaligning (T0328)E49 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2cb2A)M32 Warning: unaligning (T0328)K251 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cb2A)T244 T0328 18 :NLHSVYLMFNANDN 2cb2A 3 :KPYVAINMAELKNE T0328 34 :SQLRPCIANVAQY 2cb2A 17 :PKTFEMFASVGPK T0328 50 :LTDQ 2cb2A 33 :VTAR T0328 54 :YSDSA 2cb2A 52 :LPFGN T0328 73 :LYPESR 2cb2A 57 :RYGGAK T0328 85 :F 2cb2A 63 :M T0328 87 :AMQE 2cb2A 64 :DMTK T0328 96 :PAIEYDLFVHLRCDRYDILHLVANE 2cb2A 68 :ESSTVRVLQYTFWKDWKDHEEMHRQ T0328 121 :ISQMFEDLV 2cb2A 97 :LFRLCYSCA T0328 130 :ELVEEERGFRFM 2cb2A 107 :QMIWGPWEPIYE T0328 142 :DSRDL 2cb2A 145 :KPLDI T0328 151 :DGTENPKGRHRQEVALV 2cb2A 150 :PVISQPYGKRVVAFAEH T0328 168 :GSEDPE 2cb2A 169 :IPGKEK T0328 180 :IHVQKYAHNLSKW 2cb2A 175 :QFEDAIVRTLEML T0328 217 :EDKPLTSHIKRVNLKD 2cb2A 188 :KKAPGFLGAMVLKEIG T0328 243 :QSMPYGSL 2cb2A 208 :GSMQFGAK T0328 252 :EQGLMFISTCRTPDHFEKMLHSMVFGDG 2cb2A 245 :PQQYIVHVEWANTDALMFGMGRVLLYPE T0328 281 :GNHDHLMH 2cb2A 275 :QVHDEVLD Number of specific fragments extracted= 18 number of extra gaps= 1 total=233 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t0tV/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1t0tV/merged-good-all-a2m # 1t0tV read from 1t0tV/merged-good-all-a2m # found chain 1t0tV in training set Warning: unaligning (T0328)S21 because of BadResidue code BAD_PEPTIDE in next template residue (1t0tV)L14 Warning: unaligning (T0328)V22 because of BadResidue code BAD_PEPTIDE at template residue (1t0tV)L14 Warning: unaligning (T0328)L255 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t0tV)G198 Warning: unaligning (T0328)M256 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t0tV)G198 T0328 19 :LH 1t0tV 11 :WY T0328 23 :YLMFNANDN 1t0tV 15 :HDFRTIDWS T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSAFNGFV 1t0tV 29 :PNEEREAAISEFLALVDQWETTESEKQGSHAV T0328 94 :EAPAIEYDLFVHLRCDRYDILHLVANEISQM 1t0tV 62 :TIVGQKADILFMILRPTLDELHEIETALNKT T0328 125 :FEDLVELVEEERGF 1t0tV 94 :LADYLLPAYSYVSV T0328 139 :RFM 1t0tV 112 :NYL T0328 150 :VDGTENP 1t0tV 115 :ASGSEDP T0328 160 :HRQEVALV 1t0tV 136 :PKTNYICF T0328 168 :GSED 1t0tV 150 :RQGN T0328 192 :WHRLPLKKQE 1t0tV 156 :WYMLSMEQRR T0328 202 :DIIGRTKQDNIEY 1t0tV 172 :GMTGRKYAGKVTQ T0328 226 :KRVNLKDENG 1t0tV 185 :IITGSVGLDD T0328 253 :QG 1t0tV 195 :FE T0328 257 :FISTCRTPDHFEKMLHSMV 1t0tV 199 :VTLFSDDALQFKKLVYEMR T0328 282 :NHDHLMHF 1t0tV 218 :FDEVSARF T0328 292 :ALTGSSFFA 1t0tV 226 :GEFGSFFVG T0328 301 :PSLDFLM 1t0tV 237 :LPMENVS Number of specific fragments extracted= 17 number of extra gaps= 2 total=250 Number of alignments=19 # 1t0tV read from 1t0tV/merged-good-all-a2m # found chain 1t0tV in training set Warning: unaligning (T0328)S21 because of BadResidue code BAD_PEPTIDE in next template residue (1t0tV)L14 Warning: unaligning (T0328)V22 because of BadResidue code BAD_PEPTIDE at template residue (1t0tV)L14 Warning: unaligning (T0328)L255 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t0tV)G198 Warning: unaligning (T0328)M256 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t0tV)G198 T0328 19 :LH 1t0tV 11 :WY T0328 23 :YLMFNANDN 1t0tV 15 :HDFRTIDWS T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSAFNGFV 1t0tV 29 :PNEEREAAISEFLALVDQWETTESEKQGSHAV T0328 93 :REAPAIEYDLFVHLRCDRYDILHLVANEISQ 1t0tV 61 :YTIVGQKADILFMILRPTLDELHEIETALNK T0328 124 :MFEDLVELVEEERGF 1t0tV 93 :KLADYLLPAYSYVSV T0328 139 :RFM 1t0tV 112 :NYL T0328 150 :VDGTENP 1t0tV 115 :ASGSEDP T0328 158 :GRHRQEVALV 1t0tV 134 :ILPKTNYICF T0328 168 :GSED 1t0tV 150 :RQGN T0328 192 :WHRLPLKKQE 1t0tV 156 :WYMLSMEQRR T0328 202 :DIIGRTKQDNIE 1t0tV 172 :GMTGRKYAGKVT T0328 225 :IKRVNLKDENG 1t0tV 184 :QIITGSVGLDD T0328 253 :QG 1t0tV 195 :FE T0328 257 :FISTCRTPDHFEKMLHSMV 1t0tV 199 :VTLFSDDALQFKKLVYEMR T0328 282 :NHDHLMHFTS 1t0tV 218 :FDEVSARFGE T0328 294 :TGSSFFA 1t0tV 228 :FGSFFVG T0328 301 :PSLDFLMQF 1t0tV 237 :LPMENVSSF Number of specific fragments extracted= 17 number of extra gaps= 2 total=267 Number of alignments=20 # 1t0tV read from 1t0tV/merged-good-all-a2m # found chain 1t0tV in training set Warning: unaligning (T0328)S21 because of BadResidue code BAD_PEPTIDE in next template residue (1t0tV)L14 Warning: unaligning (T0328)V22 because of BadResidue code BAD_PEPTIDE at template residue (1t0tV)L14 Warning: unaligning (T0328)L255 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t0tV)G198 Warning: unaligning (T0328)M256 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t0tV)G198 T0328 19 :LH 1t0tV 11 :WY T0328 23 :YLMFNANDN 1t0tV 15 :HDFRTIDWS T0328 32 :VESQLRPCIANVAQYIYELTDQ 1t0tV 29 :PNEEREAAISEFLALVDQWETT T0328 94 :EAPAIEYDLFVHLRCDRYDILHLVANEISQ 1t0tV 62 :TIVGQKADILFMILRPTLDELHEIETALNK T0328 124 :MFEDLVELVEEERGFRFM 1t0tV 93 :KLADYLLPAYSYVSVVEL T0328 142 :DSRD 1t0tV 120 :DPYQ T0328 159 :RH 1t0tV 124 :IP T0328 161 :RQEVALV 1t0tV 137 :KTNYICF T0328 168 :GSED 1t0tV 151 :QGND T0328 191 :KWHRLPLKKQED 1t0tV 155 :NWYMLSMEQRRE T0328 203 :IIGRTKQDN 1t0tV 173 :MTGRKYAGK T0328 223 :SHIKRVNLKD 1t0tV 182 :VTQIITGSVG T0328 247 :Y 1t0tV 192 :L T0328 251 :KEQG 1t0tV 193 :DDFE T0328 257 :FISTCRTPDHFEKMLHSMV 1t0tV 199 :VTLFSDDALQFKKLVYEMR T0328 282 :NHDHLMHFTSA 1t0tV 218 :FDEVSARFGEF T0328 295 :GSSF 1t0tV 229 :GSFF Number of specific fragments extracted= 17 number of extra gaps= 2 total=284 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1omzA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1omzA expands to /projects/compbio/data/pdb/1omz.pdb.gz 1omzA:# T0328 read from 1omzA/merged-good-all-a2m # 1omzA read from 1omzA/merged-good-all-a2m # adding 1omzA to template set # found chain 1omzA in template set Warning: unaligning (T0328)P196 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1omzA)A287 T0328 24 :LMFNA 1omzA 69 :LIMQT T0328 30 :DNVESQLRPCIANVA 1omzA 74 :YNRTDLLLRLLNHYQ T0328 55 :SDSAF 1omzA 89 :AVPSL T0328 60 :NGFVAIGA 1omzA 95 :KVIVVWNN T0328 68 :NYWDSLYP 1omzA 110 :ELWNSLGP T0328 76 :ESRPEMLKPFPAMQEG 1omzA 130 :NKMRNRLQVFPEVETN T0328 102 :LFVHLRCDR 1omzA 146 :AVLMVDDDT T0328 111 :YDILHLVANEISQMFEDL 1omzA 158 :AQDLVFAFSIWQQFPDQI T0328 129 :VELVEEERGF 1omzA 178 :FVPRKHVSTS T0328 148 :GFVDGTENPKGRH 1omzA 195 :GFELQTPGPGNGD T0328 161 :RQEVALVGSE 1omzA 213 :LIGASFFNSK T0328 181 :HVQKYAHNLSKWHRL 1omzA 223 :YLELFQKQPAAVHAL T0328 197 :LKKQE 1omzA 288 :EHFLQ T0328 202 :DII 1omzA 302 :NIY T0328 217 :EDKPLT 1omzA 305 :DGMPLK Number of specific fragments extracted= 15 number of extra gaps= 0 total=299 Number of alignments=22 # 1omzA read from 1omzA/merged-good-all-a2m # found chain 1omzA in template set T0328 23 :YLMFNAN 1omzA 68 :TLIMQTY T0328 31 :NVESQLRPCIANVAQ 1omzA 75 :NRTDLLLRLLNHYQA T0328 55 :S 1omzA 90 :V T0328 57 :SAF 1omzA 91 :PSL T0328 60 :NGFVAIGA 1omzA 95 :KVIVVWNN T0328 68 :NYWDSLYP 1omzA 110 :ELWNSLGP T0328 76 :ESRPEMLKPFPAMQEG 1omzA 130 :NKMRNRLQVFPEVETN T0328 102 :LFVHLRCD 1omzA 146 :AVLMVDDD T0328 110 :RYDILHLVANEISQMFEDL 1omzA 157 :SAQDLVFAFSIWQQFPDQI T0328 129 :VELVEEERGF 1omzA 178 :FVPRKHVSTS T0328 148 :GFVDGTENPKGRH 1omzA 195 :GFELQTPGPGNGD T0328 161 :RQEVALVGSE 1omzA 213 :LIGASFFNSK T0328 181 :HVQKYAHNLSKWHRL 1omzA 223 :YLELFQKQPAAVHAL T0328 198 :KKQE 1omzA 289 :HFLQ T0328 202 :DII 1omzA 302 :NIY T0328 210 :DNIEYESED 1omzA 305 :DGMPLKYSN Number of specific fragments extracted= 16 number of extra gaps= 0 total=315 Number of alignments=23 # 1omzA read from 1omzA/merged-good-all-a2m # found chain 1omzA in template set T0328 27 :NA 1omzA 72 :QT T0328 30 :DNVESQLRPCIANVAQ 1omzA 74 :YNRTDLLLRLLNHYQA T0328 55 :SDSAFNGFVAIGA 1omzA 90 :VPSLHKVIVVWNN T0328 68 :NYWDSLYP 1omzA 110 :ELWNSLGP T0328 77 :SRPEMLKPFPAMQEG 1omzA 131 :KMRNRLQVFPEVETN T0328 102 :LFVHLRCD 1omzA 146 :AVLMVDDD T0328 110 :RYDILHLVANEISQM 1omzA 157 :SAQDLVFAFSIWQQF T0328 126 :EDLVE 1omzA 172 :PDQII T0328 131 :LVEEERGFRFMD 1omzA 184 :VSTSSGIYSYGG T0328 149 :FVDGTENPKGRHRQEVALV 1omzA 196 :FELQTPGPGNGDQYSMVLI T0328 168 :GS 1omzA 220 :NS T0328 180 :IH 1omzA 222 :KY T0328 189 :LSKWHRLPL 1omzA 224 :LELFQKQPA Number of specific fragments extracted= 13 number of extra gaps= 0 total=328 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o08A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1o08A/merged-good-all-a2m # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set T0328 29 :NDN 1o08A 1060 :ADK T0328 32 :VESQLRPCIANVAQYIYELTDQYSDS 1o08A 1065 :SAEEFKELAKRKNDNYVKMIQDVSPA T0328 58 :AFNGFVAIGANYWDSLYP 1o08A 1107 :KIKIALASASKNGPFLLE T0328 76 :ESRPEMLK 1o08A 1126 :MNLTGYFD T0328 84 :PFPAMQEGNRE 1o08A 1137 :DPAEVAASKPA T0328 95 :APAIEYDLFVHLRC 1o08A 1158 :VGVAPSESIGLEDS T0328 112 :DILHLVANEI 1o08A 1172 :QAGIQAIKDS T0328 122 :SQMFEDLVE 1o08A 1191 :PEDLGDDIV T0328 166 :LV 1o08A 1200 :IV T0328 190 :SKWHRLPLKKQEDII 1o08A 1202 :PDTSHYTLEFLKEVW Number of specific fragments extracted= 10 number of extra gaps= 0 total=338 Number of alignments=25 # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set T0328 29 :NDN 1o08A 1060 :ADK T0328 32 :VESQLRPCIANVAQYIYELTDQYSD 1o08A 1065 :SAEEFKELAKRKNDNYVKMIQDVSP T0328 57 :SAFNGFVAIGANYWDSLYP 1o08A 1106 :NKIKIALASASKNGPFLLE T0328 77 :SRPEMLK 1o08A 1127 :NLTGYFD T0328 84 :PFPAMQEGNREA 1o08A 1137 :DPAEVAASKPAP T0328 96 :PAIEYDLFVHLRC 1o08A 1159 :GVAPSESIGLEDS T0328 112 :DILHLVANEIS 1o08A 1172 :QAGIQAIKDSG T0328 123 :QMFEDLVELVEEER 1o08A 1192 :EDLGDDIVIVPDTS Number of specific fragments extracted= 8 number of extra gaps= 0 total=346 Number of alignments=26 # 1o08A read from 1o08A/merged-good-all-a2m # found chain 1o08A in training set T0328 28 :ANDN 1o08A 1059 :LADK T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSA 1o08A 1065 :SAEEFKELAKRKNDNYVKMIQDVSPAD T0328 59 :FNGFVAIGAN 1o08A 1108 :IKIALASASK T0328 69 :YWDSLYP 1o08A 1122 :LLERMNL T0328 76 :E 1o08A 1130 :G T0328 77 :SRPEMLKPF 1o08A 1136 :ADPAEVAAS T0328 87 :A 1o08A 1146 :P T0328 110 :RYDILHLVANE 1o08A 1147 :APDIFIAAAHA Number of specific fragments extracted= 8 number of extra gaps= 0 total=354 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fj2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1fj2A/merged-good-all-a2m # 1fj2A read from 1fj2A/merged-good-all-a2m # found chain 1fj2A in training set Warning: unaligning (T0328)N29 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)S74 Warning: unaligning (T0328)D30 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)D76 Warning: unaligning (T0328)N31 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)D76 Warning: unaligning (T0328)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)Q149 Warning: unaligning (T0328)E90 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)Q149 Warning: unaligning (T0328)A95 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)A155 Warning: unaligning (T0328)P96 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)A155 T0328 32 :VESQLRPCIANVAQYIYELTDQYSDS 1fj2A 80 :DESGIKQAAENIKALIDQEVKNGIPS T0328 58 :AFNGFVAIGANYWD 1fj2A 130 :KLAGVTALSCWLPL T0328 79 :P 1fj2A 144 :R T0328 86 :PAM 1fj2A 145 :ASF T0328 91 :GNRE 1fj2A 150 :GPIG T0328 97 :AIEYD 1fj2A 156 :NRDIS T0328 103 :FVHLRCDR 1fj2A 161 :ILQCHGDC T0328 111 :YDILHLVANEISQMF 1fj2A 174 :LMFGSLTVEKLKTLV T0328 126 :EDLVELVEE 1fj2A 190 :PANVTFKTY T0328 136 :RGFRF 1fj2A 199 :EGMMH Number of specific fragments extracted= 10 number of extra gaps= 3 total=364 Number of alignments=28 # 1fj2A read from 1fj2A/merged-good-all-a2m # found chain 1fj2A in training set Warning: unaligning (T0328)A28 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)S74 Warning: unaligning (T0328)N29 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)S74 Warning: unaligning (T0328)D30 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)D76 Warning: unaligning (T0328)N31 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)D76 Warning: unaligning (T0328)Y74 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)Q128 Warning: unaligning (T0328)P75 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)Q128 Warning: unaligning (T0328)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)Q149 Warning: unaligning (T0328)E90 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)Q149 Warning: unaligning (T0328)A95 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)A155 Warning: unaligning (T0328)P96 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)A155 T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSAFNGFVAIGANYW 1fj2A 80 :DESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGA T0328 71 :DSL 1fj2A 124 :ALT T0328 81 :MLKPFPAM 1fj2A 140 :WLPLRASF T0328 91 :GNRE 1fj2A 150 :GPIG T0328 97 :AIEYDLFVHLRCD 1fj2A 156 :NRDISILQCHGDC T0328 111 :YDILHLVANEISQMF 1fj2A 174 :LMFGSLTVEKLKTLV T0328 126 :EDLVELVEEERGF 1fj2A 190 :PANVTFKTYEGMM Number of specific fragments extracted= 7 number of extra gaps= 4 total=371 Number of alignments=29 # 1fj2A read from 1fj2A/merged-good-all-a2m # found chain 1fj2A in training set Warning: unaligning (T0328)A28 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)S74 Warning: unaligning (T0328)N29 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)S74 Warning: unaligning (T0328)D30 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)D76 Warning: unaligning (T0328)N31 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)D76 Warning: unaligning (T0328)P75 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)Q128 Warning: unaligning (T0328)E76 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)Q128 Warning: unaligning (T0328)Q89 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)Q149 Warning: unaligning (T0328)E90 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)Q149 Warning: unaligning (T0328)A95 because of BadResidue code BAD_PEPTIDE in next template residue (1fj2A)A155 Warning: unaligning (T0328)P96 because of BadResidue code BAD_PEPTIDE at template residue (1fj2A)A155 T0328 32 :VESQLRPCIANVAQYIYELTDQYSDSAFNGFVAIGA 1fj2A 80 :DESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQ T0328 68 :NYWDSLY 1fj2A 120 :SLYTALT T0328 79 :P 1fj2A 142 :P T0328 84 :PFPAM 1fj2A 143 :LRASF T0328 91 :GNRE 1fj2A 150 :GPIG T0328 97 :AIEYDLF 1fj2A 156 :NRDISIL T0328 105 :HLRCD 1fj2A 163 :QCHGD T0328 110 :RYDILHLVANEISQMFE 1fj2A 173 :PLMFGSLTVEKLKTLVN T0328 127 :DLVELVE 1fj2A 191 :ANVTFKT Number of specific fragments extracted= 9 number of extra gaps= 4 total=380 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fm0E/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1fm0E/merged-good-all-a2m # 1fm0E read from 1fm0E/merged-good-all-a2m # found chain 1fm0E in training set T0328 24 :LMFNANDN 1fm0E 50 :LTLEHYPG T0328 32 :VESQLRPCIANVA 1fm0E 59 :TEKALAEIVDEAR T0328 52 :DQYSDSAFNGFVAI 1fm0E 72 :NRWPLGRVTVIHRI T0328 86 :PAMQEG 1fm0E 86 :GELWPG T0328 99 :EYDLFVHLRCDRYDILHLVANEISQMFEDLVEL 1fm0E 92 :DEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPF Number of specific fragments extracted= 5 number of extra gaps= 0 total=385 Number of alignments=31 # 1fm0E read from 1fm0E/merged-good-all-a2m # found chain 1fm0E in training set T0328 24 :LMFNANDN 1fm0E 50 :LTLEHYPG T0328 32 :VESQLRPCIANVAQY 1fm0E 59 :TEKALAEIVDEARNR T0328 54 :YSDSAFNGFVA 1fm0E 74 :WPLGRVTVIHR T0328 85 :FPAMQEG 1fm0E 85 :IGELWPG T0328 99 :EYDLFVHLRCDRYDILHLVANEISQMFEDL 1fm0E 92 :DEIVFVGVTSAHRSSAFEAGQFIMDYLKTR T0328 129 :VELVEEERGF 1fm0E 124 :FWKREATPEG T0328 139 :R 1fm0E 135 :R Number of specific fragments extracted= 7 number of extra gaps= 0 total=392 Number of alignments=32 # 1fm0E read from 1fm0E/merged-good-all-a2m # found chain 1fm0E in training set T0328 24 :LMFNANDN 1fm0E 50 :LTLEHYPG T0328 32 :VESQLRPCIANVAQY 1fm0E 59 :TEKALAEIVDEARNR T0328 54 :YSDSAFNGFVAI 1fm0E 74 :WPLGRVTVIHRI T0328 86 :PAMQEG 1fm0E 86 :GELWPG T0328 99 :EYDLFVHLRCDRYDILHLVANEISQMFEDLVELVE 1fm0E 92 :DEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWK Number of specific fragments extracted= 5 number of extra gaps= 0 total=397 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1a8y/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1a8y expands to /projects/compbio/data/pdb/1a8y.pdb.gz 1a8y:Warning: there is no chain 1a8y will retry with 1a8yA # T0328 read from 1a8y/merged-good-all-a2m # 1a8y read from 1a8y/merged-good-all-a2m # adding 1a8y to template set # found chain 1a8y in template set Warning: unaligning (T0328)N18 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)N22 Warning: unaligning (T0328)L19 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)N22 Warning: unaligning (T0328)A41 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)M53 Warning: unaligning (T0328)N42 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)M53 Warning: unaligning (T0328)I204 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)T189 Warning: unaligning (T0328)G205 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)T189 Warning: unaligning (T0328)D210 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)E204 Warning: unaligning (T0328)D218 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)K211 Warning: unaligning (T0328)K219 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)K211 T0328 1 :MDIQNMPREQLGVCAEG 1a8y 4 :LDFPEYDGVDRVINVNA T0328 20 :HSVYLMFNA 1a8y 30 :YEVLALLYH T0328 29 :NDNVESQ 1a8y 41 :PEDDKAS T0328 37 :RPCI 1a8y 48 :QRQF T0328 43 :VAQYIYELTDQYSDSAFNGFVAIGA 1a8y 54 :EELILELAAQVLEDKGVGFGLVDSE T0328 68 :NYWDSL 1a8y 82 :AVAKKL T0328 87 :AMQE 1a8y 88 :GLTE T0328 99 :EYDLFVH 1a8y 92 :EDSIYVF T0328 106 :LRCDR 1a8y 104 :IEYDG T0328 111 :YDILHLVANEI 1a8y 112 :ADTLVEFLLDV T0328 125 :FEDLVELV 1a8y 123 :LEDPVELI T0328 141 :MDSRDLTGFV 1a8y 131 :EGERELQAFE T0328 157 :KGRHRQEVALVGSEDP 1a8y 141 :NIEDEIKLIGYFKNKD T0328 174 :FK 1a8y 157 :SE T0328 181 :HVQKYAHNLSKWHRL 1a8y 159 :HYKAFKEAAEEFHPY T0328 197 :LKKQEDI 1a8y 181 :DSKVAKK T0328 207 :TKQ 1a8y 190 :LKL T0328 211 :NIEY 1a8y 205 :PVTI T0328 217 :E 1a8y 209 :P T0328 220 :PLT 1a8y 212 :PNS T0328 236 :KS 1a8y 216 :EE T0328 238 :IEILRQSMPY 1a8y 219 :VNFVEEHRRS T0328 249 :SLK 1a8y 244 :DDM T0328 253 :QGLMFISTCRTP 1a8y 247 :DGIHIVAFAEEA T0328 265 :DHFEKMLHSM 1a8y 260 :PDGYEFLEIL T0328 275 :VFGDGAGNHDH 1a8y 272 :VAQDNTDNPDL Number of specific fragments extracted= 26 number of extra gaps= 5 total=423 Number of alignments=34 # 1a8y read from 1a8y/merged-good-all-a2m # found chain 1a8y in template set Warning: unaligning (T0328)N18 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)N22 Warning: unaligning (T0328)L19 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)N22 Warning: unaligning (T0328)A41 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)M53 Warning: unaligning (T0328)N42 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)M53 Warning: unaligning (T0328)I204 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)T189 Warning: unaligning (T0328)G205 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)T189 T0328 1 :MDIQNMPREQLGVCAEG 1a8y 4 :LDFPEYDGVDRVINVNA T0328 20 :HSVYLMFNA 1a8y 31 :EVLALLYHE T0328 29 :NDNVESQ 1a8y 41 :PEDDKAS T0328 37 :RPCI 1a8y 48 :QRQF T0328 43 :VAQYIYELTDQYSDSAFNGFVAIGA 1a8y 54 :EELILELAAQVLEDKGVGFGLVDSE T0328 68 :NYWDSL 1a8y 82 :AVAKKL T0328 81 :M 1a8y 88 :G T0328 88 :MQ 1a8y 89 :LT T0328 98 :IEYDLFVH 1a8y 91 :EEDSIYVF T0328 106 :LRCDR 1a8y 104 :IEYDG T0328 111 :YDILHLVANEIS 1a8y 112 :ADTLVEFLLDVL T0328 126 :EDLVELV 1a8y 124 :EDPVELI T0328 141 :MDSRDLTGFV 1a8y 131 :EGERELQAFE T0328 157 :KGRHRQEVALVGSE 1a8y 141 :NIEDEIKLIGYFKN T0328 172 :PEFK 1a8y 155 :KDSE T0328 181 :HVQKYAHNLSKWHRL 1a8y 159 :HYKAFKEAAEEFHPY T0328 196 :PLKKQED 1a8y 181 :DSKVAKK T0328 206 :RT 1a8y 190 :LK T0328 209 :QDNIEY 1a8y 192 :LNEIDF T0328 222 :TSHIKRVN 1a8y 227 :RSTLRKLK T0328 252 :EQGLMFISTCR 1a8y 246 :MDGIHIVAFAE T0328 263 :TPDHFEKMLHSMVFGDGAGN 1a8y 261 :DGYEFLEILKSVAQDNTDNP T0328 284 :D 1a8y 281 :D Number of specific fragments extracted= 23 number of extra gaps= 3 total=446 Number of alignments=35 # 1a8y read from 1a8y/merged-good-all-a2m # found chain 1a8y in template set Warning: unaligning (T0328)A41 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)M53 Warning: unaligning (T0328)N42 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)M53 Warning: unaligning (T0328)I204 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)T189 Warning: unaligning (T0328)G205 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)T189 Warning: unaligning (T0328)D210 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)E204 Warning: unaligning (T0328)S216 because of BadResidue code BAD_PEPTIDE in next template residue (1a8y)K211 Warning: unaligning (T0328)E217 because of BadResidue code BAD_PEPTIDE at template residue (1a8y)K211 T0328 21 :SVYLMFNANDNVESQLRPCI 1a8y 32 :VLALLYHEPPEDDKASQRQF T0328 43 :VAQYIYELTDQYSDSAFNGFVAIGAN 1a8y 54 :EELILELAAQVLEDKGVGFGLVDSEK T0328 69 :YWDSLY 1a8y 83 :VAKKLG T0328 88 :MQ 1a8y 89 :LT T0328 98 :IEYDLFVH 1a8y 91 :EEDSIYVF T0328 106 :LRCD 1a8y 104 :IEYD T0328 110 :RYDILHLVANEIS 1a8y 111 :SADTLVEFLLDVL T0328 126 :EDLVELVE 1a8y 124 :EDPVELIE T0328 142 :DSRDLTGFV 1a8y 132 :GERELQAFE T0328 157 :KGRHRQEVALV 1a8y 141 :NIEDEIKLIGY T0328 168 :GSEDP 1a8y 154 :NKDSE T0328 174 :F 1a8y 159 :H T0328 179 :YIHVQKYAHNL 1a8y 160 :YKAFKEAAEEF T0328 193 :HR 1a8y 171 :HP T0328 195 :L 1a8y 180 :F T0328 197 :LKKQEDI 1a8y 181 :DSKVAKK T0328 206 :RTKQ 1a8y 190 :LKLN T0328 211 :NIEYE 1a8y 205 :PVTIP T0328 218 :DKP 1a8y 212 :PNS T0328 222 :TSHIKRVNLKDE 1a8y 225 :HRRSTLRKLKPE T0328 251 :KEQGLMFISTCR 1a8y 245 :DMDGIHIVAFAE T0328 263 :TPDHFEKMLHSMVFGDGAGN 1a8y 261 :DGYEFLEILKSVAQDNTDNP T0328 294 :TGSSFFAPS 1a8y 281 :DLSIIWIDP Number of specific fragments extracted= 23 number of extra gaps= 4 total=469 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 3gcb/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 3gcb expands to /projects/compbio/data/pdb/3gcb.pdb.gz 3gcb:Warning: there is no chain 3gcb will retry with 3gcbA # T0328 read from 3gcb/merged-good-all-a2m # 3gcb read from 3gcb/merged-good-all-a2m # adding 3gcb to template set # found chain 3gcb in template set T0328 32 :VESQLRPCIANVAQYIYELTDQYSDS 3gcb 176 :WNSLLTTKLREFAETLRTALKERSAD T0328 58 :AFNGFV 3gcb 267 :TPVSLI T0328 84 :PFPAMQEGNR 3gcb 273 :NDPRHPYGKL T0328 94 :EAPAIEYDLFVHLRCDRYDILHLVANEISQM 3gcb 288 :LGNVLGGDAVIYLNVDNETLSKLVVKRLQNN T0328 139 :RFMDSRD 3gcb 341 :ELWNYPA T0328 147 :TG 3gcb 348 :IG T0328 153 :TENP 3gcb 350 :YNLP T0328 157 :KGRHRQEVALV 3gcb 380 :ETSKLPLRYRV T0328 168 :GSEDPEFKGGSYIHVQKYAHNL 3gcb 393 :SWGKDSGKDGLYVMTQKYFEEY T0328 192 :WHRLPLKKQE 3gcb 422 :INELPKELAS T0328 203 :IIGRTKQDNIEY 3gcb 432 :KFTSGKEEPIVL Number of specific fragments extracted= 11 number of extra gaps= 0 total=480 Number of alignments=37 # 3gcb read from 3gcb/merged-good-all-a2m # found chain 3gcb in template set T0328 32 :VESQLRPCIANVAQYIYELTDQYSD 3gcb 176 :WNSLLTTKLREFAETLRTALKERSA T0328 57 :SAFNGFV 3gcb 266 :STPVSLI T0328 84 :PFPAMQEGN 3gcb 273 :NDPRHPYGK T0328 93 :REAPAIEYDLFVHLRCDRYDILHLVANEIS 3gcb 287 :RLGNVLGGDAVIYLNVDNETLSKLVVKRLQ T0328 139 :RFMDSRDL 3gcb 341 :ELWNYPAI T0328 152 :GTENP 3gcb 349 :GYNLP T0328 157 :KGRHRQEVALV 3gcb 380 :ETSKLPLRYRV T0328 168 :GSEDPEFKGGSYIHVQKYAHNL 3gcb 393 :SWGKDSGKDGLYVMTQKYFEEY T0328 192 :WHRLPLKKQ 3gcb 422 :INELPKELA T0328 202 :DIIGRTKQDNIEYESED 3gcb 431 :SKFTSGKEEPIVLPIWD Number of specific fragments extracted= 10 number of extra gaps= 0 total=490 Number of alignments=38 # 3gcb read from 3gcb/merged-good-all-a2m # found chain 3gcb in template set T0328 30 :DNVESQLRPCIANVAQYIYELTDQ 3gcb 199 :SADDSIIVTLREQMQREIFRLMSL T0328 54 :YSDSAFNGFVA 3gcb 263 :LDPSTPVSLIN T0328 85 :FPAMQEGNR 3gcb 274 :DPRHPYGKL T0328 94 :EAPAIEYDLFVHLRCDRYDILHLVANEISQ 3gcb 288 :LGNVLGGDAVIYLNVDNETLSKLVVKRLQN T0328 160 :HRQEVALV 3gcb 318 :NKAVFFGS T0328 171 :DPEF 3gcb 339 :DIEL T0328 187 :HNLSKWHRLPLKKQEDIIG 3gcb 343 :WNYPAIGYNLPQQKASRIR T0328 215 :ESEDKPLTSHIKRVNLKDENGKSIEILRQSMPYGSL 3gcb 362 :YHESLMTHAMLITGCHVDETSKLPLRYRVENSWGKD T0328 251 :KEQGLMFIS 3gcb 399 :GKDGLYVMT T0328 264 :PDHFEKM 3gcb 408 :QKYFEEY Number of specific fragments extracted= 10 number of extra gaps= 0 total=500 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1iq4A/merged-good-all-a2m # 1iq4A read from 1iq4A/merged-good-all-a2m # found chain 1iq4A in training set T0328 75 :PESRPEMLKPF 1iq4A 21 :NYKSIMQVPKI T0328 100 :YDLFVHLRCDR 1iq4A 32 :EKIVINMGVGD T0328 111 :YDILHLVANEISQMFEDLVELVEEERGFRFMDSR 1iq4A 47 :PKALDSAVEELTLIAGQRPVVTRAKKSIAGFRLR T0328 157 :KGRHRQEVALV 1iq4A 81 :QGMPIGAKVTL T0328 177 :GSYIHVQKYAH 1iq4A 95 :RMYEFLDKLIS T0328 188 :NLSKWHRLP 1iq4A 107 :SLPRARDFR T0328 208 :KQDNIEYESED 1iq4A 116 :GVSKKSFDGRG T0328 226 :KRVNLKD 1iq4A 128 :YTLGIKE T0328 234 :N 1iq4A 139 :P T0328 244 :SMPY 1iq4A 140 :EIDY T0328 248 :GSLKEQGLMFISTCRTPDHFEKMLHSM 1iq4A 147 :NKVRGMDIVIVTTANTDEEARELLALL Number of specific fragments extracted= 11 number of extra gaps= 0 total=511 Number of alignments=40 # 1iq4A read from 1iq4A/merged-good-all-a2m # found chain 1iq4A in training set T0328 17 :GNLHSVYLMFNAND 1iq4A 29 :PKIEKIVINMGVGD T0328 31 :NVE 1iq4A 45 :QNP T0328 38 :PCIANVAQYIYELTDQYSD 1iq4A 48 :KALDSAVEELTLIAGQRPV T0328 70 :WDSLYP 1iq4A 108 :LPRARD T0328 76 :E 1iq4A 124 :G T0328 77 :SRPEM 1iq4A 133 :KEQLI T0328 85 :FPAMQEGNR 1iq4A 138 :FPEIDYDKV T0328 95 :APAIEYDLFVHLRCDRYDILHLVANEI 1iq4A 147 :NKVRGMDIVIVTTANTDEEARELLALL Number of specific fragments extracted= 8 number of extra gaps= 0 total=519 Number of alignments=41 # 1iq4A read from 1iq4A/merged-good-all-a2m # found chain 1iq4A in training set T0328 5 :NMPREQL 1iq4A 22 :YKSIMQV T0328 17 :GNLHSVYLMFNAND 1iq4A 29 :PKIEKIVINMGVGD T0328 31 :NVE 1iq4A 45 :QNP T0328 38 :PCIANVAQYIYELTDQ 1iq4A 48 :KALDSAVEELTLIAGQ T0328 77 :SRPEM 1iq4A 133 :KEQLI T0328 85 :FPAMQEGNR 1iq4A 138 :FPEIDYDKV T0328 95 :APAIEYDLFVHLRCDRYDILHLVANEI 1iq4A 147 :NKVRGMDIVIVTTANTDEEARELLALL Number of specific fragments extracted= 7 number of extra gaps= 0 total=526 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zdzA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zdzA expands to Error: no filename for 1zdzA 1zdzA expands to Error: no filename for 1zdzA 1zdzA expands to Error: no filename for 1zdzA # T0328 read from 1zdzA/merged-good-all-a2m # 1zdzA read from 1zdzA/merged-good-all-a2m # adding 1zdzA to template set Error: can't find template for 1zdzA or 1zdzA, so skipping it. # 1zdzA read from 1zdzA/merged-good-all-a2m # adding 1zdzA to template set Error: can't find template for 1zdzA or 1zdzA, so skipping it. # 1zdzA read from 1zdzA/merged-good-all-a2m # adding 1zdzA to template set Error: can't find template for 1zdzA or 1zdzA, so skipping it. # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r8gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r8gA expands to /projects/compbio/data/pdb/1r8g.pdb.gz 1r8gA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0328 read from 1r8gA/merged-good-all-a2m # 1r8gA read from 1r8gA/merged-good-all-a2m # adding 1r8gA to template set # found chain 1r8gA in template set Warning: unaligning (T0328)S77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1r8gA)N122 T0328 16 :EGNLHSVYLMFNANDN 1r8gA 53 :DITESMLELATDVCRD T0328 33 :ESQLRPCIANVAQYIYELTDQYSDS 1r8gA 69 :INQAAGQFSAMQKVVLQAATDHHLE T0328 78 :RPEMLKP 1r8gA 123 :FGYLIQQ T0328 97 :AIEYDLFVHLRCDRYDILHLVANEISQM 1r8gA 130 :ATVFGQHVHVGCASGDDAIYLLHGLSRF T0328 130 :ELVEEERGFRFMDSRDLTG 1r8gA 169 :PYMQGTDTRFASSRPNIFS T0328 149 :FVDGTENPK 1r8gA 189 :FPDNGPMPW T0328 159 :RH 1r8gA 199 :SN T0328 182 :VQKYAHNLSKWHRL 1r8gA 201 :WQQFEALFRCLSYT T0328 207 :TKQDNI 1r8gA 215 :TMIDSI T0328 213 :EY 1r8gA 222 :DL T0328 220 :PL 1r8gA 224 :HW T0328 224 :HIKRV 1r8gA 226 :DIRPS T0328 251 :KEQGLMFISTCRTP 1r8gA 231 :PHFGTVEVRVMDTP T0328 265 :DHFEKMLHSMV 1r8gA 248 :SHAVNMAGLIQ Number of specific fragments extracted= 14 number of extra gaps= 0 total=540 Number of alignments=43 # 1r8gA read from 1r8gA/merged-good-all-a2m # found chain 1r8gA in template set Warning: unaligning (T0328)S77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1r8gA)N122 T0328 16 :EGNLHSVYLMFNANDNV 1r8gA 53 :DITESMLELATDVCRDI T0328 34 :SQLRPCIANVAQYIYELTDQYSD 1r8gA 70 :NQAAGQFSAMQKVVLQAATDHHL T0328 78 :RPEMLKPFPAMQ 1r8gA 123 :FGYLIQQATVFG T0328 102 :LFVHLRCDRYDILHLVANEIS 1r8gA 135 :QHVHVGCASGDDAIYLLHGLS T0328 129 :VELVEEERGFRFMDSRDLT 1r8gA 168 :SPYMQGTDTRFASSRPNIF T0328 148 :GFVDGTENP 1r8gA 188 :AFPDNGPMP T0328 252 :EQGLMFISTC 1r8gA 232 :HFGTVEVRVM T0328 262 :RTPDHFEKMLHSMVF 1r8gA 245 :LTLSHAVNMAGLIQA Number of specific fragments extracted= 8 number of extra gaps= 0 total=548 Number of alignments=44 # 1r8gA read from 1r8gA/merged-good-all-a2m # found chain 1r8gA in template set Warning: unaligning (T0328)S77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1r8gA)N122 T0328 16 :EGNLHSVYLMFNAN 1r8gA 53 :DITESMLELATDVC T0328 31 :NVESQLRPCIANVAQYIYELTDQ 1r8gA 67 :RDINQAAGQFSAMQKVVLQAATD T0328 78 :RPEMLKPFPAMQ 1r8gA 123 :FGYLIQQATVFG T0328 102 :LFVHLRCDRYDILHLVANEISQMFE 1r8gA 135 :QHVHVGCASGDDAIYLLHGLSRFVP T0328 129 :V 1r8gA 168 :S T0328 133 :EEERGFRFM 1r8gA 169 :PYMQGTDTR T0328 142 :DSRDLTG 1r8gA 181 :SRPNIFS T0328 149 :FVDGTENPKGRH 1r8gA 189 :FPDNGPMPWVSN T0328 182 :VQKYAHNLSKWHRL 1r8gA 201 :WQQFEALFRCLSYT T0328 218 :DKPL 1r8gA 215 :TMID T0328 222 :TSHIKRVNL 1r8gA 222 :DLHWDIRPS T0328 251 :KEQGLMFISTC 1r8gA 231 :PHFGTVEVRVM T0328 262 :RTPDHFEKMLHSMV 1r8gA 245 :LTLSHAVNMAGLIQ Number of specific fragments extracted= 13 number of extra gaps= 0 total=561 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ys4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ys4A expands to /projects/compbio/data/pdb/1ys4.pdb.gz 1ys4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0328 read from 1ys4A/merged-good-all-a2m # 1ys4A read from 1ys4A/merged-good-all-a2m # adding 1ys4A to template set # found chain 1ys4A in template set T0328 43 :VAQYIYELTDQYSDSAFNGFVA 1ys4A 20 :VGQRFVQLLADHPMFELTALAA T0328 65 :IGANYWDSL 1ys4A 46 :AGKKYKDAC T0328 74 :YPESRPEMLKPFPAMQEGNREAPAIEYDLFVH 1ys4A 58 :QDRDIPENIKDMVVIPTDPKHEEFEDVDIVFS T0328 108 :CDRYDILHLVANEISQM 1ys4A 90 :ALPSDLAKKFEPEFAKE T0328 125 :FEDLVELVEE 1ys4A 131 :NADHLELIEI T0328 143 :SRDLTGFV 1ys4A 141 :QREKRGWD T0328 157 :KGRHRQEVALV 1ys4A 242 :NRVAVIDGHTE T0328 168 :GSE 1ys4A 259 :KEG T0328 195 :LPLKKQEDIIGRTKQ 1ys4A 262 :AEPEEIKEVMDKFDP T0328 210 :DNIEYESEDKPLT 1ys4A 278 :KDLNLPTYAKPIV T0328 230 :LKDENGKSIEILRQSMPY 1ys4A 292 :REEIDRPQPRLDRNEGNG T0328 248 :GSLKEQGLMFIS 1ys4A 320 :DPIFDVKYTALE Number of specific fragments extracted= 12 number of extra gaps= 0 total=573 Number of alignments=46 # 1ys4A read from 1ys4A/merged-good-all-a2m # found chain 1ys4A in template set T0328 43 :VAQYIYELTDQYSDSAFNGFV 1ys4A 20 :VGQRFVQLLADHPMFELTALA T0328 65 :IGANYW 1ys4A 41 :ASERSA T0328 71 :DSL 1ys4A 52 :DAC T0328 74 :YPESRPEMLKPFPAMQEGNREAPAIEYDLFVH 1ys4A 58 :QDRDIPENIKDMVVIPTDPKHEEFEDVDIVFS T0328 108 :CDRYDILHLVANEISQM 1ys4A 90 :ALPSDLAKKFEPEFAKE T0328 129 :VELV 1ys4A 108 :KLIF T0328 147 :TGFVDGTENP 1ys4A 115 :SAYRMEEDVP T0328 157 :KGRHRQEVALV 1ys4A 242 :NRVAVIDGHTE T0328 168 :GSE 1ys4A 259 :KEG T0328 195 :LPLKKQEDIIG 1ys4A 262 :AEPEEIKEVMD T0328 206 :RTKQDNIEYESEDKPLT 1ys4A 274 :FDPLKDLNLPTYAKPIV T0328 229 :NLKDENGKSIEILRQ 1ys4A 291 :IREEIDRPQPRLDRN T0328 247 :YGSLK 1ys4A 306 :EGNGM T0328 252 :EQGLMFISTC 1ys4A 322 :IFDVKYTALE Number of specific fragments extracted= 14 number of extra gaps= 0 total=587 Number of alignments=47 # 1ys4A read from 1ys4A/merged-good-all-a2m # found chain 1ys4A in template set T0328 17 :GNLHSVYLMFNANDN 1ys4A 247 :IDGHTESIFVKTKEG T0328 32 :VESQLRPCIAN 1ys4A 263 :EPEEIKEVMDK T0328 54 :YSDSAFNGFVA 1ys4A 305 :NEGNGMSIVVG T0328 95 :APAIEYDLFVHLRCDR 1ys4A 318 :RKDPIFDVKYTALEHN T0328 111 :YDILHLVANEISQMF 1ys4A 339 :AGASVLNAEYFVKKY Number of specific fragments extracted= 5 number of extra gaps= 0 total=592 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ftrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1ftrA/merged-good-all-a2m # 1ftrA read from 1ftrA/merged-good-all-a2m # found chain 1ftrA in training set Warning: unaligning (T0328)F103 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ftrA)F169 Warning: unaligning (T0328)V104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ftrA)F169 T0328 15 :AEGNLHSVYLMFNAND 1ftrA 66 :TPDGRPGVTIMIGHND T0328 33 :ESQLRPCI 1ftrA 82 :EDELKEQL T0328 44 :AQYIYELTDQYSDS 1ftrA 90 :LDRIGQCVMTAPTA T0328 94 :EAPAIE 1ftrA 157 :SFGITT T0328 100 :YDL 1ftrA 165 :AGG T0328 105 :HLRCDRYDILHLVANEISQMFEDL 1ftrA 170 :YIMAESQPAGLQAAEAAVDAIKGV T0328 136 :RGF 1ftrA 194 :EGA T0328 139 :RFMDSRDL 1ftrA 198 :APFPGGIV T0328 148 :GFVDGTENPKGRHRQE 1ftrA 206 :ASASKVGSKQYDFLPA T0328 169 :SE 1ftrA 222 :ST T0328 189 :LSKWH 1ftrA 224 :NDAYC T0328 207 :TKQDNIEYESEDK 1ftrA 229 :PTVEDNELPEGVK T0328 253 :QGLMFISTCRTPDHFEKMLHSMV 1ftrA 242 :CVYEIVINGLNEEAVKEAMRVGI T0328 276 :FGDGAGNHDH 1ftrA 278 :AGNFGGKLGQ T0328 286 :LMH 1ftrA 292 :LHD Number of specific fragments extracted= 15 number of extra gaps= 1 total=607 Number of alignments=49 # 1ftrA read from 1ftrA/merged-good-all-a2m # found chain 1ftrA in training set Warning: unaligning (T0328)F103 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ftrA)F169 Warning: unaligning (T0328)V104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ftrA)F169 T0328 15 :AEGNLHSVYLMFNA 1ftrA 66 :TPDGRPGVTIMIGH T0328 31 :NVESQLRPCI 1ftrA 80 :NDEDELKEQL T0328 44 :AQYIYELTDQYSD 1ftrA 90 :LDRIGQCVMTAPT T0328 101 :DL 1ftrA 166 :GG T0328 105 :HLRCDRYDILHLVANEISQMFEDL 1ftrA 170 :YIMAESQPAGLQAAEAAVDAIKGV T0328 136 :RGF 1ftrA 194 :EGA T0328 139 :RFMDSRDL 1ftrA 198 :APFPGGIV T0328 148 :GFVDGTE 1ftrA 206 :ASASKVG T0328 168 :GSEDPEFKGG 1ftrA 213 :SKQYDFLPAS T0328 189 :LSKW 1ftrA 224 :NDAY T0328 206 :RT 1ftrA 229 :PT T0328 209 :QDNIEYESEDK 1ftrA 231 :VEDNELPEGVK T0328 226 :KR 1ftrA 242 :CV T0328 255 :LMFISTCRTPDHFEKMLHSMV 1ftrA 244 :YEIVINGLNEEAVKEAMRVGI T0328 276 :FGDGA 1ftrA 268 :CQQPG Number of specific fragments extracted= 15 number of extra gaps= 1 total=622 Number of alignments=50 # 1ftrA read from 1ftrA/merged-good-all-a2m # found chain 1ftrA in training set Warning: unaligning (T0328)V104 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ftrA)F169 T0328 16 :EGNLHSVYLMF 1ftrA 69 :GRPGVTIMIGH T0328 31 :NVESQLRPCI 1ftrA 80 :NDEDELKEQL T0328 44 :AQYIYELTDQ 1ftrA 90 :LDRIGQCVMT T0328 54 :YSDSAFN 1ftrA 109 :MPEAEKE T0328 66 :GANYWDSLYP 1ftrA 121 :GYKLSFFGDG T0328 94 :EAPAIEYDLF 1ftrA 134 :EDELDGRKVW T0328 105 :HLRCDRYDILHLVANEISQMFEDL 1ftrA 170 :YIMAESQPAGLQAAEAAVDAIKGV T0328 136 :RGFRFMDSRDLTG 1ftrA 194 :EGAYAPFPGGIVA T0328 149 :FVDGTENPKGRHRQE 1ftrA 209 :SKVGSKQYDFLPAST T0328 189 :LSKWH 1ftrA 224 :NDAYC T0328 207 :TKQDNIEYESEDK 1ftrA 229 :PTVEDNELPEGVK T0328 224 :HIKRVN 1ftrA 242 :CVYEIV T0328 259 :STCRTPDHFEKMLHSMV 1ftrA 248 :INGLNEEAVKEAMRVGI T0328 284 :D 1ftrA 265 :E Number of specific fragments extracted= 14 number of extra gaps= 1 total=636 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fxlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0328 read from 1fxlA/merged-good-all-a2m # 1fxlA read from 1fxlA/merged-good-all-a2m # found chain 1fxlA in training set T0328 22 :VYLMFNANDN 1fxlA 40 :NLIVNYLPQN T0328 32 :VESQLRPCIANV 1fxlA 51 :TQEEFRSLFGSI T0328 83 :KPFPAMQ 1fxlA 63 :GEIESCK T0328 90 :EGNREAPAIEY 1fxlA 72 :RDKITGQSLGY T0328 102 :L 1fxlA 83 :G T0328 105 :HLRCDRYDILHLVANEI 1fxlA 84 :FVNYIDPKDAEKAINTL T0328 126 :E 1fxlA 101 :N T0328 137 :GFRFMD 1fxlA 102 :GLRLQT T0328 149 :FVDGTENPKGRHRQE 1fxlA 110 :IKVSYARPSSASIRD T0328 164 :VALVGSEDPE 1fxlA 126 :NLYVSGLPKT T0328 195 :LPLKKQEDII 1fxlA 136 :MTQKELEQLF T0328 210 :DN 1fxlA 146 :SQ T0328 217 :EDKPLTS 1fxlA 148 :YGRIITS T0328 227 :RVNLKDENGKSI 1fxlA 155 :RILVDQVTGVSR T0328 254 :GLMFIST 1fxlA 167 :GVGFIRF T0328 262 :RTPDHFEKMLHSMVFGDGAGNHDHL 1fxlA 174 :DKRIEAEEAIKGLNGQKPSGATEPI Number of specific fragments extracted= 16 number of extra gaps= 0 total=652 Number of alignments=52 # 1fxlA read from 1fxlA/merged-good-all-a2m # found chain 1fxlA in training set T0328 22 :VYLMFNANDN 1fxlA 40 :NLIVNYLPQN T0328 32 :VESQLRPCIAN 1fxlA 51 :TQEEFRSLFGS T0328 82 :LKPFPAMQ 1fxlA 62 :IGEIESCK T0328 90 :EGNREAPAIEY 1fxlA 72 :RDKITGQSLGY T0328 102 :LFVHL 1fxlA 83 :GFVNY T0328 109 :DRYDI 1fxlA 88 :IDPKD T0328 118 :ANEISQMFEDL 1fxlA 93 :AEKAINTLNGL T0328 134 :EERGFR 1fxlA 104 :RLQTKT T0328 149 :FVDGTENPKGRHRQEV 1fxlA 110 :IKVSYARPSSASIRDA T0328 165 :ALVGSEDPE 1fxlA 127 :LYVSGLPKT T0328 195 :LPLKKQEDIIGRTK 1fxlA 136 :MTQKELEQLFSQYG T0328 219 :K 1fxlA 150 :R T0328 225 :IK 1fxlA 151 :II T0328 227 :RVNLKDENGKSI 1fxlA 155 :RILVDQVTGVSR T0328 254 :GLMFIS 1fxlA 167 :GVGFIR T0328 261 :CRTPDHFEKMLHSMVFGDGAGNHDHL 1fxlA 173 :FDKRIEAEEAIKGLNGQKPSGATEPI Number of specific fragments extracted= 16 number of extra gaps= 0 total=668 Number of alignments=53 # 1fxlA read from 1fxlA/merged-good-all-a2m # found chain 1fxlA in training set T0328 23 :YLMFNANDN 1fxlA 41 :LIVNYLPQN T0328 32 :VESQLRPCIANV 1fxlA 51 :TQEEFRSLFGSI T0328 83 :KPFP 1fxlA 63 :GEIE T0328 87 :AMQEGNREAPAIEY 1fxlA 69 :KLVRDKITGQSLGY T0328 104 :VHLRCDRYDI 1fxlA 83 :GFVNYIDPKD T0328 118 :ANEISQMFEDL 1fxlA 93 :AEKAINTLNGL T0328 130 :ELVEEERGFRFM 1fxlA 104 :RLQTKTIKVSYA T0328 155 :NPKGRH 1fxlA 116 :RPSSAS T0328 161 :RQEVALVGSEDP 1fxlA 123 :RDANLYVSGLPK T0328 194 :RLPLKKQEDIIG 1fxlA 135 :TMTQKELEQLFS T0328 216 :SE 1fxlA 147 :QY T0328 222 :TSHIKRVNLKDENGK 1fxlA 149 :GRIITSRILVDQVTG T0328 251 :KEQGLMFIST 1fxlA 164 :VSRGVGFIRF T0328 262 :RTPDHFEKMLHSMVFGDGAGN 1fxlA 174 :DKRIEAEEAIKGLNGQKPSGA Number of specific fragments extracted= 14 number of extra gaps= 0 total=682 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nriA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nriA expands to /projects/compbio/data/pdb/1nri.pdb.gz 1nriA:Skipped atom 200, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 202, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 204, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 206, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 208, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 210, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 212, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 214, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 216, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 218, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 220, because occupancy 0.500 <= existing 0.500 in 1nriA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 947, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 949, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 951, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 953, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 955, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 957, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 959, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 961, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 963, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 965, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1158, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1160, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1162, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1164, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1166, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1168, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1170, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1172, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1174, because occupancy 0.500 <= existing 0.500 in 1nriA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1574, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1576, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1578, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1580, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1582, because occupancy 0.500 <= existing 0.500 in 1nriA Skipped atom 1584, because occupancy 0.500 <= existing 0.500 in 1nriA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M WARNING: atom 1820 has residue number 249 < previous residue 306 in 1nriA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0328 read from 1nriA/merged-good-all-a2m # 1nriA read from 1nriA/merged-good-all-a2m # adding 1nriA to template set # found chain 1nriA in template set T0328 33 :ESQLRPCIANVAQYIYELTDQYSD 1nriA 47 :IESCLPQISLAVEQIVQAFQQGGR T0328 58 :AFNGFV 1nriA 100 :MVKGII T0328 76 :ESRPEMLKPFPA 1nriA 113 :RHPVEGAEDNTK T0328 94 :EAPAIEYDLFVHLRCDR 1nriA 132 :SIHFSKNDVLVGIAASG T0328 111 :YDILHLVANEISQM 1nriA 150 :TPYVIAGLQYAKSL T0328 125 :FED 1nriA 178 :MAE T0328 161 :RQEVALV 1nriA 181 :IADIAIE T0328 169 :SED 1nriA 191 :GPE T0328 172 :PEFKGGSYIHVQKYAHNL 1nriA 197 :GSSRLKSGTAQKMVLNML T0328 197 :LKKQEDIIGRTKQ 1nriA 215 :TTASMILLGKCYE T0328 210 :DNIEY 1nriA 231 :VDVQA Number of specific fragments extracted= 11 number of extra gaps= 0 total=693 Number of alignments=55 # 1nriA read from 1nriA/merged-good-all-a2m # found chain 1nriA in template set T0328 33 :ESQLRPCIANVAQYIYELTDQYSD 1nriA 47 :IESCLPQISLAVEQIVQAFQQGGR T0328 57 :SAFNGFVAIGANYWDSLYP 1nriA 99 :EMVKGIIAGGECAIRHPVE T0328 81 :MLKPFP 1nriA 118 :GAEDNT T0328 92 :N 1nriA 124 :K T0328 94 :EAPAIEYDLFVHLRCD 1nriA 132 :SIHFSKNDVLVGIAAS T0328 110 :RYDILHLVANEISQM 1nriA 149 :RTPYVIAGLQYAKSL T0328 127 :DLVELVE 1nriA 164 :GALTISI T0328 153 :TENPKGR 1nriA 171 :ASNPKSE T0328 160 :HRQEVALV 1nriA 180 :EIADIAIE T0328 169 :SED 1nriA 191 :GPE T0328 172 :PEFKGGSYIHVQKYAHNL 1nriA 197 :GSSRLKSGTAQKMVLNML T0328 197 :LKKQEDIIGRT 1nriA 215 :TTASMILLGKC T0328 209 :QDNIEYESE 1nriA 226 :YENLMVDVQ T0328 262 :RTPDHFEKMLHSMV 1nriA 235 :ASNEKLKARAVRIV Number of specific fragments extracted= 14 number of extra gaps= 0 total=707 Number of alignments=56 # 1nriA read from 1nriA/merged-good-all-a2m # found chain 1nriA in template set T0328 33 :ESQLRPCIANVAQYIYELTDQ 1nriA 47 :IESCLPQISLAVEQIVQAFQQ T0328 54 :YSDSAFNGFVA 1nriA 96 :VSTEMVKGIIA T0328 73 :LYP 1nriA 107 :GGE T0328 76 :ESRPEMLKPFPA 1nriA 113 :RHPVEGAEDNTK T0328 95 :APAIEYDLFVHLRCD 1nriA 133 :IHFSKNDVLVGIAAS T0328 110 :RYDILHLVANEISQM 1nriA 149 :RTPYVIAGLQYAKSL Number of specific fragments extracted= 6 number of extra gaps= 0 total=713 Number of alignments=57 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0328//projects/compbio/experiments/protein-predict/casp7/T0328/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0328//projects/compbio/experiments/protein-predict/casp7/T0328/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0328/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0328/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)V117.CB) [> 3.4952 = 5.8253 < 7.5728] w=1.0000 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)F103.CB) [> 3.3531 = 5.5886 < 7.2651] w=0.9813 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)V117.CB) [> 3.9262 = 6.5437 < 8.5068] w=0.9568 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)H105.CB) [> 3.2658 = 5.4430 < 7.0759] w=0.9157 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)F103.CB) [> 3.7522 = 6.2537 < 8.1299] w=0.8927 to align # Constraint # added constraint: constraint((T0328)N27.CB, (T0328)Y100.CB) [> 3.9649 = 6.6081 < 8.5906] w=0.8871 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)V104.CB) [> 2.8733 = 4.7889 < 6.2256] w=0.8795 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)L106.CB) [> 4.2123 = 7.0205 < 9.1266] w=0.8696 to align # Constraint # added constraint: constraint((T0328)N27.CB, (T0328)D101.CB) [> 3.3928 = 5.6546 < 7.3509] w=0.8534 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)L102.CB) [> 4.1410 = 6.9017 < 8.9722] w=0.8484 to align # Constraint # added constraint: constraint((T0328)S259.CB, (T0328)M270.CB) [> 4.3450 = 7.2417 < 9.4143] w=0.8458 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)V104.CB) [> 4.2572 = 7.0954 < 9.2240] w=0.8377 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)D101.CB) [> 3.9100 = 6.5167 < 8.4717] w=0.8114 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)L102.CB) [> 4.0461 = 6.7436 < 8.7666] w=0.8041 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)L106.CB) [> 4.5737 = 7.6229 < 9.9097] w=0.7990 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)F103.CB) [> 4.1948 = 6.9914 < 9.0888] w=0.7959 to align # Constraint # added constraint: constraint((T0328)L19.CB, (T0328)R107.CB) [> 3.4210 = 5.7017 < 7.4122] w=0.7942 to align # Constraint # added constraint: constraint((T0328)H20.CB, (T0328)R107.CB) [> 3.9954 = 6.6589 < 8.6566] w=0.7942 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)L102.CB) [> 2.9423 = 4.9039 < 6.3750] w=0.7870 to align # Constraint # added constraint: constraint((T0328)L19.CB, (T0328)D109.CB) [> 3.5290 = 5.8817 < 7.6462] w=0.7861 to align # Constraint # added constraint: constraint((T0328)H20.CB, (T0328)D109.CB) [> 4.3404 = 7.2340 < 9.4042] w=0.7720 to align # Constraint # added constraint: constraint((T0328)H20.CB, (T0328)R110.CB) [> 3.7589 = 6.2649 < 8.1444] w=0.7507 to align # Constraint # added constraint: constraint((T0328)H20.CB, (T0328)L114.CB) [> 3.5549 = 5.9248 < 7.7022] w=0.7367 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)I121.CB) [> 3.9416 = 6.5693 < 8.5401] w=0.7203 to align # Constraint # added constraint: constraint((T0328)H20.CB, (T0328)C108.CB) [> 3.2311 = 5.3852 < 7.0007] w=0.7154 to align # Constraint # added constraint: constraint((T0328)L19.CB, (T0328)C108.CB) [> 3.8456 = 6.4094 < 8.3322] w=0.7154 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)L131.CB) [> 3.9549 = 6.5915 < 8.5689] w=0.6904 to align # Constraint # added constraint: constraint((T0328)N27.CB, (T0328)V132.CB) [> 2.9339 = 4.8899 < 6.3569] w=0.6822 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)Y100.CB) [> 3.9453 = 6.5754 < 8.5481] w=0.6704 to align # Constraint # added constraint: constraint((T0328)H20.CB, (T0328)Y111.CB) [> 2.6760 = 4.4600 < 5.7980] w=0.6659 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)A118.CB) [> 3.9406 = 6.5677 < 8.5380] w=0.6506 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)H105.CB) [> 4.2360 = 7.0599 < 9.1779] w=0.6493 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)F103.CB) [> 4.5312 = 7.5520 < 9.8176] w=0.6469 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)Y100.CB) [> 2.7922 = 4.6537 < 6.0498] w=0.6466 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)V104.CB) [> 4.6029 = 7.6715 < 9.9729] w=0.6276 to align # Constraint # added constraint: constraint((T0328)N27.CB, (T0328)E99.CB) [> 3.6514 = 6.0857 < 7.9114] w=0.6229 to align # Constraint # added constraint: constraint((T0328)S21.CB, (T0328)H105.CB) [> 3.7347 = 6.2245 < 8.0919] w=0.6074 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)V129.CB) [> 3.9176 = 6.5293 < 8.4881] w=0.6067 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)L102.CB) [> 4.3226 = 7.2043 < 9.3656] w=0.5999 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)D101.CB) [> 3.0106 = 5.0177 < 6.5229] w=0.5991 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)V104.CB) [> 4.4234 = 7.3724 < 9.5841] w=0.5991 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)D101.CB) [> 4.3793 = 7.2989 < 9.4885] w=0.5934 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)F257.CB) [> 3.9214 = 6.5357 < 8.4964] w=0.5824 to align # Constraint # added constraint: constraint((T0328)S21.CB, (T0328)R107.CB) [> 3.3294 = 5.5490 < 7.2137] w=0.5516 to align # Constraint # added constraint: constraint((T0328)N42.CB, (T0328)M124.CB) [> 4.0390 = 6.7316 < 8.7511] w=0.5331 to align # Constraint # added constraint: constraint((T0328)C39.CB, (T0328)M124.CB) [> 3.0839 = 5.1399 < 6.6818] w=0.5331 to align # Constraint # added constraint: constraint((T0328)Y46.CB, (T0328)E120.CB) [> 3.8523 = 6.4206 < 8.3468] w=0.5250 to align # Constraint # added constraint: constraint((T0328)C39.CB, (T0328)F125.CB) [> 3.2981 = 5.4968 < 7.1458] w=0.5214 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)A118.CB) [> 3.6543 = 6.0905 < 7.9177] w=0.5123 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)T260.CB) [> 3.1020 = 5.1700 < 6.7210] w=0.5110 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)H105.CB) [> 4.5025 = 7.5041 < 9.7554] w=0.5038 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)A118.CB) [> 3.9415 = 6.5692 < 8.5400] w=0.5029 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)C261.CB) [> 3.5975 = 5.9957 < 7.7945] w=0.5020 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)L106.CB) [> 2.6733 = 4.4554 < 5.7921] w=0.4989 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)F257.CB) [> 3.9523 = 6.5871 < 8.5632] w=0.4978 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)V132.CB) [> 3.6652 = 6.1086 < 7.9412] w=0.4953 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)E99.CB) [> 4.4938 = 7.4897 < 9.7366] w=0.4931 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)T260.CB) [> 4.7042 = 7.8404 < 10.1925] w=0.4931 to align # Constraint # added constraint: constraint((T0328)E163.CB, (T0328)R262.CB) [> 3.6144 = 6.0240 < 7.8311] w=0.4880 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)V129.CB) [> 3.8630 = 6.4384 < 8.3699] w=0.4871 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)V129.CB) [> 2.3310 = 3.8851 < 5.0506] w=0.4871 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)V132.CB) [> 2.6559 = 4.4265 < 5.7544] w=0.4871 to align # Constraint # added constraint: constraint((T0328)V228.CB, (T0328)F257.CB) [> 4.0558 = 6.7596 < 8.7875] w=0.4866 to align # Constraint # added constraint: constraint((T0328)S21.CB, (T0328)L106.CB) [> 4.0481 = 6.7469 < 8.7709] w=0.4809 to align # Constraint # added constraint: constraint((T0328)L19.CB, (T0328)F138.CB) [> 4.3370 = 7.2284 < 9.3969] w=0.4790 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)E135.CB) [> 2.7473 = 4.5789 < 5.9525] w=0.4790 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)I258.CB) [> 4.3054 = 7.1757 < 9.3284] w=0.4790 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)I121.CB) [> 4.4990 = 7.4984 < 9.7479] w=0.4790 to align # Constraint # added constraint: constraint((T0328)N29.CB, (T0328)L128.CB) [> 3.2088 = 5.3479 < 6.9523] w=0.4790 to align # Constraint # added constraint: constraint((T0328)N29.CB, (T0328)V129.CB) [> 4.2639 = 7.1066 < 9.2386] w=0.4790 to align # Constraint # added constraint: constraint((T0328)V275.CB, (T0328)M287.CB) [> 3.9083 = 6.5138 < 8.4679] w=0.4790 to align # Constraint # added constraint: constraint((T0328)W192.CB, (T0328)F289.CB) [> 2.7997 = 4.6661 < 6.0659] w=0.4790 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)I258.CB) [> 3.9533 = 6.5888 < 8.5655] w=0.4790 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)F298.CB) [> 3.3459 = 5.5764 < 7.2494] w=0.4790 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)F298.CB) [> 3.9561 = 6.5935 < 8.5716] w=0.4790 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)V132.CB) [> 2.9030 = 4.8383 < 6.2898] w=0.4790 to align # Constraint # added constraint: constraint((T0328)E99.CB, (T0328)S296.CB) [> 3.9117 = 6.5195 < 8.4753] w=0.4790 to align # Constraint # added constraint: constraint((T0328)L50.CB, (T0328)V117.CB) [> 4.1496 = 6.9160 < 8.9908] w=0.4790 to align # Constraint # added constraint: constraint((T0328)K226.CB, (T0328)S259.CB) [> 4.5204 = 7.5340 < 9.7942] w=0.4758 to align # Constraint # added constraint: constraint((T0328)L50.CB, (T0328)F59.CB) [> 3.3521 = 5.5869 < 7.2629] w=0.4724 to align # Constraint # added constraint: constraint((T0328)Y185.CB, (T0328)L255.CB) [> 3.5157 = 5.8594 < 7.6172] w=0.4709 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)F103.CB) [> 4.2044 = 7.0073 < 9.1095] w=0.4650 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)S259.CB) [> 4.1447 = 6.9079 < 8.9803] w=0.4624 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)I258.CB) [> 4.1177 = 6.8628 < 8.9216] w=0.4624 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)G137.CA) [> 4.1974 = 6.9956 < 9.0943] w=0.4612 to align # Constraint # added constraint: constraint((T0328)V43.CB, (T0328)L306.CB) [> 3.8542 = 6.4237 < 8.3508] w=0.4555 to align # Constraint # added constraint: constraint((T0328)K226.CB, (T0328)I258.CB) [> 3.1702 = 5.2837 < 6.8688] w=0.4548 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)V104.CB) [> 3.4998 = 5.8330 < 7.5829] w=0.4546 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)H105.CB) [> 3.5073 = 5.8456 < 7.5992] w=0.4514 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)V104.CB) [> 4.1904 = 6.9840 < 9.0792] w=0.4514 to align # Constraint # added constraint: constraint((T0328)Y185.CB, (T0328)F257.CB) [> 3.8103 = 6.3506 < 8.2557] w=0.4414 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)L106.CB) [> 3.1367 = 5.2278 < 6.7962] w=0.4410 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)F103.CB) [> 4.2373 = 7.0622 < 9.1809] w=0.4405 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)V104.CB) [> 4.4311 = 7.3852 < 9.6008] w=0.4405 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)L114.CB) [> 2.8940 = 4.8234 < 6.2704] w=0.4405 to align # Constraint # added constraint: constraint((T0328)N229.CB, (T0328)G254.CA) [> 4.2484 = 7.0807 < 9.2049] w=0.4374 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)M256.CB) [> 3.9649 = 6.6082 < 8.5906] w=0.4315 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)G137.CA) [> 4.2193 = 7.0321 < 9.1417] w=0.4315 to align # Constraint # added constraint: constraint((T0328)V43.CB, (T0328)F125.CB) [> 3.5149 = 5.8581 < 7.6156] w=0.4304 to align # Constraint # added constraint: constraint((T0328)K226.CB, (T0328)F257.CB) [> 4.0652 = 6.7754 < 8.8080] w=0.4279 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)H105.CB) [> 2.7506 = 4.5844 < 5.9597] w=0.4270 to align # Constraint # added constraint: constraint((T0328)N60.CB, (T0328)L106.CB) [> 4.5051 = 7.5085 < 9.7611] w=0.4270 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)L102.CB) [> 4.1941 = 6.9901 < 9.0872] w=0.4253 to align # Constraint # added constraint: constraint((T0328)F59.CB, (T0328)R107.CB) [> 4.0150 = 6.6917 < 8.6992] w=0.4253 to align # Constraint # added constraint: constraint((T0328)Q162.CB, (T0328)T260.CB) [> 2.7952 = 4.6586 < 6.0562] w=0.4214 to align # Constraint # added constraint: constraint((T0328)Q162.CB, (T0328)C261.CB) [> 3.8175 = 6.3625 < 8.2713] w=0.4214 to align # Constraint # added constraint: constraint((T0328)E163.CB, (T0328)C261.CB) [> 4.2381 = 7.0635 < 9.1826] w=0.4214 to align # Constraint # added constraint: constraint((T0328)L230.CB, (T0328)G254.CA) [> 3.0231 = 5.0385 < 6.5500] w=0.4195 to align # Constraint # added constraint: constraint((T0328)L230.CB, (T0328)Q253.CB) [> 3.2448 = 5.4079 < 7.0303] w=0.4195 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)R107.CB) [> 3.7865 = 6.3108 < 8.2041] w=0.4149 to align # Constraint # added constraint: constraint((T0328)F59.CB, (T0328)D109.CB) [> 4.5248 = 7.5414 < 9.8038] w=0.4149 to align # Constraint # added constraint: constraint((T0328)A58.CB, (T0328)D109.CB) [> 3.3316 = 5.5527 < 7.2185] w=0.4149 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)L36.CB) [> 3.3498 = 5.5830 < 7.2579] w=0.4097 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)V104.CB) [> 4.0530 = 6.7551 < 8.7816] w=0.4039 to align # Constraint # added constraint: constraint((T0328)Q35.CB, (T0328)M124.CB) [> 4.0141 = 6.6902 < 8.6972] w=0.4008 to align # Constraint # added constraint: constraint((T0328)I40.CB, (T0328)L306.CB) [> 3.4309 = 5.7182 < 7.4337] w=0.4008 to align # Constraint # added constraint: constraint((T0328)I40.CB, (T0328)M307.CB) [> 3.9993 = 6.6655 < 8.6651] w=0.4008 to align # Constraint # added constraint: constraint((T0328)A44.CB, (T0328)L303.CB) [> 3.4426 = 5.7377 < 7.4590] w=0.4008 to align # Constraint # added constraint: constraint((T0328)A44.CB, (T0328)L306.CB) [> 4.0974 = 6.8291 < 8.8778] w=0.4008 to align # Constraint # added constraint: constraint((T0328)A58.CB, (T0328)C108.CB) [> 4.0213 = 6.7022 < 8.7128] w=0.4008 to align # Constraint # added constraint: constraint((T0328)F59.CB, (T0328)C108.CB) [> 2.8053 = 4.6755 < 6.0782] w=0.4008 to align # Constraint # added constraint: constraint((T0328)F59.CB, (T0328)I113.CB) [> 3.7683 = 6.2804 < 8.1646] w=0.4008 to align # Constraint # added constraint: constraint((T0328)N60.CB, (T0328)R107.CB) [> 2.7881 = 4.6469 < 6.0409] w=0.4008 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)P301.CB) [> 4.1498 = 6.9164 < 8.9913] w=0.4008 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)A300.CB) [> 4.2497 = 7.0827 < 9.2076] w=0.4008 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)C39.CB) [> 3.3617 = 5.6029 < 7.2838] w=0.3957 to align # Constraint # added constraint: constraint((T0328)Y54.CB, (T0328)I113.CB) [> 3.5036 = 5.8393 < 7.5911] w=0.3936 to align # Constraint # added constraint: constraint((T0328)G205.CA, (T0328)Y214.CB) [> 3.1727 = 5.2878 < 6.8741] w=0.3850 to align # Constraint # added constraint: constraint((T0328)I40.CB, (T0328)V63.CB) [> 4.5378 = 7.5631 < 9.8320] w=0.3839 to align # Constraint # added constraint: constraint((T0328)I225.CB, (T0328)S259.CB) [> 3.6017 = 6.0028 < 7.8037] w=0.3816 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)M256.CB) [> 3.6772 = 6.1286 < 7.9672] w=0.3777 to align # Constraint # added constraint: constraint((T0328)D101.CB, (T0328)V129.CB) [> 4.6106 = 7.6844 < 9.9897] w=0.3776 to align # Constraint # added constraint: constraint((T0328)I225.CB, (T0328)I258.CB) [> 3.8522 = 6.4203 < 8.3464] w=0.3726 to align # Constraint # added constraint: constraint((T0328)D56.CB, (T0328)D109.CB) [> 3.7780 = 6.2966 < 8.1856] w=0.3692 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)I40.CB) [> 4.1743 = 6.9573 < 9.0444] w=0.3659 to align # Constraint # added constraint: constraint((T0328)V228.CB, (T0328)I258.CB) [> 4.1972 = 6.9953 < 9.0940] w=0.3659 to align # Constraint # added constraint: constraint((T0328)I225.CB, (T0328)F257.CB) [> 4.0058 = 6.6763 < 8.6792] w=0.3636 to align # Constraint # added constraint: constraint((T0328)S259.CB, (T0328)L271.CB) [> 3.9454 = 6.5757 < 8.5484] w=0.3633 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)V167.CB) [> 4.3425 = 7.2375 < 9.4087] w=0.3598 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)V167.CB) [> 4.0866 = 6.8110 < 8.8543] w=0.3574 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)L255.CB) [> 3.1014 = 5.1690 < 6.7196] w=0.3571 to align # Constraint # added constraint: constraint((T0328)F138.CB, (T0328)Y247.CB) [> 4.4774 = 7.4624 < 9.7011] w=0.3524 to align # Constraint # added constraint: constraint((T0328)L197.CB, (T0328)K208.CB) [> 2.9163 = 4.8605 < 6.3187] w=0.3506 to align # Constraint # added constraint: constraint((T0328)F85.CB, (T0328)H181.CB) [> 4.1350 = 6.8916 < 8.9591] w=0.3506 to align # Constraint # added constraint: constraint((T0328)K226.CB, (T0328)T260.CB) [> 4.0609 = 6.7681 < 8.7986] w=0.3441 to align # Constraint # added constraint: constraint((T0328)I225.CB, (T0328)T260.CB) [> 4.5565 = 7.5942 < 9.8725] w=0.3373 to align # Constraint # added constraint: constraint((T0328)H224.CB, (T0328)S259.CB) [> 4.3832 = 7.3054 < 9.4970] w=0.3334 to align # Constraint # added constraint: constraint((T0328)E201.CB, (T0328)Y214.CB) [> 3.8677 = 6.4462 < 8.3801] w=0.3325 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)I121.CB) [> 3.8493 = 6.4156 < 8.3402] w=0.3307 to align # Constraint # added constraint: constraint((T0328)G205.CA, (T0328)I225.CB) [> 3.7798 = 6.2996 < 8.1895] w=0.3283 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)V182.CB) [> 4.0613 = 6.7689 < 8.7995] w=0.3281 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)H181.CB) [> 3.8282 = 6.3804 < 8.2945] w=0.3273 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)I47.CB) [> 4.2269 = 7.0449 < 9.1584] w=0.3255 to align # Constraint # added constraint: constraint((T0328)W70.CB, (T0328)P79.CB) [> 4.4485 = 7.4141 < 9.6383] w=0.3239 to align # Constraint # added constraint: constraint((T0328)I47.CB, (T0328)N60.CB) [> 4.1821 = 6.9701 < 9.0611] w=0.3239 to align # Constraint # added constraint: constraint((T0328)N18.CB, (T0328)R107.CB) [> 1.9855 = 3.3091 < 4.3018] w=0.3233 to align # Constraint # added constraint: constraint((T0328)G17.CA, (T0328)R107.CB) [> 3.4220 = 5.7034 < 7.4144] w=0.3233 to align # Constraint # added constraint: constraint((T0328)G137.CA, (T0328)Y247.CB) [> 2.9079 = 4.8466 < 6.3005] w=0.3227 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)M256.CB) [> 4.1158 = 6.8597 < 8.9175] w=0.3218 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)A165.CB) [> 4.3222 = 7.2036 < 9.3647] w=0.3180 to align # Constraint # added constraint: constraint((T0328)I47.CB, (T0328)G61.CA) [> 3.8498 = 6.4163 < 8.3412] w=0.3161 to align # Constraint # added constraint: constraint((T0328)S21.CB, (T0328)L114.CB) [> 4.2863 = 7.1439 < 9.2871] w=0.3153 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)T260.CB) [> 2.8096 = 4.6827 < 6.0876] w=0.3153 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)M88.CB) [> 3.9918 = 6.6529 < 8.6488] w=0.3128 to align # Constraint # added constraint: constraint((T0328)V228.CB, (T0328)M256.CB) [> 3.8647 = 6.4412 < 8.3735] w=0.3126 to align # Constraint # added constraint: constraint((T0328)E154.CB, (T0328)I225.CB) [> 3.9797 = 6.6328 < 8.6226] w=0.3116 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)S178.CB) [> 3.7330 = 6.2216 < 8.0881] w=0.3112 to align # Constraint # added constraint: constraint((T0328)D202.CB, (T0328)Y214.CB) [> 4.4054 = 7.3423 < 9.5449] w=0.3069 to align # Constraint # added constraint: constraint((T0328)S57.CB, (T0328)I113.CB) [> 3.5024 = 5.8374 < 7.5886] w=0.3069 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)V43.CB) [> 3.2948 = 5.4913 < 7.1387] w=0.3064 to align # Constraint # added constraint: constraint((T0328)L146.CB, (T0328)L255.CB) [> 3.5108 = 5.8513 < 7.6067] w=0.3040 to align # Constraint # added constraint: constraint((T0328)D145.CB, (T0328)L255.CB) [> 3.4560 = 5.7601 < 7.4881] w=0.3040 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)L114.CB) [> 4.3593 = 7.2654 < 9.4451] w=0.3010 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)H105.CB) [> 4.2698 = 7.1163 < 9.2512] w=0.2983 to align # Constraint # added constraint: constraint((T0328)F138.CB, (T0328)L230.CB) [> 4.2241 = 7.0401 < 9.1522] w=0.2968 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)L241.CB) [> 3.6693 = 6.1156 < 7.9502] w=0.2965 to align # Constraint # added constraint: constraint((T0328)H224.CB, (T0328)T260.CB) [> 3.1344 = 5.2240 < 6.7912] w=0.2945 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)F257.CB) [> 3.9096 = 6.5160 < 8.4708] w=0.2938 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)F62.CB) [> 3.6612 = 6.1020 < 7.9326] w=0.2923 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)F62.CB) [> 3.5309 = 5.8848 < 7.6502] w=0.2923 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)G61.CA) [> 4.0910 = 6.8184 < 8.8639] w=0.2923 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)N60.CB) [> 3.6660 = 6.1099 < 7.9429] w=0.2923 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)G61.CA) [> 4.5869 = 7.6449 < 9.9383] w=0.2923 to align # Constraint # added constraint: constraint((T0328)R107.CB, (T0328)G254.CA) [> 3.7476 = 6.2460 < 8.1197] w=0.2920 to align # Constraint # added constraint: constraint((T0328)E94.CB, (T0328)F103.CB) [> 4.4326 = 7.3876 < 9.6039] w=0.2903 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)I258.CB) [> 3.2046 = 5.3409 < 6.9432] w=0.2896 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)Y100.CB) [> 3.2063 = 5.3439 < 6.9470] w=0.2855 to align # Constraint # added constraint: constraint((T0328)W70.CB, (T0328)L82.CB) [> 3.7281 = 6.2134 < 8.0775] w=0.2842 to align # Constraint # added constraint: constraint((T0328)Y69.CB, (T0328)L102.CB) [> 4.1041 = 6.8401 < 8.8922] w=0.2842 to align # Constraint # added constraint: constraint((T0328)A67.CB, (T0328)K83.CB) [> 3.2537 = 5.4228 < 7.0497] w=0.2842 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)F103.CB) [> 2.6230 = 4.3717 < 5.6833] w=0.2842 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)G177.CA) [> 2.8474 = 4.7457 < 6.1695] w=0.2839 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)S259.CB) [> 3.9991 = 6.6651 < 8.6646] w=0.2824 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)C261.CB) [> 2.7716 = 4.6193 < 6.0051] w=0.2824 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)F257.CB) [> 3.3549 = 5.5915 < 7.2689] w=0.2824 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)L255.CB) [> 3.3526 = 5.5877 < 7.2641] w=0.2824 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)M256.CB) [> 3.5126 = 5.8543 < 7.6106] w=0.2824 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)F257.CB) [> 4.6185 = 7.6975 < 10.0067] w=0.2824 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)L255.CB) [> 4.0127 = 6.6878 < 8.6942] w=0.2824 to align # Constraint # added constraint: constraint((T0328)V275.CB, (T0328)L286.CB) [> 3.2243 = 5.3739 < 6.9861] w=0.2822 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)T260.CB) [> 3.9460 = 6.5766 < 8.5496] w=0.2799 to align # Constraint # added constraint: constraint((T0328)N18.CB, (T0328)L114.CB) [> 4.6637 = 7.7728 < 10.1047] w=0.2799 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)L82.CB) [> 4.4361 = 7.3935 < 9.6116] w=0.2788 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)Y74.CB) [> 4.2897 = 7.1494 < 9.2943] w=0.2788 to align # Constraint # added constraint: constraint((T0328)C39.CB, (T0328)I121.CB) [> 3.9309 = 6.5515 < 8.5170] w=0.2780 to align # Constraint # added constraint: constraint((T0328)L36.CB, (T0328)L102.CB) [> 4.2346 = 7.0576 < 9.1749] w=0.2766 to align # Constraint # added constraint: constraint((T0328)L82.CB, (T0328)I113.CB) [> 4.0282 = 6.7137 < 8.7278] w=0.2761 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)F257.CB) [> 4.6427 = 7.7379 < 10.0593] w=0.2755 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)F103.CB) [> 4.4189 = 7.3648 < 9.5742] w=0.2743 to align # Constraint # added constraint: constraint((T0328)S273.CB, (T0328)D284.CB) [> 4.2758 = 7.1264 < 9.2643] w=0.2743 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)A165.CB) [> 4.2279 = 7.0465 < 9.1605] w=0.2739 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)V117.CB) [> 4.2802 = 7.1337 < 9.2738] w=0.2719 to align # Constraint # added constraint: constraint((T0328)Y185.CB, (T0328)T290.CB) [> 2.8013 = 4.6689 < 6.0696] w=0.2719 to align # Constraint # added constraint: constraint((T0328)H187.CB, (T0328)F289.CB) [> 3.5870 = 5.9784 < 7.7719] w=0.2719 to align # Constraint # added constraint: constraint((T0328)N188.CB, (T0328)F289.CB) [> 3.2193 = 5.3655 < 6.9751] w=0.2719 to align # Constraint # added constraint: constraint((T0328)N188.CB, (T0328)T290.CB) [> 4.2991 = 7.1652 < 9.3148] w=0.2719 to align # Constraint # added constraint: constraint((T0328)N188.CB, (T0328)S291.CB) [> 4.5932 = 7.6552 < 9.9518] w=0.2719 to align # Constraint # added constraint: constraint((T0328)Q35.CB, (T0328)L128.CB) [> 2.4531 = 4.0884 < 5.3150] w=0.2690 to align # Constraint # added constraint: constraint((T0328)L36.CB, (T0328)F125.CB) [> 4.1866 = 6.9776 < 9.0709] w=0.2690 to align # Constraint # added constraint: constraint((T0328)Y54.CB, (T0328)C108.CB) [> 4.4400 = 7.4000 < 9.6200] w=0.2690 to align # Constraint # added constraint: constraint((T0328)A58.CB, (T0328)R107.CB) [> 4.1398 = 6.8997 < 8.9696] w=0.2690 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)L102.CB) [> 4.3426 = 7.2377 < 9.4090] w=0.2690 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)C261.CB) [> 3.7574 = 6.2624 < 8.1411] w=0.2676 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)T260.CB) [> 4.2284 = 7.0474 < 9.1616] w=0.2665 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)M256.CB) [> 4.1215 = 6.8691 < 8.9299] w=0.2634 to align # Constraint # added constraint: constraint((T0328)A97.CB, (T0328)M124.CB) [> 3.9417 = 6.5695 < 8.5404] w=0.2628 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)S259.CB) [> 4.4398 = 7.3997 < 9.6197] w=0.2626 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)I258.CB) [> 4.0972 = 6.8286 < 8.8772] w=0.2626 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)I258.CB) [> 4.2122 = 7.0203 < 9.1263] w=0.2623 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)Y179.CB) [> 4.4340 = 7.3899 < 9.6069] w=0.2619 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)S178.CB) [> 3.2378 = 5.3962 < 7.0151] w=0.2619 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)F267.CB) [> 2.7494 = 4.5824 < 5.9571] w=0.2618 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)P264.CB) [> 4.5582 = 7.5971 < 9.8762] w=0.2618 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)F267.CB) [> 4.1829 = 6.9716 < 9.0630] w=0.2614 to align # Constraint # added constraint: constraint((T0328)E163.CB, (T0328)P264.CB) [> 4.3069 = 7.1781 < 9.3316] w=0.2614 to align # Constraint # added constraint: constraint((T0328)Y46.CB, (T0328)V117.CB) [> 3.8258 = 6.3763 < 8.2891] w=0.2608 to align # Constraint # added constraint: constraint((T0328)L241.CB, (T0328)T260.CB) [> 2.8451 = 4.7417 < 6.1643] w=0.2586 to align # Constraint # added constraint: constraint((T0328)C261.CB, (T0328)L271.CB) [> 4.4665 = 7.4441 < 9.6773] w=0.2585 to align # Constraint # added constraint: constraint((T0328)S21.CB, (T0328)C108.CB) [> 4.4597 = 7.4328 < 9.6626] w=0.2577 to align # Constraint # added constraint: constraint((T0328)R93.CB, (T0328)R107.CB) [> 2.9551 = 4.9251 < 6.4027] w=0.2555 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)S178.CB) [> 3.3235 = 5.5391 < 7.2009] w=0.2544 to align # Constraint # added constraint: constraint((T0328)M245.CB, (T0328)M256.CB) [> 2.8314 = 4.7190 < 6.1347] w=0.2532 to align # Constraint # added constraint: constraint((T0328)M245.CB, (T0328)L255.CB) [> 4.1587 = 6.9311 < 9.0104] w=0.2532 to align # Constraint # added constraint: constraint((T0328)I240.CB, (T0328)S259.CB) [> 2.7734 = 4.6223 < 6.0090] w=0.2532 to align # Constraint # added constraint: constraint((T0328)S143.CB, (T0328)G152.CA) [> 4.1922 = 6.9869 < 9.0830] w=0.2532 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)L131.CB) [> 4.1758 = 6.9596 < 9.0475] w=0.2527 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)L131.CB) [> 4.5734 = 7.6223 < 9.9090] w=0.2527 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)G254.CA) [> 3.4430 = 5.7383 < 7.4598] w=0.2526 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)I40.CB) [> 4.0086 = 6.6810 < 8.6854] w=0.2526 to align # Constraint # added constraint: constraint((T0328)M274.CB, (T0328)L286.CB) [> 2.9084 = 4.8473 < 6.3015] w=0.2524 to align # Constraint # added constraint: constraint((T0328)I40.CB, (T0328)F125.CB) [> 4.0989 = 6.8316 < 8.8811] w=0.2524 to align # Constraint # added constraint: constraint((T0328)N29.CB, (T0328)Y100.CB) [> 4.1809 = 6.9682 < 9.0587] w=0.2521 to align # Constraint # added constraint: constraint((T0328)L230.CB, (T0328)L255.CB) [> 3.5407 = 5.9012 < 7.6716] w=0.2500 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)L255.CB) [> 4.0953 = 6.8256 < 8.8733] w=0.2498 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)S259.CB) [> 2.4525 = 4.0875 < 5.3137] w=0.2485 to align # Constraint # added constraint: constraint((T0328)A67.CB, (T0328)S297.CB) [> 3.8175 = 6.3626 < 8.2713] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A67.CB, (T0328)F299.CB) [> 4.5373 = 7.5622 < 9.8308] w=0.2445 to align # Constraint # added constraint: constraint((T0328)N68.CB, (T0328)D101.CB) [> 4.3133 = 7.1889 < 9.3456] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y69.CB, (T0328)D101.CB) [> 2.1666 = 3.6111 < 4.6944] w=0.2445 to align # Constraint # added constraint: constraint((T0328)W70.CB, (T0328)F299.CB) [> 3.6525 = 6.0874 < 7.9137] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L73.CB, (T0328)F309.CB) [> 4.5285 = 7.5475 < 9.8118] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y74.CB, (T0328)F309.CB) [> 3.6841 = 6.1402 < 7.9823] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P79.CB, (T0328)D171.CB) [> 3.7707 = 6.2845 < 8.1699] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P79.CB, (T0328)F174.CB) [> 2.7873 = 4.6454 < 6.0391] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M81.CB, (T0328)Y179.CB) [> 3.6055 = 6.0091 < 7.8119] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)L306.CB) [> 4.1470 = 6.9116 < 8.9851] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)S178.CB) [> 4.7343 = 7.8904 < 10.2575] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)I180.CB) [> 3.0261 = 5.0436 < 6.5566] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)F298.CB) [> 1.8064 = 3.0106 < 3.9138] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)F299.CB) [> 3.4933 = 5.8222 < 7.5689] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)A300.CB) [> 2.5656 = 4.2760 < 5.5588] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)D101.CB) [> 4.2671 = 7.1118 < 9.2453] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)L102.CB) [> 3.9446 = 6.5743 < 8.5466] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)F103.CB) [> 4.6642 = 7.7737 < 10.1059] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)F298.CB) [> 3.4627 = 5.7712 < 7.5025] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)F299.CB) [> 3.0590 = 5.0984 < 6.6279] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)A300.CB) [> 4.7559 = 7.9266 < 10.3046] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)P301.CB) [> 4.4176 = 7.3626 < 9.5714] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)D101.CB) [> 3.3629 = 5.6049 < 7.2863] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)L102.CB) [> 4.4652 = 7.4420 < 9.6746] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)S296.CB) [> 4.2142 = 7.0236 < 9.1307] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)S297.CB) [> 3.9162 = 6.5271 < 8.4852] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)F298.CB) [> 2.9362 = 4.8937 < 6.3618] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G66.CA, (T0328)F299.CB) [> 3.9008 = 6.5013 < 8.4517] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A67.CB, (T0328)L82.CB) [> 3.0183 = 5.0305 < 6.5396] w=0.2445 to align # Constraint # added constraint: constraint((T0328)R93.CB, (T0328)M287.CB) [> 3.0114 = 5.0190 < 6.5247] w=0.2445 to align # Constraint # added constraint: constraint((T0328)R93.CB, (T0328)A292.CB) [> 4.5807 = 7.6345 < 9.9249] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A95.CB, (T0328)Q183.CB) [> 4.3495 = 7.2491 < 9.4238] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A95.CB, (T0328)L271.CB) [> 3.1656 = 5.2760 < 6.8588] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A95.CB, (T0328)V275.CB) [> 2.8394 = 4.7324 < 6.1521] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A95.CB, (T0328)A292.CB) [> 3.2393 = 5.3988 < 7.0185] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P96.CB, (T0328)A292.CB) [> 3.2909 = 5.4849 < 7.1303] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P96.CB, (T0328)L293.CB) [> 4.1119 = 6.8532 < 8.9091] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P96.CB, (T0328)T294.CB) [> 3.9514 = 6.5857 < 8.5614] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A97.CB, (T0328)S296.CB) [> 4.0763 = 6.7937 < 8.8319] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I98.CB, (T0328)L293.CB) [> 4.7856 = 7.9760 < 10.3688] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L82.CB, (T0328)S297.CB) [> 4.2613 = 7.1022 < 9.2328] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F85.CB, (T0328)A97.CB) [> 2.6805 = 4.4674 < 5.8077] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F85.CB, (T0328)G295.CA) [> 3.6993 = 6.1654 < 8.0151] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F85.CB, (T0328)S296.CB) [> 3.6020 = 6.0034 < 7.8044] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P86.CB, (T0328)A97.CB) [> 3.8236 = 6.3726 < 8.2844] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)E268.CB) [> 4.7338 = 7.8897 < 10.2566] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)L271.CB) [> 3.2287 = 5.3812 < 6.9955] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)H272.CB) [> 3.8309 = 6.3849 < 8.3004] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)V275.CB) [> 2.8048 = 4.6746 < 6.0770] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)F276.CB) [> 4.0965 = 6.8275 < 8.8757] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)A165.CB) [> 2.6461 = 4.4102 < 5.7333] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)L166.CB) [> 3.6085 = 6.0142 < 7.8184] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)G177.CA) [> 4.4004 = 7.3340 < 9.5342] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)S178.CB) [> 2.4769 = 4.1281 < 5.3666] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)I180.CB) [> 4.3109 = 7.1848 < 9.3403] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)L241.CB) [> 4.1057 = 6.8428 < 8.8956] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)A300.CB) [> 3.5594 = 5.9323 < 7.7120] w=0.2445 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)Q162.CB) [> 2.9740 = 4.9567 < 6.4437] w=0.2445 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)V164.CB) [> 4.6369 = 7.7281 < 10.0465] w=0.2445 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)A165.CB) [> 2.7741 = 4.6235 < 6.0105] w=0.2445 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)L166.CB) [> 4.3800 = 7.2999 < 9.4899] w=0.2445 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)L241.CB) [> 3.2624 = 5.4373 < 7.0685] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A15.CB, (T0328)N60.CB) [> 3.1594 = 5.2657 < 6.8454] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A15.CB, (T0328)R107.CB) [> 4.0155 = 6.6924 < 8.7002] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G17.CA, (T0328)R139.CB) [> 4.2168 = 7.0281 < 9.1365] w=0.2445 to align # Constraint # added constraint: constraint((T0328)E9.CB, (T0328)S302.CB) [> 3.7384 = 6.2306 < 8.0998] w=0.2445 to align # Constraint # added constraint: constraint((T0328)E9.CB, (T0328)L303.CB) [> 2.9898 = 4.9830 < 6.4780] w=0.2445 to align # Constraint # added constraint: constraint((T0328)E9.CB, (T0328)D304.CB) [> 4.0002 = 6.6670 < 8.6672] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q10.CB, (T0328)Q162.CB) [> 3.9477 = 6.5795 < 8.5534] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q10.CB, (T0328)A165.CB) [> 4.4506 = 7.4177 < 9.6431] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q10.CB, (T0328)L166.CB) [> 2.7297 = 4.5496 < 5.9145] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q10.CB, (T0328)G177.CA) [> 3.4451 = 5.7418 < 7.4643] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q10.CB, (T0328)S178.CB) [> 3.9008 = 6.5013 < 8.4517] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q10.CB, (T0328)S302.CB) [> 3.4303 = 5.7172 < 7.4324] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q10.CB, (T0328)L303.CB) [> 4.4677 = 7.4462 < 9.6800] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)F62.CB) [> 2.8772 = 4.7954 < 6.2340] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)V63.CB) [> 4.3547 = 7.2579 < 9.4352] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)S178.CB) [> 3.8610 = 6.4351 < 8.3656] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)P301.CB) [> 4.4715 = 7.4525 < 9.6883] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)S302.CB) [> 4.2408 = 7.0680 < 9.1884] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)L303.CB) [> 4.0266 = 6.7110 < 8.7243] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)L306.CB) [> 4.7189 = 7.8648 < 10.2243] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)Q162.CB) [> 4.6528 = 7.7547 < 10.0811] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q35.CB, (T0328)F125.CB) [> 3.2338 = 5.3897 < 7.0066] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L36.CB, (T0328)L73.CB) [> 3.5954 = 5.9924 < 7.7901] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L36.CB, (T0328)L128.CB) [> 3.6184 = 6.0306 < 7.8398] w=0.2445 to align # Constraint # added constraint: constraint((T0328)R37.CB, (T0328)L73.CB) [> 4.6068 = 7.6780 < 9.9814] w=0.2445 to align # Constraint # added constraint: constraint((T0328)R37.CB, (T0328)F309.CB) [> 3.9110 = 6.5183 < 8.4738] w=0.2445 to align # Constraint # added constraint: constraint((T0328)C39.CB, (T0328)V63.CB) [> 4.4019 = 7.3364 < 9.5374] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A41.CB, (T0328)F309.CB) [> 4.7736 = 7.9559 < 10.3427] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V43.CB, (T0328)L303.CB) [> 4.7168 = 7.8613 < 10.2197] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L50.CB, (T0328)C108.CB) [> 4.5485 = 7.5809 < 9.8552] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L50.CB, (T0328)L116.CB) [> 4.4177 = 7.3629 < 9.5717] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F59.CB, (T0328)V117.CB) [> 4.4930 = 7.4883 < 9.7347] w=0.2445 to align # Constraint # added constraint: constraint((T0328)N60.CB, (T0328)C108.CB) [> 4.2939 = 7.1565 < 9.3035] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)I180.CB) [> 4.2635 = 7.1058 < 9.2375] w=0.2445 to align # Constraint # added constraint: constraint((T0328)S21.CB, (T0328)M245.CB) [> 3.2309 = 5.3848 < 7.0002] w=0.2445 to align # Constraint # added constraint: constraint((T0328)S21.CB, (T0328)M256.CB) [> 4.7563 = 7.9272 < 10.3054] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)H115.CB) [> 4.5268 = 7.5446 < 9.8080] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)E135.CB) [> 4.4905 = 7.4842 < 9.7295] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)V182.CB) [> 4.0415 = 6.7358 < 8.7565] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)V182.CB) [> 4.3589 = 7.2649 < 9.4443] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)T294.CB) [> 4.7065 = 7.8442 < 10.1975] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)S296.CB) [> 4.1915 = 6.9858 < 9.0815] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)Y69.CB) [> 3.5545 = 5.9241 < 7.7014] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)S72.CB) [> 4.2187 = 7.0312 < 9.1406] w=0.2445 to align # Constraint # added constraint: constraint((T0328)N31.CB, (T0328)D127.CB) [> 2.9714 = 4.9523 < 6.4380] w=0.2445 to align # Constraint # added constraint: constraint((T0328)E33.CB, (T0328)L73.CB) [> 3.5020 = 5.8367 < 7.5877] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)M256.CB) [> 4.1864 = 6.9774 < 9.0706] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)I258.CB) [> 2.9839 = 4.9732 < 6.4651] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)T294.CB) [> 4.0325 = 6.7208 < 8.7370] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)G295.CA) [> 3.7483 = 6.2471 < 8.1213] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)S296.CB) [> 3.6459 = 6.0766 < 7.8995] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)F298.CB) [> 4.4777 = 7.4628 < 9.7016] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q183.CB, (T0328)M256.CB) [> 4.5305 = 7.5508 < 9.8160] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q183.CB, (T0328)F257.CB) [> 2.5315 = 4.2192 < 5.4850] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q183.CB, (T0328)A292.CB) [> 3.0259 = 5.0431 < 6.5560] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q183.CB, (T0328)L293.CB) [> 4.7029 = 7.8382 < 10.1897] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q183.CB, (T0328)T294.CB) [> 3.4869 = 5.8114 < 7.5549] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Q183.CB, (T0328)G295.CA) [> 2.9088 = 4.8479 < 6.3023] w=0.2445 to align # Constraint # added constraint: constraint((T0328)K184.CB, (T0328)Y247.CB) [> 4.7254 = 7.8757 < 10.2384] w=0.2445 to align # Constraint # added constraint: constraint((T0328)K184.CB, (T0328)L255.CB) [> 4.6176 = 7.6960 < 10.0048] w=0.2445 to align # Constraint # added constraint: constraint((T0328)K184.CB, (T0328)A292.CB) [> 4.3143 = 7.1906 < 9.3477] w=0.2445 to align # Constraint # added constraint: constraint((T0328)K184.CB, (T0328)L293.CB) [> 2.9312 = 4.8854 < 6.3510] w=0.2445 to align # Constraint # added constraint: constraint((T0328)K184.CB, (T0328)T294.CB) [> 2.6865 = 4.4776 < 5.8208] w=0.2445 to align # Constraint # added constraint: constraint((T0328)K184.CB, (T0328)G295.CA) [> 4.5919 = 7.6532 < 9.9492] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)F267.CB) [> 4.1105 = 6.8508 < 8.9061] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)S297.CB) [> 3.9658 = 6.6097 < 8.5927] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)F298.CB) [> 4.6002 = 7.6670 < 9.9671] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)F299.CB) [> 3.8451 = 6.4085 < 8.3311] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)A300.CB) [> 4.4483 = 7.4139 < 9.6380] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)I258.CB) [> 3.8303 = 6.3839 < 8.2991] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)S259.CB) [> 4.2124 = 7.0207 < 9.1269] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)T260.CB) [> 3.1447 = 5.2412 < 6.8136] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)C261.CB) [> 4.7133 = 7.8555 < 10.2121] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)S297.CB) [> 4.4623 = 7.4372 < 9.6684] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)F298.CB) [> 2.9318 = 4.8863 < 6.3522] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)F299.CB) [> 4.6159 = 7.6931 < 10.0011] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)A300.CB) [> 3.1824 = 5.3040 < 6.8952] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)F257.CB) [> 4.5551 = 7.5919 < 9.8695] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)I258.CB) [> 4.3644 = 7.2740 < 9.4562] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)S259.CB) [> 3.1051 = 5.1752 < 6.7278] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)C261.CB) [> 4.5420 = 7.5701 < 9.8411] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)P264.CB) [> 4.3235 = 7.2059 < 9.3677] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)G295.CA) [> 4.2737 = 7.1228 < 9.2596] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)S296.CB) [> 4.4579 = 7.4298 < 9.6588] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)S297.CB) [> 3.2986 = 5.4977 < 7.1470] w=0.2445 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)F298.CB) [> 4.6360 = 7.7267 < 10.0447] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I203.CB, (T0328)F289.CB) [> 4.3837 = 7.3062 < 9.4980] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I204.CB, (T0328)L286.CB) [> 4.1263 = 6.8772 < 8.9403] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G205.CA, (T0328)P220.CB) [> 4.4336 = 7.3894 < 9.6062] w=0.2445 to align # Constraint # added constraint: constraint((T0328)E239.CB, (T0328)C261.CB) [> 4.7483 = 7.9138 < 10.2879] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I240.CB, (T0328)T260.CB) [> 3.7406 = 6.2343 < 8.1046] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I240.CB, (T0328)C261.CB) [> 2.3656 = 3.9426 < 5.1254] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I240.CB, (T0328)H266.CB) [> 3.3731 = 5.6219 < 7.3084] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I240.CB, (T0328)F267.CB) [> 3.3665 = 5.6108 < 7.2941] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I240.CB, (T0328)M270.CB) [> 4.3390 = 7.2316 < 9.4011] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L241.CB, (T0328)S259.CB) [> 4.1260 = 6.8767 < 8.9397] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L241.CB, (T0328)C261.CB) [> 4.4144 = 7.3574 < 9.5646] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P246.CB, (T0328)L255.CB) [> 3.9941 = 6.6569 < 8.6539] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G254.CA, (T0328)T290.CB) [> 4.6725 = 7.7875 < 10.1237] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L255.CB, (T0328)T290.CB) [> 4.0274 = 6.7123 < 8.7260] w=0.2445 to align # Constraint # added constraint: constraint((T0328)M274.CB, (T0328)M287.CB) [> 3.7200 = 6.2000 < 8.0601] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y185.CB, (T0328)M256.CB) [> 4.4985 = 7.4976 < 9.7469] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y185.CB, (T0328)S291.CB) [> 3.8510 = 6.4183 < 8.3438] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y185.CB, (T0328)A292.CB) [> 3.4322 = 5.7203 < 7.4364] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y185.CB, (T0328)L293.CB) [> 4.2404 = 7.0674 < 9.1876] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A186.CB, (T0328)E252.CB) [> 4.2553 = 7.0922 < 9.2198] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A186.CB, (T0328)T290.CB) [> 4.2060 = 7.0100 < 9.1130] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A186.CB, (T0328)L293.CB) [> 3.3745 = 5.6242 < 7.3115] w=0.2445 to align # Constraint # added constraint: constraint((T0328)K191.CB, (T0328)F289.CB) [> 3.5311 = 5.8852 < 7.6508] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I203.CB, (T0328)P220.CB) [> 4.7896 = 7.9827 < 10.3776] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I203.CB, (T0328)H285.CB) [> 2.5980 = 4.3300 < 5.6290] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I203.CB, (T0328)L286.CB) [> 3.2726 = 5.4543 < 7.0906] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I203.CB, (T0328)H288.CB) [> 4.3575 = 7.2625 < 9.4413] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F140.CB, (T0328)P246.CB) [> 2.7535 = 4.5891 < 5.9659] w=0.2445 to align # Constraint # added constraint: constraint((T0328)R144.CB, (T0328)P246.CB) [> 4.6041 = 7.6735 < 9.9756] w=0.2445 to align # Constraint # added constraint: constraint((T0328)D145.CB, (T0328)P246.CB) [> 3.7598 = 6.2664 < 8.1463] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L146.CB, (T0328)P246.CB) [> 2.4260 = 4.0433 < 5.2563] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L146.CB, (T0328)Y247.CB) [> 4.4889 = 7.4815 < 9.7260] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L146.CB, (T0328)Q253.CB) [> 3.2539 = 5.4232 < 7.0502] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L146.CB, (T0328)G254.CA) [> 3.2717 = 5.4528 < 7.0886] w=0.2445 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)W192.CB) [> 3.5385 = 5.8975 < 7.6668] w=0.2445 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)Q200.CB) [> 4.5272 = 7.5454 < 9.8090] w=0.2445 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)I204.CB) [> 4.5829 = 7.6382 < 9.9296] w=0.2445 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)L255.CB) [> 4.5986 = 7.6643 < 9.9636] w=0.2445 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)L286.CB) [> 4.6747 = 7.7912 < 10.1286] w=0.2445 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)F289.CB) [> 4.3797 = 7.2995 < 9.4894] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G148.CA, (T0328)K208.CB) [> 4.2009 = 7.0016 < 9.1020] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)Q200.CB) [> 4.4425 = 7.4042 < 9.6254] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)I204.CB) [> 3.0402 = 5.0670 < 6.5871] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)R206.CB) [> 3.8666 = 6.4444 < 8.3777] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)N211.CB) [> 4.4274 = 7.3791 < 9.5928] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V150.CB, (T0328)R206.CB) [> 4.3876 = 7.3127 < 9.5065] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I98.CB, (T0328)T294.CB) [> 2.6864 = 4.4774 < 5.8206] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I98.CB, (T0328)G295.CA) [> 3.0064 = 5.0106 < 6.5138] w=0.2445 to align # Constraint # added constraint: constraint((T0328)I98.CB, (T0328)S296.CB) [> 3.3631 = 5.6051 < 7.2866] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)V182.CB) [> 4.6244 = 7.7074 < 10.0196] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)T294.CB) [> 4.6645 = 7.7742 < 10.1065] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)G295.CA) [> 4.7594 = 7.9323 < 10.3120] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)S296.CB) [> 2.4504 = 4.0839 < 5.3091] w=0.2445 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)F298.CB) [> 4.6758 = 7.7930 < 10.1310] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)S296.CB) [> 4.6969 = 7.8281 < 10.1766] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F138.CB, (T0328)M245.CB) [> 4.4826 = 7.4710 < 9.7123] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F174.CB, (T0328)F299.CB) [> 4.6042 = 7.6737 < 9.9759] w=0.2445 to align # Constraint # added constraint: constraint((T0328)F174.CB, (T0328)S302.CB) [> 4.5364 = 7.5607 < 9.8290] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G176.CA, (T0328)S302.CB) [> 2.3924 = 3.9873 < 5.1835] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G176.CA, (T0328)F305.CB) [> 4.6841 = 7.8068 < 10.1488] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G177.CA, (T0328)P301.CB) [> 3.4018 = 5.6696 < 7.3705] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G177.CA, (T0328)S302.CB) [> 2.9058 = 4.8430 < 6.2959] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G177.CA, (T0328)F305.CB) [> 4.3120 = 7.1867 < 9.3427] w=0.2445 to align # Constraint # added constraint: constraint((T0328)S178.CB, (T0328)C261.CB) [> 4.1295 = 6.8825 < 8.9473] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)T260.CB) [> 4.3489 = 7.2482 < 9.4226] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)C261.CB) [> 3.0347 = 5.0578 < 6.5751] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)R262.CB) [> 4.4671 = 7.4451 < 9.6786] w=0.2445 to align # Constraint # added constraint: constraint((T0328)Y179.CB, (T0328)P264.CB) [> 2.3999 = 3.9998 < 5.1998] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V150.CB, (T0328)N211.CB) [> 2.4897 = 4.1494 < 5.3943] w=0.2445 to align # Constraint # added constraint: constraint((T0328)D151.CB, (T0328)S244.CB) [> 2.9312 = 4.8854 < 6.3510] w=0.2445 to align # Constraint # added constraint: constraint((T0328)G152.CA, (T0328)S244.CB) [> 4.5306 = 7.5509 < 9.8162] w=0.2445 to align # Constraint # added constraint: constraint((T0328)T153.CB, (T0328)R206.CB) [> 4.4905 = 7.4842 < 9.7295] w=0.2445 to align # Constraint # added constraint: constraint((T0328)N155.CB, (T0328)L241.CB) [> 3.1951 = 5.3252 < 6.9228] w=0.2445 to align # Constraint # added constraint: constraint((T0328)P156.CB, (T0328)E239.CB) [> 2.9986 = 4.9977 < 6.4970] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)I240.CB) [> 3.7397 = 6.2329 < 8.1027] w=0.2445 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)I240.CB) [> 4.1585 = 6.9307 < 9.0100] w=0.2445 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)T263.CB) [> 4.5595 = 7.5992 < 9.8790] w=0.2445 to align # Constraint # added constraint: constraint((T0328)E170.CB, (T0328)T263.CB) [> 4.6561 = 7.7602 < 10.0882] w=0.2445 to align # Constraint # added constraint: constraint((T0328)E163.CB, (T0328)T263.CB) [> 4.4246 = 7.3743 < 9.5866] w=0.2434 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)T263.CB) [> 4.1685 = 6.9474 < 9.0317] w=0.2434 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)M88.CB) [> 3.5263 = 5.8771 < 7.6403] w=0.2422 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)H105.CB) [> 4.3797 = 7.2995 < 9.4894] w=0.2362 to align # Constraint # added constraint: constraint((T0328)G137.CA, (T0328)V228.CB) [> 2.7080 = 4.5133 < 5.8673] w=0.2345 to align # Constraint # added constraint: constraint((T0328)V43.CB, (T0328)E126.CB) [> 4.7797 = 7.9661 < 10.3560] w=0.2345 to align # Constraint # added constraint: constraint((T0328)N42.CB, (T0328)F125.CB) [> 3.9531 = 6.5885 < 8.5651] w=0.2345 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)F298.CB) [> 4.0412 = 6.7354 < 8.7560] w=0.2345 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)V167.CB) [> 3.5608 = 5.9346 < 7.7150] w=0.2345 to align # Constraint # added constraint: constraint((T0328)K231.CB, (T0328)G254.CA) [> 2.8792 = 4.7987 < 6.2383] w=0.2345 to align # Constraint # added constraint: constraint((T0328)I204.CB, (T0328)H283.CB) [> 3.3580 = 5.5967 < 7.2757] w=0.2345 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)F298.CB) [> 2.7965 = 4.6609 < 6.0591] w=0.2345 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)S297.CB) [> 4.4241 = 7.3736 < 9.5857] w=0.2345 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)F298.CB) [> 4.1933 = 6.9889 < 9.0855] w=0.2345 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)S297.CB) [> 4.0349 = 6.7248 < 8.7422] w=0.2345 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)L271.CB) [> 4.7741 = 7.9569 < 10.3440] w=0.2345 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)C261.CB) [> 4.6161 = 7.6936 < 10.0016] w=0.2345 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)F298.CB) [> 4.7612 = 7.9353 < 10.3159] w=0.2345 to align # Constraint # added constraint: constraint((T0328)Q162.CB, (T0328)R262.CB) [> 3.1142 = 5.1903 < 6.7474] w=0.2345 to align # Constraint # added constraint: constraint((T0328)F138.CB, (T0328)V228.CB) [> 3.6052 = 6.0086 < 7.8112] w=0.2345 to align # Constraint # added constraint: constraint((T0328)V228.CB, (T0328)L255.CB) [> 3.4183 = 5.6972 < 7.4063] w=0.2293 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)M256.CB) [> 3.9274 = 6.5457 < 8.5094] w=0.2280 to align # Constraint # added constraint: constraint((T0328)I47.CB, (T0328)V63.CB) [> 4.3685 = 7.2808 < 9.4650] w=0.2279 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)V164.CB) [> 4.0726 = 6.7877 < 8.8240] w=0.2264 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)C261.CB) [> 4.5307 = 7.5511 < 9.8164] w=0.2229 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)S259.CB) [> 4.5480 = 7.5799 < 9.8539] w=0.2229 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)I258.CB) [> 3.2452 = 5.4087 < 7.0313] w=0.2229 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)F257.CB) [> 4.2448 = 7.0747 < 9.1971] w=0.2229 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)C261.CB) [> 4.5300 = 7.5501 < 9.8151] w=0.2229 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)S259.CB) [> 2.3276 = 3.8793 < 5.0431] w=0.2229 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)F257.CB) [> 3.4059 = 5.6765 < 7.3795] w=0.2229 to align # Constraint # added constraint: constraint((T0328)L36.CB, (T0328)E268.CB) [> 3.4383 = 5.7305 < 7.4497] w=0.2229 to align # Constraint # added constraint: constraint((T0328)V22.CB, (T0328)I47.CB) [> 4.0663 = 6.7771 < 8.8103] w=0.2229 to align # Constraint # added constraint: constraint((T0328)R144.CB, (T0328)T260.CB) [> 4.0413 = 6.7354 < 8.7561] w=0.2229 to align # Constraint # added constraint: constraint((T0328)S122.CB, (T0328)E154.CB) [> 3.5349 = 5.8914 < 7.6589] w=0.2229 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)M256.CB) [> 3.1082 = 5.1804 < 6.7345] w=0.2229 to align # Constraint # added constraint: constraint((T0328)V117.CB, (T0328)M256.CB) [> 2.9103 = 4.8505 < 6.3057] w=0.2229 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)M256.CB) [> 3.6757 = 6.1261 < 7.9640] w=0.2229 to align # Constraint # added constraint: constraint((T0328)R107.CB, (T0328)L255.CB) [> 3.2104 = 5.3507 < 6.9559] w=0.2229 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)I258.CB) [> 4.6737 = 7.7895 < 10.1264] w=0.2229 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)A118.CB) [> 3.0220 = 5.0367 < 6.5477] w=0.2192 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)I258.CB) [> 3.5222 = 5.8704 < 7.6315] w=0.2190 to align # Constraint # added constraint: constraint((T0328)R161.CB, (T0328)P264.CB) [> 3.4074 = 5.6790 < 7.3826] w=0.2139 to align # Constraint # added constraint: constraint((T0328)E163.CB, (T0328)F267.CB) [> 3.3058 = 5.5097 < 7.1626] w=0.2139 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)F257.CB) [> 2.5782 = 4.2970 < 5.5862] w=0.2139 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)L255.CB) [> 4.6936 = 7.8227 < 10.1695] w=0.2139 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)L255.CB) [> 2.9236 = 4.8727 < 6.3345] w=0.2139 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)I65.CB) [> 3.7137 = 6.1895 < 8.0463] w=0.2132 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)V117.CB) [> 3.6717 = 6.1195 < 7.9553] w=0.2102 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)F103.CB) [> 3.9557 = 6.5928 < 8.5707] w=0.2059 to align # Constraint # added constraint: constraint((T0328)R161.CB, (T0328)R262.CB) [> 4.4674 = 7.4457 < 9.6794] w=0.2049 to align # Constraint # added constraint: constraint((T0328)N229.CB, (T0328)L255.CB) [> 3.9578 = 6.5963 < 8.5752] w=0.1989 to align # Constraint # added constraint: constraint((T0328)M141.CB, (T0328)D151.CB) [> 3.6888 = 6.1481 < 7.9925] w=0.1981 to align # Constraint # added constraint: constraint((T0328)M141.CB, (T0328)V150.CB) [> 3.6559 = 6.0932 < 7.9212] w=0.1981 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)H105.CB) [> 3.5061 = 5.8435 < 7.5965] w=0.1961 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)F138.CB) [> 3.4813 = 5.8021 < 7.5428] w=0.1959 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)F138.CB) [> 4.4210 = 7.3683 < 9.5788] w=0.1959 to align # Constraint # added constraint: constraint((T0328)E213.CB, (T0328)K226.CB) [> 4.2432 = 7.0721 < 9.1937] w=0.1957 to align # Constraint # added constraint: constraint((T0328)L197.CB, (T0328)Y214.CB) [> 3.8280 = 6.3801 < 8.2941] w=0.1941 to align # Constraint # added constraint: constraint((T0328)Q200.CB, (T0328)Y214.CB) [> 3.9405 = 6.5675 < 8.5378] w=0.1941 to align # Constraint # added constraint: constraint((T0328)V228.CB, (T0328)M274.CB) [> 3.8338 = 6.3896 < 8.3065] w=0.1928 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)Q162.CB) [> 3.6161 = 6.0269 < 7.8350] w=0.1914 to align # Constraint # added constraint: constraint((T0328)Y69.CB, (T0328)V117.CB) [> 3.8530 = 6.4217 < 8.3482] w=0.1911 to align # Constraint # added constraint: constraint((T0328)A44.CB, (T0328)S55.CB) [> 3.9074 = 6.5124 < 8.4661] w=0.1892 to align # Constraint # added constraint: constraint((T0328)T51.CB, (T0328)I121.CB) [> 4.7263 = 7.8772 < 10.2403] w=0.1870 to align # Constraint # added constraint: constraint((T0328)T51.CB, (T0328)V117.CB) [> 3.7110 = 6.1850 < 8.0406] w=0.1870 to align # Constraint # added constraint: constraint((T0328)W192.CB, (T0328)L271.CB) [> 4.7011 = 7.8351 < 10.1857] w=0.1870 to align # Constraint # added constraint: constraint((T0328)L189.CB, (T0328)S259.CB) [> 4.4157 = 7.3595 < 9.5673] w=0.1870 to align # Constraint # added constraint: constraint((T0328)L189.CB, (T0328)F257.CB) [> 4.5433 = 7.5722 < 9.8438] w=0.1870 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)L255.CB) [> 4.3187 = 7.1979 < 9.3572] w=0.1870 to align # Constraint # added constraint: constraint((T0328)S169.CB, (T0328)Q253.CB) [> 4.3250 = 7.2083 < 9.3708] w=0.1870 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)G254.CA) [> 3.8059 = 6.3432 < 8.2462] w=0.1870 to align # Constraint # added constraint: constraint((T0328)R161.CB, (T0328)T260.CB) [> 4.3497 = 7.2495 < 9.4243] w=0.1870 to align # Constraint # added constraint: constraint((T0328)R161.CB, (T0328)C261.CB) [> 3.0768 = 5.1281 < 6.6665] w=0.1870 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)M256.CB) [> 4.0731 = 6.7884 < 8.8249] w=0.1870 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)G254.CA) [> 4.7146 = 7.8577 < 10.2150] w=0.1870 to align # Constraint # added constraint: constraint((T0328)S223.CB, (T0328)T260.CB) [> 3.5101 = 5.8502 < 7.6053] w=0.1848 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)I258.CB) [> 3.7141 = 6.1902 < 8.0472] w=0.1810 to align # Constraint # added constraint: constraint((T0328)F59.CB, (T0328)L106.CB) [> 4.1156 = 6.8593 < 8.9170] w=0.1808 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)A64.CB) [> 3.8721 = 6.4535 < 8.3896] w=0.1796 to align # Constraint # added constraint: constraint((T0328)E130.CB, (T0328)F140.CB) [> 3.6297 = 6.0495 < 7.8644] w=0.1783 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)V182.CB) [> 3.4784 = 5.7973 < 7.5365] w=0.1746 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)V182.CB) [> 3.8846 = 6.4742 < 8.4165] w=0.1746 to align # Constraint # added constraint: constraint((T0328)A186.CB, (T0328)L197.CB) [> 4.0267 = 6.7112 < 8.7245] w=0.1746 to align # Constraint # added constraint: constraint((T0328)A28.CB, (T0328)A67.CB) [> 4.4463 = 7.4105 < 9.6336] w=0.1730 to align # Constraint # added constraint: constraint((T0328)I204.CB, (T0328)S223.CB) [> 3.8489 = 6.4148 < 8.3392] w=0.1720 to align # Constraint # added constraint: constraint((T0328)I204.CB, (T0328)H224.CB) [> 3.1644 = 5.2740 < 6.8562] w=0.1720 to align # Constraint # added constraint: constraint((T0328)G205.CA, (T0328)S223.CB) [> 2.4609 = 4.1015 < 5.3319] w=0.1720 to align # Constraint # added constraint: constraint((T0328)G205.CA, (T0328)H224.CB) [> 3.8359 = 6.3932 < 8.3112] w=0.1720 to align # Constraint # added constraint: constraint((T0328)F140.CB, (T0328)V228.CB) [> 3.1625 = 5.2709 < 6.8522] w=0.1702 to align # Constraint # added constraint: constraint((T0328)N60.CB, (T0328)Q89.CB) [> 4.0712 = 6.7854 < 8.8210] w=0.1693 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)V117.CB) [> 4.4783 = 7.4637 < 9.7029] w=0.1685 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)L102.CB) [> 4.1144 = 6.8574 < 8.9146] w=0.1683 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)M88.CB) [> 3.9436 = 6.5727 < 8.5445] w=0.1648 to align # Constraint # added constraint: constraint((T0328)T222.CB, (T0328)H283.CB) [> 3.7634 = 6.2723 < 8.1539] w=0.1630 to align # Constraint # added constraint: constraint((T0328)G205.CA, (T0328)K226.CB) [> 3.9817 = 6.6362 < 8.6270] w=0.1630 to align # Constraint # added constraint: constraint((T0328)I203.CB, (T0328)H224.CB) [> 3.8159 = 6.3597 < 8.2677] w=0.1630 to align # Constraint # added constraint: constraint((T0328)I203.CB, (T0328)S223.CB) [> 3.8622 = 6.4371 < 8.3682] w=0.1630 to align # Constraint # added constraint: constraint((T0328)E154.CB, (T0328)V228.CB) [> 4.7421 = 7.9035 < 10.2746] w=0.1630 to align # Constraint # added constraint: constraint((T0328)L146.CB, (T0328)G248.CA) [> 4.4553 = 7.4256 < 9.6533] w=0.1630 to align # Constraint # added constraint: constraint((T0328)V43.CB, (T0328)D310.CB) [> 4.4452 = 7.4086 < 9.6312] w=0.1630 to align # Constraint # added constraint: constraint((T0328)P38.CB, (T0328)D310.CB) [> 4.2691 = 7.1152 < 9.2498] w=0.1630 to align # Constraint # added constraint: constraint((T0328)L230.CB, (T0328)M270.CB) [> 3.2476 = 5.4127 < 7.0365] w=0.1630 to align # Constraint # added constraint: constraint((T0328)T222.CB, (T0328)H285.CB) [> 2.6375 = 4.3958 < 5.7145] w=0.1630 to align # Constraint # added constraint: constraint((T0328)S223.CB, (T0328)H285.CB) [> 3.6896 = 6.1493 < 7.9941] w=0.1630 to align # Constraint # added constraint: constraint((T0328)H224.CB, (T0328)D284.CB) [> 3.3192 = 5.5319 < 7.1915] w=0.1630 to align # Constraint # added constraint: constraint((T0328)H224.CB, (T0328)L286.CB) [> 2.5464 = 4.2439 < 5.5171] w=0.1630 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)G277.CA) [> 4.0830 = 6.8051 < 8.8466] w=0.1630 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)M88.CB) [> 3.1591 = 5.2651 < 6.8446] w=0.1601 to align # Constraint # added constraint: constraint((T0328)F140.CB, (T0328)P156.CB) [> 3.7561 = 6.2602 < 8.1382] w=0.1563 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)P301.CB) [> 4.3837 = 7.3061 < 9.4979] w=0.1563 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)A165.CB) [> 4.0299 = 6.7165 < 8.7315] w=0.1563 to align # Constraint # added constraint: constraint((T0328)V275.CB, (T0328)T290.CB) [> 4.2341 = 7.0568 < 9.1738] w=0.1563 to align # Constraint # added constraint: constraint((T0328)I212.CB, (T0328)H266.CB) [> 2.9999 = 4.9998 < 6.4997] w=0.1563 to align # Constraint # added constraint: constraint((T0328)I212.CB, (T0328)C261.CB) [> 2.7927 = 4.6545 < 6.0509] w=0.1563 to align # Constraint # added constraint: constraint((T0328)I212.CB, (T0328)T260.CB) [> 4.0822 = 6.8036 < 8.8447] w=0.1563 to align # Constraint # added constraint: constraint((T0328)G168.CA, (T0328)F289.CB) [> 4.6934 = 7.8223 < 10.1689] w=0.1563 to align # Constraint # added constraint: constraint((T0328)G168.CA, (T0328)H193.CB) [> 3.7583 = 6.2638 < 8.1429] w=0.1563 to align # Constraint # added constraint: constraint((T0328)G168.CA, (T0328)W192.CB) [> 3.6247 = 6.0412 < 7.8535] w=0.1563 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)F299.CB) [> 3.1954 = 5.3256 < 6.9233] w=0.1563 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)F299.CB) [> 4.3155 = 7.1925 < 9.3503] w=0.1563 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)G61.CA) [> 3.0870 = 5.1451 < 6.6886] w=0.1551 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)F62.CB) [> 3.7199 = 6.1998 < 8.0598] w=0.1551 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)G61.CA) [> 4.3668 = 7.2780 < 9.4614] w=0.1551 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)F62.CB) [> 3.2891 = 5.4819 < 7.1265] w=0.1551 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)A64.CB) [> 3.8930 = 6.4884 < 8.4349] w=0.1551 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)L106.CB) [> 3.8351 = 6.3919 < 8.3095] w=0.1543 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)H105.CB) [> 4.5905 = 7.6508 < 9.9461] w=0.1543 to align # Constraint # added constraint: constraint((T0328)L230.CB, (T0328)K251.CB) [> 2.8163 = 4.6938 < 6.1019] w=0.1524 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)S122.CB) [> 4.5569 = 7.5948 < 9.8733] w=0.1498 to align # Constraint # added constraint: constraint((T0328)K226.CB, (T0328)M256.CB) [> 4.3615 = 7.2692 < 9.4500] w=0.1490 to align # Constraint # added constraint: constraint((T0328)R110.CB, (T0328)V182.CB) [> 4.2466 = 7.0777 < 9.2009] w=0.1486 to align # Constraint # added constraint: constraint((T0328)N155.CB, (T0328)K226.CB) [> 4.3061 = 7.1769 < 9.3300] w=0.1486 to align # Constraint # added constraint: constraint((T0328)G152.CA, (T0328)H224.CB) [> 4.0838 = 6.8063 < 8.8482] w=0.1486 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)R227.CB) [> 3.3677 = 5.6128 < 7.2967] w=0.1486 to align # Constraint # added constraint: constraint((T0328)Y111.CB, (T0328)V182.CB) [> 1.5667 = 2.6112 < 3.3946] w=0.1486 to align # Constraint # added constraint: constraint((T0328)H115.CB, (T0328)H160.CB) [> 3.4504 = 5.7507 < 7.4759] w=0.1486 to align # Constraint # added constraint: constraint((T0328)L230.CB, (T0328)F257.CB) [> 3.7569 = 6.2615 < 8.1399] w=0.1483 to align # Constraint # added constraint: constraint((T0328)L230.CB, (T0328)M256.CB) [> 4.1087 = 6.8478 < 8.9021] w=0.1483 to align # Constraint # added constraint: constraint((T0328)S223.CB, (T0328)C261.CB) [> 3.0772 = 5.1287 < 6.6672] w=0.1405 to align # Constraint # added constraint: constraint((T0328)T153.CB, (T0328)L166.CB) [> 4.1890 = 6.9816 < 9.0761] w=0.1403 to align # Constraint # added constraint: constraint((T0328)T153.CB, (T0328)A165.CB) [> 4.1047 = 6.8411 < 8.8935] w=0.1403 to align # Constraint # added constraint: constraint((T0328)N60.CB, (T0328)L128.CB) [> 3.6268 = 6.0446 < 7.8580] w=0.1320 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)M88.CB) [> 4.4497 = 7.4161 < 9.6409] w=0.1319 to align # Constraint # added constraint: constraint((T0328)S169.CB, (T0328)V182.CB) [> 3.9440 = 6.5734 < 8.5454] w=0.1313 to align # Constraint # added constraint: constraint((T0328)Y48.CB, (T0328)Y69.CB) [> 3.9966 = 6.6611 < 8.6594] w=0.1307 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)H181.CB) [> 4.6135 = 7.6891 < 9.9958] w=0.1253 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)S169.CB) [> 2.9256 = 4.8760 < 6.3387] w=0.1253 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)G168.CA) [> 3.3958 = 5.6596 < 7.3575] w=0.1253 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)G168.CA) [> 3.3543 = 5.5904 < 7.2676] w=0.1253 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)A118.CB) [> 4.0773 = 6.7956 < 8.8343] w=0.1253 to align # Constraint # added constraint: constraint((T0328)L195.CB, (T0328)M270.CB) [> 2.2472 = 3.7454 < 4.8690] w=0.1246 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)V117.CB) [> 3.9138 = 6.5230 < 8.4799] w=0.1230 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)L166.CB) [> 3.6219 = 6.0364 < 7.8474] w=0.1229 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)V167.CB) [> 3.8537 = 6.4228 < 8.3497] w=0.1229 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)L166.CB) [> 3.7243 = 6.2072 < 8.0693] w=0.1229 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)A165.CB) [> 3.9869 = 6.6448 < 8.6383] w=0.1229 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)L166.CB) [> 3.6847 = 6.1412 < 7.9835] w=0.1229 to align # Constraint # added constraint: constraint((T0328)S223.CB, (T0328)S259.CB) [> 3.6822 = 6.1370 < 7.9781] w=0.1225 to align # Constraint # added constraint: constraint((T0328)R144.CB, (T0328)R159.CB) [> 4.1947 = 6.9912 < 9.0886] w=0.1176 to align # Constraint # added constraint: constraint((T0328)G148.CA, (T0328)K157.CB) [> 3.4660 = 5.7766 < 7.5097] w=0.1156 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)G254.CA) [> 4.4109 = 7.3516 < 9.5570] w=0.1137 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)G61.CA) [> 3.1481 = 5.2469 < 6.8209] w=0.1134 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)F62.CB) [> 3.9453 = 6.5756 < 8.5482] w=0.1134 to align # Constraint # added constraint: constraint((T0328)D71.CB, (T0328)M88.CB) [> 4.4684 = 7.4473 < 9.6815] w=0.1113 to align # Constraint # added constraint: constraint((T0328)Y69.CB, (T0328)M88.CB) [> 4.4504 = 7.4173 < 9.6425] w=0.1113 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)V104.CB) [> 4.2147 = 7.0245 < 9.1318] w=0.1110 to align # Constraint # added constraint: constraint((T0328)P172.CB, (T0328)V182.CB) [> 3.9095 = 6.5159 < 8.4706] w=0.1100 to align # Constraint # added constraint: constraint((T0328)I225.CB, (T0328)M256.CB) [> 3.7837 = 6.3062 < 8.1981] w=0.1096 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)L286.CB) [> 4.4691 = 7.4485 < 9.6830] w=0.1077 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)V63.CB) [> 3.4794 = 5.7990 < 7.5386] w=0.1074 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)F62.CB) [> 4.4282 = 7.3804 < 9.5945] w=0.1074 to align # Constraint # added constraint: constraint((T0328)N68.CB, (T0328)E215.CB) [> 4.1964 = 6.9939 < 9.0921] w=0.1061 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)I225.CB) [> 4.7534 = 7.9223 < 10.2990] w=0.1061 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)A118.CB) [> 4.4877 = 7.4794 < 9.7233] w=0.1061 to align # Constraint # added constraint: constraint((T0328)V13.CB, (T0328)I225.CB) [> 2.9214 = 4.8690 < 6.3297] w=0.1061 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)A118.CB) [> 4.2899 = 7.1498 < 9.2947] w=0.1061 to align # Constraint # added constraint: constraint((T0328)A15.CB, (T0328)N119.CB) [> 4.3626 = 7.2709 < 9.4522] w=0.1061 to align # Constraint # added constraint: constraint((T0328)E16.CB, (T0328)R110.CB) [> 3.4904 = 5.8174 < 7.5626] w=0.1061 to align # Constraint # added constraint: constraint((T0328)E16.CB, (T0328)A118.CB) [> 4.7454 = 7.9090 < 10.2816] w=0.1061 to align # Constraint # added constraint: constraint((T0328)R110.CB, (T0328)F174.CB) [> 2.6078 = 4.3463 < 5.6502] w=0.1061 to align # Constraint # added constraint: constraint((T0328)V129.CB, (T0328)T153.CB) [> 3.4635 = 5.7725 < 7.5043] w=0.1061 to align # Constraint # added constraint: constraint((T0328)E201.CB, (T0328)I212.CB) [> 4.3867 = 7.3112 < 9.5045] w=0.1061 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)E239.CB) [> 3.9810 = 6.6350 < 8.6254] w=0.1061 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)H181.CB) [> 3.5969 = 5.9949 < 7.7933] w=0.1061 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)C108.CB) [> 3.5667 = 5.9445 < 7.7279] w=0.1061 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)Y100.CB) [> 4.0538 = 6.7563 < 8.7832] w=0.1058 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)R227.CB) [> 4.7108 = 7.8514 < 10.2068] w=0.1040 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)V117.CB) [> 3.9560 = 6.5933 < 8.5712] w=0.1027 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)A118.CB) [> 3.9550 = 6.5916 < 8.5691] w=0.1027 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)E163.CB) [> 4.2020 = 7.0033 < 9.1043] w=0.1013 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)I258.CB) [> 4.2695 = 7.1159 < 9.2507] w=0.0989 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)Q200.CB) [> 4.0089 = 6.6815 < 8.6859] w=0.0986 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)A118.CB) [> 4.3019 = 7.1699 < 9.3208] w=0.0970 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)Y74.CB) [> 4.3238 = 7.2063 < 9.3681] w=0.0915 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)L286.CB) [> 3.8212 = 6.3686 < 8.2792] w=0.0897 to align # Constraint # added constraint: constraint((T0328)S122.CB, (T0328)D145.CB) [> 3.3261 = 5.5434 < 7.2064] w=0.0893 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)D145.CB) [> 3.5150 = 5.8583 < 7.6157] w=0.0893 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)T260.CB) [> 3.7997 = 6.3328 < 8.2326] w=0.0893 to align # Constraint # added constraint: constraint((T0328)F140.CB, (T0328)T260.CB) [> 3.9057 = 6.5094 < 8.4623] w=0.0893 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)L106.CB) [> 4.5570 = 7.5950 < 9.8735] w=0.0887 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)R107.CB) [> 3.1999 = 5.3331 < 6.9331] w=0.0887 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)A118.CB) [> 3.6549 = 6.0915 < 7.9190] w=0.0880 to align # Constraint # added constraint: constraint((T0328)A44.CB, (T0328)Y69.CB) [> 4.4426 = 7.4043 < 9.6257] w=0.0870 to align # Constraint # added constraint: constraint((T0328)E173.CB, (T0328)V182.CB) [> 3.6579 = 6.0965 < 7.9255] w=0.0862 to align # Constraint # added constraint: constraint((T0328)W70.CB, (T0328)M88.CB) [> 2.4985 = 4.1642 < 5.4135] w=0.0856 to align # Constraint # added constraint: constraint((T0328)Q45.CB, (T0328)Y111.CB) [> 4.2526 = 7.0876 < 9.2140] w=0.0835 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)C108.CB) [> 3.2863 = 5.4771 < 7.1202] w=0.0835 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)R107.CB) [> 4.4957 = 7.4928 < 9.7407] w=0.0835 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)G61.CA) [> 4.4590 = 7.4317 < 9.6612] w=0.0835 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)L166.CB) [> 4.7509 = 7.9181 < 10.2935] w=0.0835 to align # Constraint # added constraint: constraint((T0328)V117.CB, (T0328)L166.CB) [> 3.4592 = 5.7653 < 7.4950] w=0.0835 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)L166.CB) [> 3.5191 = 5.8651 < 7.6246] w=0.0835 to align # Constraint # added constraint: constraint((T0328)L131.CB, (T0328)G148.CA) [> 4.6954 = 7.8257 < 10.1734] w=0.0835 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)V117.CB) [> 3.3689 = 5.6148 < 7.2992] w=0.0833 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)S259.CB) [> 4.5517 = 7.5862 < 9.8620] w=0.0833 to align # Constraint # added constraint: constraint((T0328)I238.CB, (T0328)L255.CB) [> 3.2410 = 5.4017 < 7.0222] w=0.0830 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)M88.CB) [> 4.0752 = 6.7920 < 8.8297] w=0.0828 to align # Constraint # added constraint: constraint((T0328)W70.CB, (T0328)I121.CB) [> 3.9703 = 6.6171 < 8.6023] w=0.0821 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)V117.CB) [> 4.5164 = 7.5273 < 9.7855] w=0.0821 to align # Constraint # added constraint: constraint((T0328)M6.CB, (T0328)G168.CA) [> 4.4131 = 7.3551 < 9.5616] w=0.0815 to align # Constraint # added constraint: constraint((T0328)M6.CB, (T0328)S169.CB) [> 3.9247 = 6.5411 < 8.5035] w=0.0815 to align # Constraint # added constraint: constraint((T0328)M6.CB, (T0328)K175.CB) [> 2.5084 = 4.1806 < 5.4348] w=0.0815 to align # Constraint # added constraint: constraint((T0328)R8.CB, (T0328)S302.CB) [> 2.3712 = 3.9519 < 5.1375] w=0.0815 to align # Constraint # added constraint: constraint((T0328)R8.CB, (T0328)F305.CB) [> 4.1319 = 6.8864 < 8.9524] w=0.0815 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)L106.CB) [> 4.0199 = 6.6999 < 8.7098] w=0.0799 to align # Constraint # added constraint: constraint((T0328)G17.CA, (T0328)L106.CB) [> 3.5525 = 5.9208 < 7.6971] w=0.0788 to align # Constraint # added constraint: constraint((T0328)R78.CB, (T0328)E99.CB) [> 4.1691 = 6.9485 < 9.0330] w=0.0788 to align # Constraint # added constraint: constraint((T0328)R78.CB, (T0328)I98.CB) [> 4.3176 = 7.1959 < 9.3547] w=0.0788 to align # Constraint # added constraint: constraint((T0328)Y46.CB, (T0328)M88.CB) [> 3.7102 = 6.1836 < 8.0387] w=0.0788 to align # Constraint # added constraint: constraint((T0328)E49.CB, (T0328)M88.CB) [> 3.7671 = 6.2786 < 8.1622] w=0.0788 to align # Constraint # added constraint: constraint((T0328)V275.CB, (T0328)A292.CB) [> 4.1907 = 6.9845 < 9.0798] w=0.0782 to align # Constraint # added constraint: constraint((T0328)M274.CB, (T0328)A292.CB) [> 4.6572 = 7.7620 < 10.0906] w=0.0782 to align # Constraint # added constraint: constraint((T0328)S223.CB, (T0328)M270.CB) [> 3.3991 = 5.6652 < 7.3647] w=0.0782 to align # Constraint # added constraint: constraint((T0328)M141.CB, (T0328)R227.CB) [> 4.6836 = 7.8061 < 10.1479] w=0.0782 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)A118.CB) [> 3.8621 = 6.4368 < 8.3678] w=0.0747 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)I225.CB) [> 3.0442 = 5.0736 < 6.5957] w=0.0743 to align # Constraint # added constraint: constraint((T0328)A97.CB, (T0328)L146.CB) [> 4.6981 = 7.8302 < 10.1792] w=0.0743 to align # Constraint # added constraint: constraint((T0328)E99.CB, (T0328)L146.CB) [> 3.1729 = 5.2881 < 6.8746] w=0.0743 to align # Constraint # added constraint: constraint((T0328)L189.CB, (T0328)S223.CB) [> 4.7695 = 7.9493 < 10.3340] w=0.0743 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)T260.CB) [> 4.5195 = 7.5326 < 9.7924] w=0.0743 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)H224.CB) [> 3.8371 = 6.3951 < 8.3137] w=0.0743 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)H224.CB) [> 4.0606 = 6.7677 < 8.7979] w=0.0743 to align # Constraint # added constraint: constraint((T0328)D151.CB, (T0328)L221.CB) [> 3.9083 = 6.5138 < 8.4679] w=0.0743 to align # Constraint # added constraint: constraint((T0328)D151.CB, (T0328)T222.CB) [> 4.3649 = 7.2749 < 9.4574] w=0.0743 to align # Constraint # added constraint: constraint((T0328)D151.CB, (T0328)I225.CB) [> 4.0998 = 6.8330 < 8.8829] w=0.0743 to align # Constraint # added constraint: constraint((T0328)T153.CB, (T0328)K226.CB) [> 3.4472 = 5.7453 < 7.4689] w=0.0743 to align # Constraint # added constraint: constraint((T0328)G152.CA, (T0328)K226.CB) [> 4.6737 = 7.7894 < 10.1263] w=0.0743 to align # Constraint # added constraint: constraint((T0328)G152.CA, (T0328)L221.CB) [> 3.9598 = 6.5997 < 8.5796] w=0.0743 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)M88.CB) [> 3.2045 = 5.3408 < 6.9430] w=0.0722 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)M88.CB) [> 3.7930 = 6.3216 < 8.2181] w=0.0722 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)V63.CB) [> 3.5849 = 5.9748 < 7.7672] w=0.0716 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)Q209.CB) [> 3.8114 = 6.3523 < 8.2580] w=0.0716 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)T207.CB) [> 3.7195 = 6.1991 < 8.0588] w=0.0716 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)V182.CB) [> 3.8399 = 6.3998 < 8.3197] w=0.0716 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)A165.CB) [> 3.9852 = 6.6419 < 8.6345] w=0.0716 to align # Constraint # added constraint: constraint((T0328)T147.CB, (T0328)K157.CB) [> 3.9456 = 6.5760 < 8.5488] w=0.0716 to align # Constraint # added constraint: constraint((T0328)T222.CB, (T0328)S259.CB) [> 4.3433 = 7.2388 < 9.4105] w=0.0713 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)T222.CB) [> 3.6898 = 6.1497 < 7.9946] w=0.0707 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)R107.CB) [> 4.7682 = 7.9469 < 10.3310] w=0.0707 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)V182.CB) [> 3.0315 = 5.0525 < 6.5683] w=0.0707 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)C261.CB) [> 3.3474 = 5.5790 < 7.2527] w=0.0707 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)G254.CA) [> 4.0690 = 6.7817 < 8.8163] w=0.0692 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)G254.CA) [> 3.2616 = 5.4360 < 7.0668] w=0.0692 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)T260.CB) [> 3.1451 = 5.2418 < 6.8143] w=0.0692 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)Y179.CB) [> 4.5515 = 7.5859 < 9.8617] w=0.0685 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)Y100.CB) [> 3.5145 = 5.8575 < 7.6148] w=0.0678 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)F103.CB) [> 3.7174 = 6.1956 < 8.0543] w=0.0641 to align # Constraint # added constraint: constraint((T0328)Y111.CB, (T0328)M141.CB) [> 4.5579 = 7.5965 < 9.8755] w=0.0623 to align # Constraint # added constraint: constraint((T0328)T222.CB, (T0328)C261.CB) [> 3.9193 = 6.5322 < 8.4919] w=0.0623 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)R227.CB) [> 4.6292 = 7.7153 < 10.0299] w=0.0623 to align # Constraint # added constraint: constraint((T0328)I180.CB, (T0328)H288.CB) [> 4.4905 = 7.4842 < 9.7294] w=0.0623 to align # Constraint # added constraint: constraint((T0328)V117.CB, (T0328)L255.CB) [> 4.5751 = 7.6252 < 9.9128] w=0.0595 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)L255.CB) [> 2.6683 = 4.4472 < 5.7814] w=0.0595 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)F257.CB) [> 3.8702 = 6.4504 < 8.3855] w=0.0595 to align # Constraint # added constraint: constraint((T0328)L106.CB, (T0328)R227.CB) [> 4.4447 = 7.4079 < 9.6303] w=0.0595 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)R227.CB) [> 3.2299 = 5.3832 < 6.9981] w=0.0595 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)V150.CB) [> 4.4155 = 7.3591 < 9.5668] w=0.0595 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)T260.CB) [> 4.2359 = 7.0599 < 9.1779] w=0.0595 to align # Constraint # added constraint: constraint((T0328)V150.CB, (T0328)M256.CB) [> 2.5358 = 4.2264 < 5.4943] w=0.0595 to align # Constraint # added constraint: constraint((T0328)V150.CB, (T0328)L255.CB) [> 4.7786 = 7.9643 < 10.3536] w=0.0595 to align # Constraint # added constraint: constraint((T0328)G148.CA, (T0328)M256.CB) [> 4.1967 = 6.9945 < 9.0928] w=0.0595 to align # Constraint # added constraint: constraint((T0328)G148.CA, (T0328)L255.CB) [> 3.4753 = 5.7922 < 7.5299] w=0.0595 to align # Constraint # added constraint: constraint((T0328)L146.CB, (T0328)I258.CB) [> 3.6131 = 6.0218 < 7.8283] w=0.0595 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)V117.CB) [> 4.1215 = 6.8692 < 8.9299] w=0.0560 to align # Constraint # added constraint: constraint((T0328)I47.CB, (T0328)F305.CB) [> 4.2774 = 7.1290 < 9.2678] w=0.0547 to align # Constraint # added constraint: constraint((T0328)C39.CB, (T0328)F309.CB) [> 3.8286 = 6.3810 < 8.2953] w=0.0547 to align # Constraint # added constraint: constraint((T0328)I204.CB, (T0328)L306.CB) [> 3.6467 = 6.0779 < 7.9013] w=0.0547 to align # Constraint # added constraint: constraint((T0328)L195.CB, (T0328)N229.CB) [> 2.7977 = 4.6629 < 6.0618] w=0.0530 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)L195.CB) [> 4.1484 = 6.9141 < 8.9883] w=0.0525 to align # Constraint # added constraint: constraint((T0328)F276.CB, (T0328)L286.CB) [> 3.9058 = 6.5097 < 8.4626] w=0.0477 to align # Constraint # added constraint: constraint((T0328)E16.CB, (T0328)A64.CB) [> 4.7445 = 7.9075 < 10.2798] w=0.0477 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)V63.CB) [> 4.3582 = 7.2636 < 9.4427] w=0.0477 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)A64.CB) [> 3.1354 = 5.2257 < 6.7934] w=0.0477 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)A44.CB) [> 4.5905 = 7.6509 < 9.9462] w=0.0477 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)V63.CB) [> 4.2640 = 7.1067 < 9.2387] w=0.0477 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)F62.CB) [> 4.4209 = 7.3681 < 9.5786] w=0.0477 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)V63.CB) [> 3.4644 = 5.7739 < 7.5061] w=0.0477 to align # Constraint # added constraint: constraint((T0328)A15.CB, (T0328)F62.CB) [> 2.2908 = 3.8181 < 4.9635] w=0.0477 to align # Constraint # added constraint: constraint((T0328)A15.CB, (T0328)V63.CB) [> 3.7881 = 6.3135 < 8.2076] w=0.0477 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)H181.CB) [> 4.7786 = 7.9644 < 10.3537] w=0.0477 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)E201.CB) [> 2.4986 = 4.1644 < 5.4137] w=0.0477 to align # Constraint # added constraint: constraint((T0328)I238.CB, (T0328)G254.CA) [> 3.9138 = 6.5230 < 8.4799] w=0.0477 to align # Constraint # added constraint: constraint((T0328)L50.CB, (T0328)T207.CB) [> 3.7367 = 6.2279 < 8.0963] w=0.0440 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)R227.CB) [> 4.7502 = 7.9170 < 10.2921] w=0.0440 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)R227.CB) [> 4.2647 = 7.1078 < 9.2402] w=0.0440 to align # Constraint # added constraint: constraint((T0328)F276.CB, (T0328)H285.CB) [> 3.9730 = 6.6217 < 8.6082] w=0.0418 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)M88.CB) [> 2.8408 = 4.7346 < 6.1550] w=0.0418 to align # Constraint # added constraint: constraint((T0328)D142.CB, (T0328)D151.CB) [> 3.8278 = 6.3796 < 8.2935] w=0.0418 to align # Constraint # added constraint: constraint((T0328)R242.CB, (T0328)T260.CB) [> 3.9733 = 6.6221 < 8.6088] w=0.0414 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)Y179.CB) [> 4.5025 = 7.5041 < 9.7554] w=0.0413 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)L106.CB) [> 3.6202 = 6.0336 < 7.8437] w=0.0402 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)C108.CB) [> 3.8021 = 6.3368 < 8.2378] w=0.0402 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)R107.CB) [> 3.8239 = 6.3731 < 8.2851] w=0.0402 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)L106.CB) [> 4.1748 = 6.9580 < 9.0454] w=0.0397 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)H105.CB) [> 4.7487 = 7.9145 < 10.2888] w=0.0397 to align # Constraint # added constraint: constraint((T0328)I65.CB, (T0328)L106.CB) [> 2.6886 = 4.4811 < 5.8254] w=0.0397 to align # Constraint # added constraint: constraint((T0328)A67.CB, (T0328)L114.CB) [> 4.4192 = 7.3653 < 9.5749] w=0.0397 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)Y100.CB) [> 3.7690 = 6.2816 < 8.1661] w=0.0397 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)L255.CB) [> 3.1264 = 5.2107 < 6.7739] w=0.0394 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)G254.CA) [> 4.2266 = 7.0443 < 9.1576] w=0.0394 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)H181.CB) [> 4.6976 = 7.8294 < 10.1782] w=0.0394 to align # Constraint # added constraint: constraint((T0328)V104.CB, (T0328)V167.CB) [> 4.1680 = 6.9467 < 9.0307] w=0.0394 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)M256.CB) [> 2.7552 = 4.5919 < 5.9695] w=0.0394 to align # Constraint # added constraint: constraint((T0328)F103.CB, (T0328)L255.CB) [> 4.3253 = 7.2089 < 9.3716] w=0.0394 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)F257.CB) [> 3.0857 = 5.1429 < 6.6858] w=0.0394 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)M256.CB) [> 4.3535 = 7.2558 < 9.4326] w=0.0394 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)L255.CB) [> 3.8708 = 6.4513 < 8.3867] w=0.0394 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)V182.CB) [> 3.8106 = 6.3510 < 8.2563] w=0.0394 to align # Constraint # added constraint: constraint((T0328)L102.CB, (T0328)H181.CB) [> 3.6783 = 6.1304 < 7.9696] w=0.0394 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)S259.CB) [> 3.7415 = 6.2358 < 8.1065] w=0.0394 to align # Constraint # added constraint: constraint((T0328)Y100.CB, (T0328)I258.CB) [> 3.1043 = 5.1738 < 6.7260] w=0.0394 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)F299.CB) [> 3.1217 = 5.2028 < 6.7636] w=0.0354 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)S297.CB) [> 4.4715 = 7.4525 < 9.6883] w=0.0354 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)F299.CB) [> 4.6835 = 7.8058 < 10.1475] w=0.0354 to align # Constraint # added constraint: constraint((T0328)C14.CB, (T0328)R262.CB) [> 4.1580 = 6.9300 < 9.0090] w=0.0354 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)C261.CB) [> 2.9506 = 4.9177 < 6.3931] w=0.0354 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)T260.CB) [> 2.9354 = 4.8923 < 6.3600] w=0.0354 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)S259.CB) [> 2.6072 = 4.3453 < 5.6488] w=0.0354 to align # Constraint # added constraint: constraint((T0328)G12.CA, (T0328)I258.CB) [> 2.5921 = 4.3201 < 5.6161] w=0.0354 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)C261.CB) [> 4.6971 = 7.8285 < 10.1771] w=0.0354 to align # Constraint # added constraint: constraint((T0328)L11.CB, (T0328)T260.CB) [> 4.6568 = 7.7612 < 10.0896] w=0.0354 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)F299.CB) [> 2.7788 = 4.6313 < 6.0207] w=0.0354 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)F257.CB) [> 4.1154 = 6.8590 < 8.9167] w=0.0354 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)I240.CB) [> 4.2135 = 7.0226 < 9.1293] w=0.0354 to align # Constraint # added constraint: constraint((T0328)T222.CB, (T0328)F299.CB) [> 3.3998 = 5.6663 < 7.3662] w=0.0354 to align # Constraint # added constraint: constraint((T0328)T222.CB, (T0328)F298.CB) [> 4.0356 = 6.7259 < 8.7437] w=0.0354 to align # Constraint # added constraint: constraint((T0328)T222.CB, (T0328)R242.CB) [> 3.4522 = 5.7537 < 7.4799] w=0.0354 to align # Constraint # added constraint: constraint((T0328)V182.CB, (T0328)L221.CB) [> 3.6867 = 6.1444 < 7.9878] w=0.0354 to align # Constraint # added constraint: constraint((T0328)L131.CB, (T0328)T153.CB) [> 3.0738 = 5.1229 < 6.6598] w=0.0354 to align # Constraint # added constraint: constraint((T0328)R107.CB, (T0328)P301.CB) [> 2.8170 = 4.6950 < 6.1035] w=0.0354 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)F299.CB) [> 4.4187 = 7.3645 < 9.5738] w=0.0354 to align # Constraint # added constraint: constraint((T0328)I238.CB, (T0328)M256.CB) [> 3.2970 = 5.4949 < 7.1434] w=0.0354 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)R107.CB) [> 3.2692 = 5.4486 < 7.0832] w=0.0351 to align # Constraint # added constraint: constraint((T0328)R107.CB, (T0328)T153.CB) [> 3.6974 = 6.1624 < 8.0111] w=0.0342 to align # Constraint # added constraint: constraint((T0328)C108.CB, (T0328)T153.CB) [> 3.8707 = 6.4511 < 8.3865] w=0.0342 to align # Constraint # added constraint: constraint((T0328)V117.CB, (T0328)F276.CB) [> 4.6845 = 7.8075 < 10.1498] w=0.0298 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)T260.CB) [> 4.0975 = 6.8292 < 8.8779] w=0.0298 to align # Constraint # added constraint: constraint((T0328)R107.CB, (T0328)R227.CB) [> 3.1016 = 5.1694 < 6.7202] w=0.0298 to align # Constraint # added constraint: constraint((T0328)H105.CB, (T0328)F276.CB) [> 3.8683 = 6.4471 < 8.3812] w=0.0298 to align # Constraint # added constraint: constraint((T0328)F149.CB, (T0328)L189.CB) [> 3.4167 = 5.6946 < 7.4029] w=0.0298 to align # Constraint # added constraint: constraint((T0328)G148.CA, (T0328)G254.CA) [> 4.6638 = 7.7730 < 10.1049] w=0.0298 to align # Constraint # added constraint: constraint((T0328)G148.CA, (T0328)R227.CB) [> 4.1933 = 6.9888 < 9.0854] w=0.0298 to align # Constraint # added constraint: constraint((T0328)V150.CB, (T0328)R227.CB) [> 4.1463 = 6.9105 < 8.9837] w=0.0298 to align # Constraint # added constraint: constraint((T0328)V150.CB, (T0328)G254.CA) [> 4.6540 = 7.7567 < 10.0837] w=0.0298 to align # Constraint # added constraint: constraint((T0328)I238.CB, (T0328)Q253.CB) [> 4.0443 = 6.7404 < 8.7625] w=0.0297 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)A118.CB) [> 4.0326 = 6.7210 < 8.7372] w=0.0286 to align # Constraint # added constraint: constraint((T0328)G205.CA, (T0328)L221.CB) [> 3.4755 = 5.7924 < 7.5302] w=0.0281 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)I238.CB) [> 3.6619 = 6.1032 < 7.9342] w=0.0281 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)S237.CB) [> 4.7496 = 7.9159 < 10.2907] w=0.0281 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)I238.CB) [> 4.6185 = 7.6976 < 10.0069] w=0.0281 to align # Constraint # added constraint: constraint((T0328)V164.CB, (T0328)R242.CB) [> 2.1977 = 3.6628 < 4.7617] w=0.0281 to align # Constraint # added constraint: constraint((T0328)T290.CB, (T0328)A300.CB) [> 3.8346 = 6.3910 < 8.3083] w=0.0274 to align # Constraint # added constraint: constraint((T0328)S291.CB, (T0328)A300.CB) [> 4.3901 = 7.3169 < 9.5120] w=0.0274 to align # Constraint # added constraint: constraint((T0328)S291.CB, (T0328)P301.CB) [> 3.8732 = 6.4553 < 8.3918] w=0.0274 to align # Constraint # added constraint: constraint((T0328)S291.CB, (T0328)S302.CB) [> 3.6127 = 6.0211 < 7.8275] w=0.0274 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)H288.CB) [> 3.6173 = 6.0289 < 7.8375] w=0.0274 to align # Constraint # added constraint: constraint((T0328)H181.CB, (T0328)H285.CB) [> 2.5051 = 4.1751 < 5.4276] w=0.0274 to align # Constraint # added constraint: constraint((T0328)A165.CB, (T0328)H181.CB) [> 2.6469 = 4.4115 < 5.7350] w=0.0273 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)C108.CB) [> 4.3800 = 7.3000 < 9.4899] w=0.0261 to align # Constraint # added constraint: constraint((T0328)V117.CB, (T0328)A165.CB) [> 4.4221 = 7.3701 < 9.5812] w=0.0261 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)Y100.CB) [> 4.4223 = 7.3704 < 9.5816] w=0.0245 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)L102.CB) [> 4.2336 = 7.0560 < 9.1728] w=0.0245 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)L102.CB) [> 4.7446 = 7.9076 < 10.2799] w=0.0245 to align # Constraint # added constraint: constraint((T0328)L166.CB, (T0328)Q209.CB) [> 4.3422 = 7.2371 < 9.4082] w=0.0239 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)C108.CB) [> 4.7222 = 7.8704 < 10.2315] w=0.0239 to align # Constraint # added constraint: constraint((T0328)A15.CB, (T0328)M25.CB) [> 3.8545 = 6.4242 < 8.3515] w=0.0239 to align # Constraint # added constraint: constraint((T0328)I258.CB, (T0328)F299.CB) [> 4.5528 = 7.5879 < 9.8643] w=0.0239 to align # Constraint # added constraint: constraint((T0328)I258.CB, (T0328)F298.CB) [> 2.8940 = 4.8233 < 6.2703] w=0.0239 to align # Constraint # added constraint: constraint((T0328)I258.CB, (T0328)S297.CB) [> 4.4418 = 7.4030 < 9.6239] w=0.0239 to align # Constraint # added constraint: constraint((T0328)F257.CB, (T0328)F298.CB) [> 4.2389 = 7.0649 < 9.1843] w=0.0239 to align # Constraint # added constraint: constraint((T0328)F257.CB, (T0328)S297.CB) [> 2.8076 = 4.6793 < 6.0831] w=0.0239 to align # Constraint # added constraint: constraint((T0328)F257.CB, (T0328)S296.CB) [> 4.1444 = 6.9074 < 8.9796] w=0.0239 to align # Constraint # added constraint: constraint((T0328)F257.CB, (T0328)G295.CA) [> 4.4309 = 7.3848 < 9.6002] w=0.0239 to align # Constraint # added constraint: constraint((T0328)M256.CB, (T0328)F298.CB) [> 3.5314 = 5.8857 < 7.6514] w=0.0239 to align # Constraint # added constraint: constraint((T0328)M256.CB, (T0328)S296.CB) [> 4.2650 = 7.1083 < 9.2408] w=0.0239 to align # Constraint # added constraint: constraint((T0328)C261.CB, (T0328)F299.CB) [> 3.9040 = 6.5066 < 8.4586] w=0.0239 to align # Constraint # added constraint: constraint((T0328)T260.CB, (T0328)F299.CB) [> 4.7857 = 7.9762 < 10.3691] w=0.0239 to align # Constraint # added constraint: constraint((T0328)S259.CB, (T0328)F299.CB) [> 3.1495 = 5.2491 < 6.8239] w=0.0239 to align # Constraint # added constraint: constraint((T0328)S259.CB, (T0328)F298.CB) [> 4.4099 = 7.3499 < 9.5549] w=0.0239 to align # Constraint # added constraint: constraint((T0328)S259.CB, (T0328)S297.CB) [> 3.5864 = 5.9773 < 7.7705] w=0.0239 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)F299.CB) [> 3.5651 = 5.9418 < 7.7243] w=0.0239 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)S297.CB) [> 3.0964 = 5.1607 < 6.7089] w=0.0239 to align # Constraint # added constraint: constraint((T0328)R227.CB, (T0328)S296.CB) [> 4.7597 = 7.9329 < 10.3127] w=0.0239 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)R107.CB) [> 4.5357 = 7.5594 < 9.8273] w=0.0228 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)L102.CB) [> 3.9244 = 6.5406 < 8.5028] w=0.0180 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)V104.CB) [> 2.5748 = 4.2914 < 5.5788] w=0.0180 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)H105.CB) [> 3.7677 = 6.2795 < 8.1634] w=0.0180 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)C108.CB) [> 4.5062 = 7.5103 < 9.7634] w=0.0180 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)D151.CB) [> 3.5294 = 5.8823 < 7.6470] w=0.0180 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)G152.CA) [> 3.2246 = 5.3743 < 6.9866] w=0.0180 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)D151.CB) [> 4.7211 = 7.8685 < 10.2290] w=0.0180 to align # Constraint # added constraint: constraint((T0328)L24.CB, (T0328)G152.CA) [> 3.4781 = 5.7968 < 7.5359] w=0.0180 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)V150.CB) [> 4.0253 = 6.7088 < 8.7214] w=0.0180 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)D151.CB) [> 3.2122 = 5.3537 < 6.9598] w=0.0180 to align # Constraint # added constraint: constraint((T0328)M25.CB, (T0328)G152.CA) [> 4.4193 = 7.3654 < 9.5751] w=0.0180 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)V150.CB) [> 2.5188 = 4.1981 < 5.4575] w=0.0180 to align # Constraint # added constraint: constraint((T0328)S237.CB, (T0328)G254.CA) [> 3.0098 = 5.0163 < 6.5212] w=0.0180 to align # Constraint # added constraint: constraint((T0328)S237.CB, (T0328)L255.CB) [> 4.7594 = 7.9323 < 10.3120] w=0.0180 to align # Constraint # added constraint: constraint((T0328)F26.CB, (T0328)I65.CB) [> 3.0136 = 5.0227 < 6.5295] w=0.0163 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)G148.CA) [> 4.7979 = 7.9965 < 10.3954] w=0.0141 to align # Constraint # added constraint: constraint((T0328)G61.CA, (T0328)C108.CB) [> 3.3255 = 5.5426 < 7.2053] w=0.0141 to align # Constraint # added constraint: constraint((T0328)F62.CB, (T0328)R107.CB) [> 2.4427 = 4.0711 < 5.2925] w=0.0141 to align # Constraint # added constraint: constraint((T0328)S237.CB, (T0328)I258.CB) [> 4.4525 = 7.4208 < 9.6470] w=0.0141 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)T260.CB) [> 4.5610 = 7.6017 < 9.8823] w=0.0141 to align # Constraint # added constraint: constraint((T0328)V167.CB, (T0328)C261.CB) [> 4.7121 = 7.8534 < 10.2095] w=0.0141 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)L106.CB) [> 2.5907 = 4.3178 < 5.6131] w=0.0090 to align # Constraint # added constraint: constraint((T0328)M88.CB, (T0328)Y100.CB) [> 4.7558 = 7.9264 < 10.3043] w=0.0090 to align # Constraint # added constraint: constraint((T0328)A118.CB, (T0328)G152.CA) [> 3.1722 = 5.2870 < 6.8731] w=0.0090 to align # Constraint # added constraint: constraint((T0328)R107.CB, (T0328)A118.CB) [> 4.7313 = 7.8855 < 10.2511] w=0.0090 to align # Constraint # added constraint: constraint((T0328)Y23.CB, (T0328)V117.CB) [> 3.5347 = 5.8912 < 7.6586] w=0.0090 to align # Constraint # added constraint: constraint((T0328)V63.CB, (T0328)L166.CB) [> 4.7154 = 7.8590 < 10.2166] w=0.0087 to align # Constraint # added constraint: constraint((T0328)A64.CB, (T0328)C108.CB) [> 3.8389 = 6.3982 < 8.3177] w=0.0087 to align # Constraint # added constraint: constraint((T0328)Q243.CB, (T0328)L255.CB) [> 4.0279 = 6.7131 < 8.7270] w=0.0087 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0328/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0328/decoys/ # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 285 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 287 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 287 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 285 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 299 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 256 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 283 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 301 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 304 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CPHmodels_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CPHmodels_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)N282.C and (T0328)H283.N only 0.000 apart, marking (T0328)H283.N as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CA only 0.000 apart, marking (T0328)H283.CA as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CA only 0.000 apart, marking (T0328)H283.CA as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CB only 0.000 apart, marking (T0328)H283.CB as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CB only 0.000 apart, marking (T0328)H283.CB as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CB only 0.000 apart, marking (T0328)H283.CB as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CE1 and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.NE2 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CE1 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.O and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.NE2 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CE1 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)I258.C and (T0328)S259.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)S259.N and (T0328)S259.CA only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)S259.CA only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)S259.CB only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)S259.CB only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)S259.CB only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)S259.OG only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)S259.OG only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)S259.OG only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)S259.OG only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)S259.O only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)S259.O only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)S259.O only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)S259.O only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)S259.O only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)S259.C only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)S259.C only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)S259.C only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)S259.C only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)S259.C only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)S259.C only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T260.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T260.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T260.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T260.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T260.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T260.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T260.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T260.CA only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T260.CG2 only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T260.OG1 only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T260.O only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T260.C only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)C261.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)C261.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)C261.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)C261.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)C261.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)C261.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)C261.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)C261.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)C261.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)C261.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)C261.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)C261.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)C261.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)C261.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)C261.N and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)C261.CA only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)C261.CB only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)C261.SG only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)C261.O only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)C261.C only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.CA only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.CG only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.CD only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.NE only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.CZ only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.NH1 only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.NH2 only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.O only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)R262.C only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)T263.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)T263.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)T263.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)T263.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)T263.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)T263.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)T263.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)T263.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)T263.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)T263.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)T263.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)T263.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)T263.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)T263.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)T263.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)T263.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)T263.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)T263.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T263.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T263.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T263.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T263.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T263.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T263.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T263.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T263.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T263.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T263.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T263.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T263.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T263.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)T263.N and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T263.CA only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T263.CB only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T263.CG2 only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T263.OG1 only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T263.O only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)T263.C only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)P264.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)P264.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)P264.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)P264.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)P264.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)P264.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)P264.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)P264.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)P264.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)P264.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)P264.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)P264.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)P264.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)P264.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)P264.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)P264.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)P264.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)P264.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)P264.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)P264.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)P264.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)P264.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)P264.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)P264.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)P264.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)P264.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)P264.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)P264.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)P264.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)P264.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)P264.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)P264.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)P264.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)P264.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)P264.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)P264.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)P264.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)P264.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)P264.N and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)P264.CA only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)P264.CB only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)P264.CG only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.N and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T263.C and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T263.O and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T263.N and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.C and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.O and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)R262.N and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)C261.C and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)C261.O and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)C261.N and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T260.C and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T260.O and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)T260.N and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)S259.C and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)S259.O and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)S259.N and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)I258.C and (T0328)P264.CD only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)P264.O only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)P264.C only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.N only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.N only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.N only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.N only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.N only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.N only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.N only 0.000 apart, marking (T0328)D265.N as missing WARNING: atoms too close: (T0328)D265.N and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.CA only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.N and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.N and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.CG only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.OD1 only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.OD2 only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.N and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.O only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.O and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.N and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)D265.C only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.N only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.N only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.N only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.N only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.N only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.N only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.N only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.N only 0.000 apart, marking (T0328)D265.N as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.N only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.N only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.N only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.N only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.N only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.N only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.N only 0.000 apart, marking (T0328)H266.N as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.CA only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.CB only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.CG only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.CD2 only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.ND1 only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.CE1 only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.NE2 only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.O only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)D265.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)H266.C only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.N only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.N only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.N only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.N only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.N only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.N only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.N only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.N only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.N only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.N only 0.000 apart, marking (T0328)H266.N as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.N only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.N only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.N only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.N only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.N only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.N only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.N only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.N only 0.000 apart, marking (T0328)D265.N as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.N only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.N only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.N only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.N only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.N only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.N only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.N only 0.000 apart, marking (T0328)F267.N as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CA only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CG only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CD1 only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CD2 only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CE1 only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CE2 only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.CZ only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.O only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)H266.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)D265.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)F267.C only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.N only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.N only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.N only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.N only 0.000 apart, marking (T0328)F267.N as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.N only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.N only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.N only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.N only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.N only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.N only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.N only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.N only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.N only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.N only 0.000 apart, marking (T0328)H266.N as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.N only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.N only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.N only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.N only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.N only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.N only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.N only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.N only 0.000 apart, marking (T0328)D265.N as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.N only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.N only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.N only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.N only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.N only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.N only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.N only 0.000 apart, marking (T0328)E268.N as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.CA only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.CG only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.CD only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.OE1 only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.OE2 only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.O only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)F267.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)H266.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)D265.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)E268.C only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.N only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.N only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.N only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.N only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.N only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.N only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.N only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.N only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.N only 0.000 apart, marking (T0328)E268.N as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.N only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.N only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.N only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.N only 0.000 apart, marking (T0328)F267.N as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.N only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.N only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.N only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.N only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.N only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.N only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.N only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.N only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.N only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.N only 0.000 apart, marking (T0328)H266.N as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.N only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.N only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.N only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.N only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.N only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.N only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.N only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.N only 0.000 apart, marking (T0328)D265.N as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.N only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.N only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.N only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.N only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.N only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.N only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.N only 0.000 apart, marking (T0328)K269.N as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.CA only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.CB only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.CG only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.CD only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.CE only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.NZ only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.O only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)E268.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)F267.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)H266.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)D265.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)K269.C only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.N only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.N only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.N only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.N only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.N only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.N only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.N only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.N only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.N only 0.000 apart, marking (T0328)K269.N as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.N only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.N only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.N only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.N only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.N only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.N only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.N only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.N only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.N only 0.000 apart, marking (T0328)E268.N as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.N only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.N only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.N only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.N only 0.000 apart, marking (T0328)F267.N as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.N only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.N only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.N only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.N only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.N only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.N only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.N only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.N only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.N only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.N only 0.000 apart, marking (T0328)H266.N as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.N only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.N only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.N only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.N only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.N only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.N only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.N only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.N only 0.000 apart, marking (T0328)D265.N as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.N only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.N only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.N only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.N only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.N only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.N only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.N only 0.000 apart, marking (T0328)M270.N as missing WARNING: atoms too close: (T0328)M270.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.CA only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)M270.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)M270.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.CG only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)M270.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.SD only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)M270.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.CE only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)M270.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.O only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)M270.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)K269.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)E268.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)F267.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)H266.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)D265.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)M270.C only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.N only 0.000 apart, marking (T0328)M270.C as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.N only 0.000 apart, marking (T0328)M270.O as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.N only 0.000 apart, marking (T0328)M270.CE as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.N only 0.000 apart, marking (T0328)M270.SD as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.N only 0.000 apart, marking (T0328)M270.CG as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.N only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.N only 0.000 apart, marking (T0328)M270.CA as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.N only 0.000 apart, marking (T0328)M270.N as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.N only 0.000 apart, marking (T0328)K269.C as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.N only 0.000 apart, marking (T0328)K269.O as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.N only 0.000 apart, marking (T0328)K269.NZ as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.N only 0.000 apart, marking (T0328)K269.CE as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.N only 0.000 apart, marking (T0328)K269.CD as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.N only 0.000 apart, marking (T0328)K269.CG as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.N only 0.000 apart, marking (T0328)K269.CB as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.N only 0.000 apart, marking (T0328)K269.CA as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.N only 0.000 apart, marking (T0328)K269.N as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.N only 0.000 apart, marking (T0328)E268.C as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.N only 0.000 apart, marking (T0328)E268.O as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.N only 0.000 apart, marking (T0328)E268.OE2 as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.N only 0.000 apart, marking (T0328)E268.OE1 as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.N only 0.000 apart, marking (T0328)E268.CD as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.N only 0.000 apart, marking (T0328)E268.CG as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.N only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.N only 0.000 apart, marking (T0328)E268.CA as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.N only 0.000 apart, marking (T0328)E268.N as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.N only 0.000 apart, marking (T0328)F267.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.N only 0.000 apart, marking (T0328)F267.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CZ as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CE2 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CE1 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CD2 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CD1 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.N only 0.000 apart, marking (T0328)F267.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.N only 0.000 apart, marking (T0328)F267.N as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.N only 0.000 apart, marking (T0328)H266.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.N only 0.000 apart, marking (T0328)H266.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.N only 0.000 apart, marking (T0328)H266.NE2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.N only 0.000 apart, marking (T0328)H266.CE1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.N only 0.000 apart, marking (T0328)H266.ND1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.N only 0.000 apart, marking (T0328)H266.CD2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.N only 0.000 apart, marking (T0328)H266.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.N only 0.000 apart, marking (T0328)H266.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.N only 0.000 apart, marking (T0328)H266.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.N only 0.000 apart, marking (T0328)H266.N as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.N only 0.000 apart, marking (T0328)D265.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.N only 0.000 apart, marking (T0328)D265.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.N only 0.000 apart, marking (T0328)D265.OD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.N only 0.000 apart, marking (T0328)D265.OD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.N only 0.000 apart, marking (T0328)D265.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.N only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.N only 0.000 apart, marking (T0328)D265.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.N only 0.000 apart, marking (T0328)D265.N as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.N only 0.000 apart, marking (T0328)P264.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.N only 0.000 apart, marking (T0328)P264.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.N only 0.000 apart, marking (T0328)P264.CD as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.N only 0.000 apart, marking (T0328)P264.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.N only 0.000 apart, marking (T0328)P264.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.N only 0.000 apart, marking (T0328)P264.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.N only 0.000 apart, marking (T0328)P264.N as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.N only 0.000 apart, marking (T0328)T263.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.N only 0.000 apart, marking (T0328)T263.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.N only 0.000 apart, marking (T0328)T263.OG1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.N only 0.000 apart, marking (T0328)T263.CG2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.N only 0.000 apart, marking (T0328)T263.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.N only 0.000 apart, marking (T0328)T263.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.N only 0.000 apart, marking (T0328)T263.N as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.N only 0.000 apart, marking (T0328)R262.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.N only 0.000 apart, marking (T0328)R262.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.N only 0.000 apart, marking (T0328)R262.NH2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.N only 0.000 apart, marking (T0328)R262.NH1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.N only 0.000 apart, marking (T0328)R262.CZ as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.N only 0.000 apart, marking (T0328)R262.NE as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.N only 0.000 apart, marking (T0328)R262.CD as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.N only 0.000 apart, marking (T0328)R262.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.N only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.N only 0.000 apart, marking (T0328)R262.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.N only 0.000 apart, marking (T0328)R262.N as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.N only 0.000 apart, marking (T0328)C261.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.N only 0.000 apart, marking (T0328)C261.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.N only 0.000 apart, marking (T0328)C261.SG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.N only 0.000 apart, marking (T0328)C261.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.N only 0.000 apart, marking (T0328)C261.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.N only 0.000 apart, marking (T0328)C261.N as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.N only 0.000 apart, marking (T0328)T260.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.N only 0.000 apart, marking (T0328)T260.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.N only 0.000 apart, marking (T0328)T260.OG1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.N only 0.000 apart, marking (T0328)T260.CG2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.N only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.N only 0.000 apart, marking (T0328)T260.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.N only 0.000 apart, marking (T0328)T260.N as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.N only 0.000 apart, marking (T0328)S259.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.N only 0.000 apart, marking (T0328)S259.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.N only 0.000 apart, marking (T0328)S259.OG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.N only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.N only 0.000 apart, marking (T0328)S259.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.N only 0.000 apart, marking (T0328)S259.N as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.N only 0.000 apart, marking (T0328)L271.N as missing WARNING: atoms too close: (T0328)L271.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.CA only 0.000 apart, marking (T0328)L271.CA as missing WARNING: atoms too close: (T0328)L271.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)L271.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)L271.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)L271.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)L271.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.CG only 0.000 apart, marking (T0328)L271.CG as missing WARNING: atoms too close: (T0328)L271.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)L271.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)L271.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)L271.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.CD1 only 0.000 apart, marking (T0328)L271.CD1 as missing WARNING: atoms too close: (T0328)L271.CD1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)L271.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)L271.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)L271.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)L271.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.CD2 only 0.000 apart, marking (T0328)L271.CD2 as missing WARNING: atoms too close: (T0328)L271.CD2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)L271.CD1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)L271.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)L271.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)L271.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)L271.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.O only 0.000 apart, marking (T0328)L271.O as missing WARNING: atoms too close: (T0328)L271.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)L271.CD2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)L271.CD1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)L271.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)L271.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)L271.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)L271.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.CE and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.SD and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)M270.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.NZ and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.CE and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.CD and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)K269.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.OE2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.OE1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.CD and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)E268.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CZ and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CE2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CE1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CD2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CD1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)F267.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.NE2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.CE1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.ND1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.CD2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)H266.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.OD2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.OD1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)D265.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)P264.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)P264.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)P264.CD and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)P264.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)P264.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)P264.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)P264.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T263.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T263.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T263.OG1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T263.CG2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T263.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T263.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T263.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.NH2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.NH1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.CZ and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.NE and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.CD and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.CG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)R262.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)C261.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)C261.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)C261.SG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)C261.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)C261.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)C261.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T260.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T260.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T260.OG1 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T260.CG2 and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T260.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)T260.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)S259.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)S259.O and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)S259.OG and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)S259.CB and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)S259.N and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing WARNING: atoms too close: (T0328)I258.C and (T0328)L271.C only 0.000 apart, marking (T0328)L271.C as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)N282.C and (T0328)H283.N only 0.000 apart, marking (T0328)H283.N as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CA only 0.000 apart, marking (T0328)H283.CA as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CA only 0.000 apart, marking (T0328)H283.CA as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CB only 0.000 apart, marking (T0328)H283.CB as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CB only 0.000 apart, marking (T0328)H283.CB as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CB only 0.000 apart, marking (T0328)H283.CB as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CG only 0.000 apart, marking (T0328)H283.CG as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CD2 only 0.000 apart, marking (T0328)H283.CD2 as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.ND1 only 0.000 apart, marking (T0328)H283.ND1 as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.CE1 only 0.000 apart, marking (T0328)H283.CE1 as missing WARNING: atoms too close: (T0328)H283.CE1 and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.NE2 only 0.000 apart, marking (T0328)H283.NE2 as missing WARNING: atoms too close: (T0328)H283.NE2 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CE1 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.O only 0.000 apart, marking (T0328)H283.O as missing WARNING: atoms too close: (T0328)H283.O and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.NE2 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CE1 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.ND1 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CD2 and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CG and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CB and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)H283.N and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing WARNING: atoms too close: (T0328)N282.C and (T0328)H283.C only 0.000 apart, marking (T0328)H283.C as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 280 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 301 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 304 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 76 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 268 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 289 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 Skipped atom 7, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 20, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 49, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 58, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 95, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 128, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 189, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 218, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 219, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 312, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 313, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 326, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 411, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 460, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 461, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 466, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 507, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 592, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 605, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 746, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 771, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 784, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 789, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 829, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 831, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 833, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 835, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 854, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 979, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 992, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1057, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1066, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1091, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1128, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 Skipped atom 7, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 20, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 49, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 58, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 95, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 128, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 189, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 218, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 219, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 312, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 313, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 326, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 411, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 460, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 461, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 466, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 507, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 592, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 605, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 746, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 771, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 784, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 789, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 829, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 831, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 833, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 835, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 854, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 979, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 992, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1057, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1066, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1091, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1128, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 296 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # Found a chain break before 288 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 Skipped atom 19, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 32, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 61, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 70, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 107, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 148, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 201, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 226, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 227, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 316, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 317, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 330, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 415, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 460, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 461, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 466, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 507, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 588, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 601, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 762, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 775, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 780, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 820, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 822, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 824, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 826, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 845, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 966, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 983, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 1048, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 1073, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz Skipped atom 1110, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL1.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 307 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 309 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 296 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 306 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/Frankenstein_TS1.pdb.gz looking for model 1 # Found a chain break before 110 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS1 # ReadConformPDB reading from PDB file servers/Frankenstein_TS2.pdb.gz looking for model 1 # Found a chain break before 282 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS2 # ReadConformPDB reading from PDB file servers/Frankenstein_TS3.pdb.gz looking for model 1 # Found a chain break before 259 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS3 # ReadConformPDB reading from PDB file servers/Frankenstein_TS4.pdb.gz looking for model 1 # Found a chain break before 229 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # Found a chain break before 301 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # Found a chain break before 301 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS2.pdb.gz looking for model 1 # Found a chain break before 299 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS3.pdb.gz looking for model 1 # Found a chain break before 205 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS4.pdb.gz looking for model 1 # Found a chain break before 277 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server2_TS5.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server2_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 299 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 244 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 303 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 185 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 302 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 306 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 305 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 300 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 301 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS1.pdb.gz looking for model 1 # Found a chain break before 304 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS2.pdb.gz looking for model 1 WARNING: atom 1 has residue number 17 < previous residue 306 in servers/POMYSL_TS2.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation POMYSL_TS2 # ReadConformPDB reading from PDB file servers/POMYSL_TS3.pdb.gz looking for model 1 # Found a chain break before 303 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS3 # ReadConformPDB reading from PDB file servers/POMYSL_TS4.pdb.gz looking for model 1 # Found a chain break before 307 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS4 # ReadConformPDB reading from PDB file servers/POMYSL_TS5.pdb.gz looking for model 1 # Found a chain break before 302 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # Found a chain break before 269 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # Found a chain break before 289 # copying to AlignedFragments data structure # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 245 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 243 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 300 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 251 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 300 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 280 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 300 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 245 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 300 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)I3.CA and (T0328)I3.CB only 0.000 apart, marking (T0328)I3.CB as missing WARNING: atoms too close: (T0328)Q4.CA and (T0328)Q4.CB only 0.000 apart, marking (T0328)Q4.CB as missing WARNING: atoms too close: (T0328)R8.CA and (T0328)R8.CB only 0.000 apart, marking (T0328)R8.CB as missing WARNING: atoms too close: (T0328)L19.CA and (T0328)L19.CB only 0.000 apart, marking (T0328)L19.CB as missing WARNING: atoms too close: (T0328)M25.CA and (T0328)M25.CB only 0.000 apart, marking (T0328)M25.CB as missing WARNING: atoms too close: (T0328)F26.CA and (T0328)F26.CB only 0.000 apart, marking (T0328)F26.CB as missing WARNING: atoms too close: (T0328)N27.CA and (T0328)N27.CB only 0.000 apart, marking (T0328)N27.CB as missing WARNING: atoms too close: (T0328)N31.CA and (T0328)N31.CB only 0.000 apart, marking (T0328)N31.CB as missing WARNING: atoms too close: (T0328)Y54.CA and (T0328)Y54.CB only 0.000 apart, marking (T0328)Y54.CB as missing WARNING: atoms too close: (T0328)F59.CA and (T0328)F59.CB only 0.000 apart, marking (T0328)F59.CB as missing WARNING: atoms too close: (T0328)V63.CA and (T0328)V63.CB only 0.000 apart, marking (T0328)V63.CB as missing WARNING: atoms too close: (T0328)A64.CA and (T0328)A64.CB only 0.000 apart, marking (T0328)A64.CB as missing WARNING: atoms too close: (T0328)N68.CA and (T0328)N68.CB only 0.000 apart, marking (T0328)N68.CB as missing WARNING: atoms too close: (T0328)W70.CA and (T0328)W70.CB only 0.000 apart, marking (T0328)W70.CB as missing WARNING: atoms too close: (T0328)L73.CA and (T0328)L73.CB only 0.000 apart, marking (T0328)L73.CB as missing WARNING: atoms too close: (T0328)E80.CA and (T0328)E80.CB only 0.000 apart, marking (T0328)E80.CB as missing WARNING: atoms too close: (T0328)P86.CA and (T0328)P86.CB only 0.000 apart, marking (T0328)P86.CB as missing WARNING: atoms too close: (T0328)E90.CA and (T0328)E90.CB only 0.000 apart, marking (T0328)E90.CB as missing WARNING: atoms too close: (T0328)N92.CA and (T0328)N92.CB only 0.000 apart, marking (T0328)N92.CB as missing WARNING: atoms too close: (T0328)F103.CA and (T0328)F103.CB only 0.000 apart, marking (T0328)F103.CB as missing WARNING: atoms too close: (T0328)V104.CA and (T0328)V104.CB only 0.000 apart, marking (T0328)V104.CB as missing WARNING: atoms too close: (T0328)R107.CA and (T0328)R107.CB only 0.000 apart, marking (T0328)R107.CB as missing WARNING: atoms too close: (T0328)H115.CA and (T0328)H115.CB only 0.000 apart, marking (T0328)H115.CB as missing WARNING: atoms too close: (T0328)E120.CA and (T0328)E120.CB only 0.000 apart, marking (T0328)E120.CB as missing WARNING: atoms too close: (T0328)E133.CA and (T0328)E133.CB only 0.000 apart, marking (T0328)E133.CB as missing WARNING: atoms too close: (T0328)R139.CA and (T0328)R139.CB only 0.000 apart, marking (T0328)R139.CB as missing WARNING: atoms too close: (T0328)P156.CA and (T0328)P156.CB only 0.000 apart, marking (T0328)P156.CB as missing WARNING: atoms too close: (T0328)Q162.CA and (T0328)Q162.CB only 0.000 apart, marking (T0328)Q162.CB as missing WARNING: atoms too close: (T0328)A165.CA and (T0328)A165.CB only 0.000 apart, marking (T0328)A165.CB as missing WARNING: atoms too close: (T0328)V167.CA and (T0328)V167.CB only 0.000 apart, marking (T0328)V167.CB as missing WARNING: atoms too close: (T0328)E170.CA and (T0328)E170.CB only 0.000 apart, marking (T0328)E170.CB as missing WARNING: atoms too close: (T0328)D171.CA and (T0328)D171.CB only 0.000 apart, marking (T0328)D171.CB as missing WARNING: atoms too close: (T0328)E173.CA and (T0328)E173.CB only 0.000 apart, marking (T0328)E173.CB as missing WARNING: atoms too close: (T0328)F174.CA and (T0328)F174.CB only 0.000 apart, marking (T0328)F174.CB as missing WARNING: atoms too close: (T0328)H181.CA and (T0328)H181.CB only 0.000 apart, marking (T0328)H181.CB as missing WARNING: atoms too close: (T0328)V182.CA and (T0328)V182.CB only 0.000 apart, marking (T0328)V182.CB as missing WARNING: atoms too close: (T0328)Q183.CA and (T0328)Q183.CB only 0.000 apart, marking (T0328)Q183.CB as missing WARNING: atoms too close: (T0328)L197.CA and (T0328)L197.CB only 0.000 apart, marking (T0328)L197.CB as missing WARNING: atoms too close: (T0328)E201.CA and (T0328)E201.CB only 0.000 apart, marking (T0328)E201.CB as missing WARNING: atoms too close: (T0328)K208.CA and (T0328)K208.CB only 0.000 apart, marking (T0328)K208.CB as missing WARNING: atoms too close: (T0328)S223.CA and (T0328)S223.CB only 0.000 apart, marking (T0328)S223.CB as missing WARNING: atoms too close: (T0328)H224.CA and (T0328)H224.CB only 0.000 apart, marking (T0328)H224.CB as missing WARNING: atoms too close: (T0328)I225.CA and (T0328)I225.CB only 0.000 apart, marking (T0328)I225.CB as missing WARNING: atoms too close: (T0328)K226.CA and (T0328)K226.CB only 0.000 apart, marking (T0328)K226.CB as missing WARNING: atoms too close: (T0328)I240.CA and (T0328)I240.CB only 0.000 apart, marking (T0328)I240.CB as missing WARNING: atoms too close: (T0328)P246.CA and (T0328)P246.CB only 0.000 apart, marking (T0328)P246.CB as missing WARNING: atoms too close: (T0328)L250.CA and (T0328)L250.CB only 0.000 apart, marking (T0328)L250.CB as missing WARNING: atoms too close: (T0328)L255.CA and (T0328)L255.CB only 0.000 apart, marking (T0328)L255.CB as missing WARNING: atoms too close: (T0328)D265.CA and (T0328)D265.CB only 0.000 apart, marking (T0328)D265.CB as missing WARNING: atoms too close: (T0328)F276.CA and (T0328)F276.CB only 0.000 apart, marking (T0328)F276.CB as missing WARNING: atoms too close: (T0328)A280.CA and (T0328)A280.CB only 0.000 apart, marking (T0328)A280.CB as missing WARNING: atoms too close: (T0328)S291.CA and (T0328)S291.CB only 0.000 apart, marking (T0328)S291.CB as missing WARNING: atoms too close: (T0328)F298.CA and (T0328)F298.CB only 0.000 apart, marking (T0328)F298.CB as missing WARNING: atoms too close: (T0328)S302.CA and (T0328)S302.CB only 0.000 apart, marking (T0328)S302.CB as missing WARNING: atoms too close: (T0328)M307.CA and (T0328)M307.CB only 0.000 apart, marking (T0328)M307.CB as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)M1.CA and (T0328)M1.CB only 0.000 apart, marking (T0328)M1.CB as missing WARNING: atoms too close: (T0328)Q4.CA and (T0328)Q4.CB only 0.000 apart, marking (T0328)Q4.CB as missing WARNING: atoms too close: (T0328)R8.CA and (T0328)R8.CB only 0.000 apart, marking (T0328)R8.CB as missing WARNING: atoms too close: (T0328)L11.CA and (T0328)L11.CB only 0.000 apart, marking (T0328)L11.CB as missing WARNING: atoms too close: (T0328)V13.CA and (T0328)V13.CB only 0.000 apart, marking (T0328)V13.CB as missing WARNING: atoms too close: (T0328)C14.CA and (T0328)C14.CB only 0.000 apart, marking (T0328)C14.CB as missing WARNING: atoms too close: (T0328)N18.CA and (T0328)N18.CB only 0.000 apart, marking (T0328)N18.CB as missing WARNING: atoms too close: (T0328)N29.CA and (T0328)N29.CB only 0.000 apart, marking (T0328)N29.CB as missing WARNING: atoms too close: (T0328)N31.CA and (T0328)N31.CB only 0.000 apart, marking (T0328)N31.CB as missing WARNING: atoms too close: (T0328)S34.CA and (T0328)S34.CB only 0.000 apart, marking (T0328)S34.CB as missing WARNING: atoms too close: (T0328)L36.CA and (T0328)L36.CB only 0.000 apart, marking (T0328)L36.CB as missing WARNING: atoms too close: (T0328)V43.CA and (T0328)V43.CB only 0.000 apart, marking (T0328)V43.CB as missing WARNING: atoms too close: (T0328)Y54.CA and (T0328)Y54.CB only 0.000 apart, marking (T0328)Y54.CB as missing WARNING: atoms too close: (T0328)D71.CA and (T0328)D71.CB only 0.000 apart, marking (T0328)D71.CB as missing WARNING: atoms too close: (T0328)S77.CA and (T0328)S77.CB only 0.000 apart, marking (T0328)S77.CB as missing WARNING: atoms too close: (T0328)R78.CA and (T0328)R78.CB only 0.000 apart, marking (T0328)R78.CB as missing WARNING: atoms too close: (T0328)P79.CA and (T0328)P79.CB only 0.000 apart, marking (T0328)P79.CB as missing WARNING: atoms too close: (T0328)P84.CA and (T0328)P84.CB only 0.000 apart, marking (T0328)P84.CB as missing WARNING: atoms too close: (T0328)P86.CA and (T0328)P86.CB only 0.000 apart, marking (T0328)P86.CB as missing WARNING: atoms too close: (T0328)R93.CA and (T0328)R93.CB only 0.000 apart, marking (T0328)R93.CB as missing WARNING: atoms too close: (T0328)F103.CA and (T0328)F103.CB only 0.000 apart, marking (T0328)F103.CB as missing WARNING: atoms too close: (T0328)D112.CA and (T0328)D112.CB only 0.000 apart, marking (T0328)D112.CB as missing WARNING: atoms too close: (T0328)F125.CA and (T0328)F125.CB only 0.000 apart, marking (T0328)F125.CB as missing WARNING: atoms too close: (T0328)R139.CA and (T0328)R139.CB only 0.000 apart, marking (T0328)R139.CB as missing WARNING: atoms too close: (T0328)H181.CA and (T0328)H181.CB only 0.000 apart, marking (T0328)H181.CB as missing WARNING: atoms too close: (T0328)H187.CA and (T0328)H187.CB only 0.000 apart, marking (T0328)H187.CB as missing WARNING: atoms too close: (T0328)L197.CA and (T0328)L197.CB only 0.000 apart, marking (T0328)L197.CB as missing WARNING: atoms too close: (T0328)D202.CA and (T0328)D202.CB only 0.000 apart, marking (T0328)D202.CB as missing WARNING: atoms too close: (T0328)E213.CA and (T0328)E213.CB only 0.000 apart, marking (T0328)E213.CB as missing WARNING: atoms too close: (T0328)N229.CA and (T0328)N229.CB only 0.000 apart, marking (T0328)N229.CB as missing WARNING: atoms too close: (T0328)D232.CA and (T0328)D232.CB only 0.000 apart, marking (T0328)D232.CB as missing WARNING: atoms too close: (T0328)N234.CA and (T0328)N234.CB only 0.000 apart, marking (T0328)N234.CB as missing WARNING: atoms too close: (T0328)E239.CA and (T0328)E239.CB only 0.000 apart, marking (T0328)E239.CB as missing WARNING: atoms too close: (T0328)L241.CA and (T0328)L241.CB only 0.000 apart, marking (T0328)L241.CB as missing WARNING: atoms too close: (T0328)R242.CA and (T0328)R242.CB only 0.000 apart, marking (T0328)R242.CB as missing WARNING: atoms too close: (T0328)Y247.CA and (T0328)Y247.CB only 0.000 apart, marking (T0328)Y247.CB as missing WARNING: atoms too close: (T0328)R262.CA and (T0328)R262.CB only 0.000 apart, marking (T0328)R262.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)D278.CA and (T0328)D278.CB only 0.000 apart, marking (T0328)D278.CB as missing WARNING: atoms too close: (T0328)A280.CA and (T0328)A280.CB only 0.000 apart, marking (T0328)A280.CB as missing WARNING: atoms too close: (T0328)N282.CA and (T0328)N282.CB only 0.000 apart, marking (T0328)N282.CB as missing WARNING: atoms too close: (T0328)S296.CA and (T0328)S296.CB only 0.000 apart, marking (T0328)S296.CB as missing WARNING: atoms too close: (T0328)F299.CA and (T0328)F299.CB only 0.000 apart, marking (T0328)F299.CB as missing WARNING: atoms too close: (T0328)F305.CA and (T0328)F305.CB only 0.000 apart, marking (T0328)F305.CB as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)N5.CA and (T0328)N5.CB only 0.000 apart, marking (T0328)N5.CB as missing WARNING: atoms too close: (T0328)S21.CA and (T0328)S21.CB only 0.000 apart, marking (T0328)S21.CB as missing WARNING: atoms too close: (T0328)S34.CA and (T0328)S34.CB only 0.000 apart, marking (T0328)S34.CB as missing WARNING: atoms too close: (T0328)L36.CA and (T0328)L36.CB only 0.000 apart, marking (T0328)L36.CB as missing WARNING: atoms too close: (T0328)Q45.CA and (T0328)Q45.CB only 0.000 apart, marking (T0328)Q45.CB as missing WARNING: atoms too close: (T0328)Y54.CA and (T0328)Y54.CB only 0.000 apart, marking (T0328)Y54.CB as missing WARNING: atoms too close: (T0328)F59.CA and (T0328)F59.CB only 0.000 apart, marking (T0328)F59.CB as missing WARNING: atoms too close: (T0328)N68.CA and (T0328)N68.CB only 0.000 apart, marking (T0328)N68.CB as missing WARNING: atoms too close: (T0328)D112.CA and (T0328)D112.CB only 0.000 apart, marking (T0328)D112.CB as missing WARNING: atoms too close: (T0328)Q123.CA and (T0328)Q123.CB only 0.000 apart, marking (T0328)Q123.CB as missing WARNING: atoms too close: (T0328)R136.CA and (T0328)R136.CB only 0.000 apart, marking (T0328)R136.CB as missing WARNING: atoms too close: (T0328)F138.CA and (T0328)F138.CB only 0.000 apart, marking (T0328)F138.CB as missing WARNING: atoms too close: (T0328)D145.CA and (T0328)D145.CB only 0.000 apart, marking (T0328)D145.CB as missing WARNING: atoms too close: (T0328)F149.CA and (T0328)F149.CB only 0.000 apart, marking (T0328)F149.CB as missing WARNING: atoms too close: (T0328)H160.CA and (T0328)H160.CB only 0.000 apart, marking (T0328)H160.CB as missing WARNING: atoms too close: (T0328)V182.CA and (T0328)V182.CB only 0.000 apart, marking (T0328)V182.CB as missing WARNING: atoms too close: (T0328)Q183.CA and (T0328)Q183.CB only 0.000 apart, marking (T0328)Q183.CB as missing WARNING: atoms too close: (T0328)K184.CA and (T0328)K184.CB only 0.000 apart, marking (T0328)K184.CB as missing WARNING: atoms too close: (T0328)S190.CA and (T0328)S190.CB only 0.000 apart, marking (T0328)S190.CB as missing WARNING: atoms too close: (T0328)W192.CA and (T0328)W192.CB only 0.000 apart, marking (T0328)W192.CB as missing WARNING: atoms too close: (T0328)R194.CA and (T0328)R194.CB only 0.000 apart, marking (T0328)R194.CB as missing WARNING: atoms too close: (T0328)Q200.CA and (T0328)Q200.CB only 0.000 apart, marking (T0328)Q200.CB as missing WARNING: atoms too close: (T0328)I203.CA and (T0328)I203.CB only 0.000 apart, marking (T0328)I203.CB as missing WARNING: atoms too close: (T0328)K208.CA and (T0328)K208.CB only 0.000 apart, marking (T0328)K208.CB as missing WARNING: atoms too close: (T0328)N211.CA and (T0328)N211.CB only 0.000 apart, marking (T0328)N211.CB as missing WARNING: atoms too close: (T0328)D218.CA and (T0328)D218.CB only 0.000 apart, marking (T0328)D218.CB as missing WARNING: atoms too close: (T0328)S223.CA and (T0328)S223.CB only 0.000 apart, marking (T0328)S223.CB as missing WARNING: atoms too close: (T0328)R227.CA and (T0328)R227.CB only 0.000 apart, marking (T0328)R227.CB as missing WARNING: atoms too close: (T0328)K231.CA and (T0328)K231.CB only 0.000 apart, marking (T0328)K231.CB as missing WARNING: atoms too close: (T0328)E233.CA and (T0328)E233.CB only 0.000 apart, marking (T0328)E233.CB as missing WARNING: atoms too close: (T0328)P246.CA and (T0328)P246.CB only 0.000 apart, marking (T0328)P246.CB as missing WARNING: atoms too close: (T0328)Y247.CA and (T0328)Y247.CB only 0.000 apart, marking (T0328)Y247.CB as missing WARNING: atoms too close: (T0328)Q253.CA and (T0328)Q253.CB only 0.000 apart, marking (T0328)Q253.CB as missing WARNING: atoms too close: (T0328)F257.CA and (T0328)F257.CB only 0.000 apart, marking (T0328)F257.CB as missing WARNING: atoms too close: (T0328)T260.CA and (T0328)T260.CB only 0.000 apart, marking (T0328)T260.CB as missing WARNING: atoms too close: (T0328)D278.CA and (T0328)D278.CB only 0.000 apart, marking (T0328)D278.CB as missing WARNING: atoms too close: (T0328)H288.CA and (T0328)H288.CB only 0.000 apart, marking (T0328)H288.CB as missing WARNING: atoms too close: (T0328)F289.CA and (T0328)F289.CB only 0.000 apart, marking (T0328)F289.CB as missing WARNING: atoms too close: (T0328)L303.CA and (T0328)L303.CB only 0.000 apart, marking (T0328)L303.CB as missing WARNING: atoms too close: (T0328)M307.CA and (T0328)M307.CB only 0.000 apart, marking (T0328)M307.CB as missing WARNING: atoms too close: (T0328)Q308.CA and (T0328)Q308.CB only 0.000 apart, marking (T0328)Q308.CB as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)Q4.CA and (T0328)Q4.CB only 0.000 apart, marking (T0328)Q4.CB as missing WARNING: atoms too close: (T0328)L11.CA and (T0328)L11.CB only 0.000 apart, marking (T0328)L11.CB as missing WARNING: atoms too close: (T0328)N18.CA and (T0328)N18.CB only 0.000 apart, marking (T0328)N18.CB as missing WARNING: atoms too close: (T0328)N27.CA and (T0328)N27.CB only 0.000 apart, marking (T0328)N27.CB as missing WARNING: atoms too close: (T0328)S34.CA and (T0328)S34.CB only 0.000 apart, marking (T0328)S34.CB as missing WARNING: atoms too close: (T0328)L36.CA and (T0328)L36.CB only 0.000 apart, marking (T0328)L36.CB as missing WARNING: atoms too close: (T0328)T51.CA and (T0328)T51.CB only 0.000 apart, marking (T0328)T51.CB as missing WARNING: atoms too close: (T0328)Y54.CA and (T0328)Y54.CB only 0.000 apart, marking (T0328)Y54.CB as missing WARNING: atoms too close: (T0328)F59.CA and (T0328)F59.CB only 0.000 apart, marking (T0328)F59.CB as missing WARNING: atoms too close: (T0328)N68.CA and (T0328)N68.CB only 0.000 apart, marking (T0328)N68.CB as missing WARNING: atoms too close: (T0328)S77.CA and (T0328)S77.CB only 0.000 apart, marking (T0328)S77.CB as missing WARNING: atoms too close: (T0328)P84.CA and (T0328)P84.CB only 0.000 apart, marking (T0328)P84.CB as missing WARNING: atoms too close: (T0328)P86.CA and (T0328)P86.CB only 0.000 apart, marking (T0328)P86.CB as missing WARNING: atoms too close: (T0328)R93.CA and (T0328)R93.CB only 0.000 apart, marking (T0328)R93.CB as missing WARNING: atoms too close: (T0328)N119.CA and (T0328)N119.CB only 0.000 apart, marking (T0328)N119.CB as missing WARNING: atoms too close: (T0328)E120.CA and (T0328)E120.CB only 0.000 apart, marking (T0328)E120.CB as missing WARNING: atoms too close: (T0328)Q123.CA and (T0328)Q123.CB only 0.000 apart, marking (T0328)Q123.CB as missing WARNING: atoms too close: (T0328)F125.CA and (T0328)F125.CB only 0.000 apart, marking (T0328)F125.CB as missing WARNING: atoms too close: (T0328)L128.CA and (T0328)L128.CB only 0.000 apart, marking (T0328)L128.CB as missing WARNING: atoms too close: (T0328)E130.CA and (T0328)E130.CB only 0.000 apart, marking (T0328)E130.CB as missing WARNING: atoms too close: (T0328)R139.CA and (T0328)R139.CB only 0.000 apart, marking (T0328)R139.CB as missing WARNING: atoms too close: (T0328)F140.CA and (T0328)F140.CB only 0.000 apart, marking (T0328)F140.CB as missing WARNING: atoms too close: (T0328)L166.CA and (T0328)L166.CB only 0.000 apart, marking (T0328)L166.CB as missing WARNING: atoms too close: (T0328)V167.CA and (T0328)V167.CB only 0.000 apart, marking (T0328)V167.CB as missing WARNING: atoms too close: (T0328)S169.CA and (T0328)S169.CB only 0.000 apart, marking (T0328)S169.CB as missing WARNING: atoms too close: (T0328)E170.CA and (T0328)E170.CB only 0.000 apart, marking (T0328)E170.CB as missing WARNING: atoms too close: (T0328)I180.CA and (T0328)I180.CB only 0.000 apart, marking (T0328)I180.CB as missing WARNING: atoms too close: (T0328)L197.CA and (T0328)L197.CB only 0.000 apart, marking (T0328)L197.CB as missing WARNING: atoms too close: (T0328)D202.CA and (T0328)D202.CB only 0.000 apart, marking (T0328)D202.CB as missing WARNING: atoms too close: (T0328)Y214.CA and (T0328)Y214.CB only 0.000 apart, marking (T0328)Y214.CB as missing WARNING: atoms too close: (T0328)T222.CA and (T0328)T222.CB only 0.000 apart, marking (T0328)T222.CB as missing WARNING: atoms too close: (T0328)N229.CA and (T0328)N229.CB only 0.000 apart, marking (T0328)N229.CB as missing WARNING: atoms too close: (T0328)K231.CA and (T0328)K231.CB only 0.000 apart, marking (T0328)K231.CB as missing WARNING: atoms too close: (T0328)N234.CA and (T0328)N234.CB only 0.000 apart, marking (T0328)N234.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)M270.CA and (T0328)M270.CB only 0.000 apart, marking (T0328)M270.CB as missing WARNING: atoms too close: (T0328)L271.CA and (T0328)L271.CB only 0.000 apart, marking (T0328)L271.CB as missing WARNING: atoms too close: (T0328)D278.CA and (T0328)D278.CB only 0.000 apart, marking (T0328)D278.CB as missing WARNING: atoms too close: (T0328)A280.CA and (T0328)A280.CB only 0.000 apart, marking (T0328)A280.CB as missing WARNING: atoms too close: (T0328)H283.CA and (T0328)H283.CB only 0.000 apart, marking (T0328)H283.CB as missing WARNING: atoms too close: (T0328)T294.CA and (T0328)T294.CB only 0.000 apart, marking (T0328)T294.CB as missing WARNING: atoms too close: (T0328)S296.CA and (T0328)S296.CB only 0.000 apart, marking (T0328)S296.CB as missing WARNING: atoms too close: (T0328)F309.CA and (T0328)F309.CB only 0.000 apart, marking (T0328)F309.CB as missing WARNING: atoms too close: (T0328)D310.CA and (T0328)D310.CB only 0.000 apart, marking (T0328)D310.CB as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)D2.CA and (T0328)D2.CB only 0.000 apart, marking (T0328)D2.CB as missing WARNING: atoms too close: (T0328)N18.CA and (T0328)N18.CB only 0.000 apart, marking (T0328)N18.CB as missing WARNING: atoms too close: (T0328)F26.CA and (T0328)F26.CB only 0.000 apart, marking (T0328)F26.CB as missing WARNING: atoms too close: (T0328)N27.CA and (T0328)N27.CB only 0.000 apart, marking (T0328)N27.CB as missing WARNING: atoms too close: (T0328)L36.CA and (T0328)L36.CB only 0.000 apart, marking (T0328)L36.CB as missing WARNING: atoms too close: (T0328)N42.CA and (T0328)N42.CB only 0.000 apart, marking (T0328)N42.CB as missing WARNING: atoms too close: (T0328)Y46.CA and (T0328)Y46.CB only 0.000 apart, marking (T0328)Y46.CB as missing WARNING: atoms too close: (T0328)D52.CA and (T0328)D52.CB only 0.000 apart, marking (T0328)D52.CB as missing WARNING: atoms too close: (T0328)Y54.CA and (T0328)Y54.CB only 0.000 apart, marking (T0328)Y54.CB as missing WARNING: atoms too close: (T0328)A58.CA and (T0328)A58.CB only 0.000 apart, marking (T0328)A58.CB as missing WARNING: atoms too close: (T0328)A64.CA and (T0328)A64.CB only 0.000 apart, marking (T0328)A64.CB as missing WARNING: atoms too close: (T0328)W70.CA and (T0328)W70.CB only 0.000 apart, marking (T0328)W70.CB as missing WARNING: atoms too close: (T0328)P79.CA and (T0328)P79.CB only 0.000 apart, marking (T0328)P79.CB as missing WARNING: atoms too close: (T0328)P84.CA and (T0328)P84.CB only 0.000 apart, marking (T0328)P84.CB as missing WARNING: atoms too close: (T0328)F85.CA and (T0328)F85.CB only 0.000 apart, marking (T0328)F85.CB as missing WARNING: atoms too close: (T0328)Q89.CA and (T0328)Q89.CB only 0.000 apart, marking (T0328)Q89.CB as missing WARNING: atoms too close: (T0328)R93.CA and (T0328)R93.CB only 0.000 apart, marking (T0328)R93.CB as missing WARNING: atoms too close: (T0328)R107.CA and (T0328)R107.CB only 0.000 apart, marking (T0328)R107.CB as missing WARNING: atoms too close: (T0328)Y111.CA and (T0328)Y111.CB only 0.000 apart, marking (T0328)Y111.CB as missing WARNING: atoms too close: (T0328)L114.CA and (T0328)L114.CB only 0.000 apart, marking (T0328)L114.CB as missing WARNING: atoms too close: (T0328)A118.CA and (T0328)A118.CB only 0.000 apart, marking (T0328)A118.CB as missing WARNING: atoms too close: (T0328)I121.CA and (T0328)I121.CB only 0.000 apart, marking (T0328)I121.CB as missing WARNING: atoms too close: (T0328)V129.CA and (T0328)V129.CB only 0.000 apart, marking (T0328)V129.CB as missing WARNING: atoms too close: (T0328)Q162.CA and (T0328)Q162.CB only 0.000 apart, marking (T0328)Q162.CB as missing WARNING: atoms too close: (T0328)F174.CA and (T0328)F174.CB only 0.000 apart, marking (T0328)F174.CB as missing WARNING: atoms too close: (T0328)V182.CA and (T0328)V182.CB only 0.000 apart, marking (T0328)V182.CB as missing WARNING: atoms too close: (T0328)K184.CA and (T0328)K184.CB only 0.000 apart, marking (T0328)K184.CB as missing WARNING: atoms too close: (T0328)A186.CA and (T0328)A186.CB only 0.000 apart, marking (T0328)A186.CB as missing WARNING: atoms too close: (T0328)L197.CA and (T0328)L197.CB only 0.000 apart, marking (T0328)L197.CB as missing WARNING: atoms too close: (T0328)K199.CA and (T0328)K199.CB only 0.000 apart, marking (T0328)K199.CB as missing WARNING: atoms too close: (T0328)I203.CA and (T0328)I203.CB only 0.000 apart, marking (T0328)I203.CB as missing WARNING: atoms too close: (T0328)Q209.CA and (T0328)Q209.CB only 0.000 apart, marking (T0328)Q209.CB as missing WARNING: atoms too close: (T0328)Y214.CA and (T0328)Y214.CB only 0.000 apart, marking (T0328)Y214.CB as missing WARNING: atoms too close: (T0328)I225.CA and (T0328)I225.CB only 0.000 apart, marking (T0328)I225.CB as missing WARNING: atoms too close: (T0328)E233.CA and (T0328)E233.CB only 0.000 apart, marking (T0328)E233.CB as missing WARNING: atoms too close: (T0328)L241.CA and (T0328)L241.CB only 0.000 apart, marking (T0328)L241.CB as missing WARNING: atoms too close: (T0328)P246.CA and (T0328)P246.CB only 0.000 apart, marking (T0328)P246.CB as missing WARNING: atoms too close: (T0328)Y247.CA and (T0328)Y247.CB only 0.000 apart, marking (T0328)Y247.CB as missing WARNING: atoms too close: (T0328)Q253.CA and (T0328)Q253.CB only 0.000 apart, marking (T0328)Q253.CB as missing WARNING: atoms too close: (T0328)M256.CA and (T0328)M256.CB only 0.000 apart, marking (T0328)M256.CB as missing WARNING: atoms too close: (T0328)F257.CA and (T0328)F257.CB only 0.000 apart, marking (T0328)F257.CB as missing WARNING: atoms too close: (T0328)S259.CA and (T0328)S259.CB only 0.000 apart, marking (T0328)S259.CB as missing WARNING: atoms too close: (T0328)F267.CA and (T0328)F267.CB only 0.000 apart, marking (T0328)F267.CB as missing WARNING: atoms too close: (T0328)E268.CA and (T0328)E268.CB only 0.000 apart, marking (T0328)E268.CB as missing WARNING: atoms too close: (T0328)F289.CA and (T0328)F289.CB only 0.000 apart, marking (T0328)F289.CB as missing WARNING: atoms too close: (T0328)S296.CA and (T0328)S296.CB only 0.000 apart, marking (T0328)S296.CB as missing WARNING: atoms too close: (T0328)S297.CA and (T0328)S297.CB only 0.000 apart, marking (T0328)S297.CB as missing WARNING: atoms too close: (T0328)F305.CA and (T0328)F305.CB only 0.000 apart, marking (T0328)F305.CB as missing WARNING: atoms too close: (T0328)N311.CA and (T0328)N311.CB only 0.000 apart, marking (T0328)N311.CB as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 Skipped atom 19, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 32, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 61, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 70, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 107, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 140, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 201, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 230, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 231, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 324, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 325, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 338, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 423, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 472, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 473, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 478, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 519, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 604, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 617, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 758, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 783, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 796, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 801, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 841, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 843, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 845, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 847, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 866, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 991, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 1004, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 1069, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 1078, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 1103, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz Skipped atom 1140, because occupancy 1.000 <= existing 1.000 in servers/SAM-T02_AL1.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 Skipped atom 19, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 32, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 61, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 70, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 135, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 196, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 225, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 226, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 319, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 320, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 333, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 418, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 467, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 468, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 473, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 514, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 599, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 612, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 753, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 778, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 791, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 796, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 836, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 838, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 840, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 842, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 861, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 986, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 999, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 1064, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 1073, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 1098, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz Skipped atom 1135, because occupancy 1.000 <= existing 1.000 in servers/SAM-T99_AL1.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 284 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 158 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 251 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 305 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 302 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 309 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 158 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 110 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 304 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 222 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 285 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 246 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)K231.CA and (T0328)G235.CA only 0.000 apart, marking (T0328)K231.CA as missing WARNING: atoms too close: (T0328)D232.N and (T0328)K236.N only 0.000 apart, marking (T0328)K236.N as missing WARNING: atoms too close: (T0328)D232.CA and (T0328)K236.CA only 0.000 apart, marking (T0328)K236.CA as missing WARNING: atoms too close: (T0328)D232.CB and (T0328)K236.CB only 0.000 apart, marking (T0328)K236.CB as missing WARNING: atoms too close: (T0328)D232.C and (T0328)K236.C only 0.000 apart, marking (T0328)K236.C as missing WARNING: atoms too close: (T0328)E233.CA and (T0328)S237.CA only 0.000 apart, marking (T0328)S237.CA as missing WARNING: atoms too close: (T0328)N234.CA and (T0328)I238.CA only 0.000 apart, marking (T0328)I238.CA as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 Skipped atom 15, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 28, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 57, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 66, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 103, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 136, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 197, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 226, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 227, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 320, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 321, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 334, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 419, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 468, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 469, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 474, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 515, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 600, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 613, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 754, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 779, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 792, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 797, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 837, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 839, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 841, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 843, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 862, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 987, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 1000, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 1065, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 1074, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 1099, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz Skipped atom 1136, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL1.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 210 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 203 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 299 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 278 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 305 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/gtg_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation gtg_AL1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 229 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 183 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 226 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 62 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 257 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 # Found a chain break before 308 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)R139.O and (T0328)F140.N only 0.000 apart, marking (T0328)F140.N as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0328)R136.O and (T0328)G137.N only 0.000 apart, marking (T0328)G137.N as missing WARNING: atoms too close: (T0328)K251.O and (T0328)E252.N only 0.000 apart, marking (T0328)E252.N as missing # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 # Found a chain break before 302 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 # Found a chain break before 310 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # Found a chain break before 300 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # Found a chain break before 302 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # Found a chain break before 300 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 WARNING: atom 382 has residue number 52 < previous residue 78 in servers/mGen-3D_TS1.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 311 in servers/nFOLD_TS2.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 311 in servers/nFOLD_TS3.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 311 in servers/nFOLD_TS5.pdb.gz # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/panther2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # naming current conformation panther2_TS1 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0328 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score 2.0422 model score 2.0422 model score 2.0422 model score 2.0422 model score 2.0422 model score 2.0422 model score 2.0422 model score 0.1505 model score 0.1449 model score 2.2295 model score 2.1573 model score 2.6774 model score 2.1573 model score 2.2295 model score 2.2091 model score 2.1225 model score 2.2062 model score -0.0227 model score 1.5998 model score 1.6219 model score 1.6200 model score 1.6001 model score 1.6151 model score 0.0206 model score 0.0116 model score 0.0039 model score 0.0021 model score 0.0218 model score 0.7202 model score 2.1792 model score 1.6924 model score 1.9312 model score 1.7883 model score 1.8894 model score 1.2784 model score 1.2779 model score 1.2791 model score 1.2784 model score 1.2786 model score 0.0267 model score 0.4601 model score 0.4868 model score 0.0802 model score 0.4826 model score 0.0318 model score 0.0116 model score 0.0218 model score 0.0218 model score 0.0039 model score 0.1550 model score 0.6104 model score 2.3779 model score 2.2530 model score 2.6252 model score 1.2740 model score 1.2804 model score 1.2781 model score 1.2771 model score 1.2793 model score 1.2740 model score 1.2804 model score 1.2781 model score 1.2771 model score 1.2793 model score 2.3880 model score 2.4414 model score 2.5397 model score 2.5472 model score 2.5502 model score 0.1425 model score 1.5768 model score 2.3811 model score 2.4565 model score 1.4171 model score 1.2738 model score 1.2774 model score 1.2787 model score 1.2793 model score 1.2771 model score 0.0746 model score 0.0860 model score 0.4692 model score 0.1534 model score 0.4652 model score 1.7452 model score 2.3465 model score 2.3436 model score 2.2598 model score -0.0175 model score -0.0051 model score 0.1488 model score -0.0319 model score 0.2687 model score -0.0328 model score -0.0328 model score -0.0328 model score 0.3409 model score 2.0334 model score 1.9153 model score 1.6305 model score 1.6181 model score 1.9617 model score 1.6673 model score 1.3835 model score 2.4027 model score 1.6991 model score 0.0947 model score 2.0727 model score 2.4184 model score 2.4272 model score 1.9884 model score 0.1006 model score 2.0727 model score 2.5288 model score 2.3663 model score 2.3705 model score 0.1942 model score 0.6970 model score 0.9267 model score 1.7182 model score 1.6957 model score 0.2406 model score 2.0192 model score 1.2771 model score 2.4738 model score 2.1212 model score 2.3155 model score 0.0776 model score 0.0749 model score 0.0785 model score 0.0806 model score 0.0792 model score 0.1325 model score 0.1345 model score 2.1470 model score 1.4679 model score 0.0776 model score 0.0271 model score 0.1192 model score 0.5573 model score -0.0122 model score -0.0370 model score 1.5003 model score 2.4286 model score 1.8862 model score 2.2647 model score 1.8045 model score 2.8216 model score 0.0580 model score -0.0370 model score 0.0358 model score 0.0740 model score 0.1135 model score -0.0283 model score 0.1272 model score 0.2332 model score 0.0639 model score 0.3427 model score 0.4541 model score 1.1875 model score 1.8869 model score 1.8025 model score 1.6351 model score 0.2820 model score 1.1725 model score 1.8669 model score 1.7233 model score 1.6213 model score 0.1135 model score 0.0740 model score 0.0358 model score -0.0370 model score 0.0580 model score 1.8320 model score 2.0096 model score 2.2383 model score 2.0792 model score 1.9794 model score 1.2740 model score 1.2772 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2740 model score 0.0034 model score 0.0597 model score 0.8185 model score 1.3035 model score 0.9738 model score 0.2332 model score 2.2177 model score 2.3650 model score 0.9962 model score 2.2581 model score 0.2077 model score 1.0423 model score 2.2377 model score 2.2430 model score 1.9670 model score 0.2406 model score 1.0079 model score 2.2345 model score 2.2236 model score 2.1605 model score 1.2740 model score 0.0108 model score 1.2740 model score 0.1476 model score 0.1782 model score 0.1489 model score 0.1940 model score 0.2307 model score 0.4978 model score -0.0002 model score 1.2795 model score 1.2770 model score 1.2772 model score 1.2771 model score 1.2771 model score 1.2771 model score 2.3135 model score 2.5302 model score 2.2304 model score 2.3033 model score 2.1473 model score 2.5123 model score 2.4941 model score 2.1840 model score 2.5154 model score 2.6738 model score 2.1145 model score 1.6886 model score 2.2773 model score 2.3917 model score 1.9853 model score 1.7548 model score 0.1463 model score 1.7023 model score 1.1277 model score 1.8259 model score 2.5182 model score -0.0532 model score 0.8996 model score 0.9603 model score 1.5755 model score 1.5517 model score 1.3193 model score 0.0019 USE_META, weight: 0.3440 cost: 2.0422 min: -0.0532 max: 2.8216 USE_META, weight: 0.3440 cost: 2.0422 min: -0.0532 max: 2.8216 USE_META, weight: 0.3440 cost: 2.0422 min: -0.0532 max: 2.8216 USE_META, weight: 0.3440 cost: 2.0422 min: -0.0532 max: 2.8216 USE_META, weight: 0.3440 cost: 2.0422 min: -0.0532 max: 2.8216 USE_META, weight: 0.3440 cost: 2.0422 min: -0.0532 max: 2.8216 USE_META, weight: 0.3440 cost: 2.0422 min: -0.0532 max: 2.8216 USE_META, weight: 0.9362 cost: 0.1505 min: -0.0532 max: 2.8216 USE_META, weight: 0.9380 cost: 0.1449 min: -0.0532 max: 2.8216 USE_META, weight: 0.2854 cost: 2.2295 min: -0.0532 max: 2.8216 USE_META, weight: 0.3080 cost: 2.1573 min: -0.0532 max: 2.8216 USE_META, weight: 0.1451 cost: 2.6774 min: -0.0532 max: 2.8216 USE_META, weight: 0.3080 cost: 2.1573 min: -0.0532 max: 2.8216 USE_META, weight: 0.2854 cost: 2.2295 min: -0.0532 max: 2.8216 USE_META, weight: 0.2918 cost: 2.2091 min: -0.0532 max: 2.8216 USE_META, weight: 0.3189 cost: 2.1225 min: -0.0532 max: 2.8216 USE_META, weight: 0.2927 cost: 2.2062 min: -0.0532 max: 2.8216 USE_META, weight: 0.9905 cost: -0.0227 min: -0.0532 max: 2.8216 USE_META, weight: 0.4825 cost: 1.5998 min: -0.0532 max: 2.8216 USE_META, weight: 0.4756 cost: 1.6219 min: -0.0532 max: 2.8216 USE_META, weight: 0.4762 cost: 1.6200 min: -0.0532 max: 2.8216 USE_META, weight: 0.4824 cost: 1.6001 min: -0.0532 max: 2.8216 USE_META, weight: 0.4777 cost: 1.6151 min: -0.0532 max: 2.8216 USE_META, weight: 0.9769 cost: 0.0206 min: -0.0532 max: 2.8216 USE_META, weight: 0.9797 cost: 0.0116 min: -0.0532 max: 2.8216 USE_META, weight: 0.9821 cost: 0.0039 min: -0.0532 max: 2.8216 USE_META, weight: 0.9827 cost: 0.0021 min: -0.0532 max: 2.8216 USE_META, weight: 0.9765 cost: 0.0218 min: -0.0532 max: 2.8216 USE_META, weight: 0.7579 cost: 0.7202 min: -0.0532 max: 2.8216 USE_META, weight: 0.3011 cost: 2.1792 min: -0.0532 max: 2.8216 USE_META, weight: 0.4535 cost: 1.6924 min: -0.0532 max: 2.8216 USE_META, weight: 0.3788 cost: 1.9312 min: -0.0532 max: 2.8216 USE_META, weight: 0.4235 cost: 1.7883 min: -0.0532 max: 2.8216 USE_META, weight: 0.3918 cost: 1.8894 min: -0.0532 max: 2.8216 USE_META, weight: 0.5831 cost: 1.2784 min: -0.0532 max: 2.8216 USE_META, weight: 0.5833 cost: 1.2779 min: -0.0532 max: 2.8216 USE_META, weight: 0.5829 cost: 1.2791 min: -0.0532 max: 2.8216 USE_META, weight: 0.5831 cost: 1.2784 min: -0.0532 max: 2.8216 USE_META, weight: 0.5831 cost: 1.2786 min: -0.0532 max: 2.8216 USE_META, weight: 0.9750 cost: 0.0267 min: -0.0532 max: 2.8216 USE_META, weight: 0.8393 cost: 0.4601 min: -0.0532 max: 2.8216 USE_META, weight: 0.8310 cost: 0.4868 min: -0.0532 max: 2.8216 USE_META, weight: 0.9583 cost: 0.0802 min: -0.0532 max: 2.8216 USE_META, weight: 0.8323 cost: 0.4826 min: -0.0532 max: 2.8216 USE_META, weight: 0.9734 cost: 0.0318 min: -0.0532 max: 2.8216 USE_META, weight: 0.9797 cost: 0.0116 min: -0.0532 max: 2.8216 USE_META, weight: 0.9765 cost: 0.0218 min: -0.0532 max: 2.8216 USE_META, weight: 0.9765 cost: 0.0218 min: -0.0532 max: 2.8216 USE_META, weight: 0.9821 cost: 0.0039 min: -0.0532 max: 2.8216 USE_META, weight: 0.9348 cost: 0.1550 min: -0.0532 max: 2.8216 USE_META, weight: 0.7922 cost: 0.6104 min: -0.0532 max: 2.8216 USE_META, weight: 0.2389 cost: 2.3779 min: -0.0532 max: 2.8216 USE_META, weight: 0.2780 cost: 2.2530 min: -0.0532 max: 2.8216 USE_META, weight: 0.1615 cost: 2.6252 min: -0.0532 max: 2.8216 USE_META, weight: 0.5845 cost: 1.2740 min: -0.0532 max: 2.8216 USE_META, weight: 0.5825 cost: 1.2804 min: -0.0532 max: 2.8216 USE_META, weight: 0.5832 cost: 1.2781 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.5828 cost: 1.2793 min: -0.0532 max: 2.8216 USE_META, weight: 0.5845 cost: 1.2740 min: -0.0532 max: 2.8216 USE_META, weight: 0.5825 cost: 1.2804 min: -0.0532 max: 2.8216 USE_META, weight: 0.5832 cost: 1.2781 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.5828 cost: 1.2793 min: -0.0532 max: 2.8216 USE_META, weight: 0.2358 cost: 2.3880 min: -0.0532 max: 2.8216 USE_META, weight: 0.2190 cost: 2.4414 min: -0.0532 max: 2.8216 USE_META, weight: 0.1883 cost: 2.5397 min: -0.0532 max: 2.8216 USE_META, weight: 0.1859 cost: 2.5472 min: -0.0532 max: 2.8216 USE_META, weight: 0.1850 cost: 2.5502 min: -0.0532 max: 2.8216 USE_META, weight: 0.9387 cost: 0.1425 min: -0.0532 max: 2.8216 USE_META, weight: 0.4897 cost: 1.5768 min: -0.0532 max: 2.8216 USE_META, weight: 0.2379 cost: 2.3811 min: -0.0532 max: 2.8216 USE_META, weight: 0.2143 cost: 2.4565 min: -0.0532 max: 2.8216 USE_META, weight: 0.5397 cost: 1.4171 min: -0.0532 max: 2.8216 USE_META, weight: 0.5846 cost: 1.2738 min: -0.0532 max: 2.8216 USE_META, weight: 0.5834 cost: 1.2774 min: -0.0532 max: 2.8216 USE_META, weight: 0.5830 cost: 1.2787 min: -0.0532 max: 2.8216 USE_META, weight: 0.5828 cost: 1.2793 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.9600 cost: 0.0746 min: -0.0532 max: 2.8216 USE_META, weight: 0.9564 cost: 0.0860 min: -0.0532 max: 2.8216 USE_META, weight: 0.8365 cost: 0.4692 min: -0.0532 max: 2.8216 USE_META, weight: 0.9353 cost: 0.1534 min: -0.0532 max: 2.8216 USE_META, weight: 0.8377 cost: 0.4652 min: -0.0532 max: 2.8216 USE_META, weight: 0.4370 cost: 1.7452 min: -0.0532 max: 2.8216 USE_META, weight: 0.2487 cost: 2.3465 min: -0.0532 max: 2.8216 USE_META, weight: 0.2497 cost: 2.3436 min: -0.0532 max: 2.8216 USE_META, weight: 0.2759 cost: 2.2598 min: -0.0532 max: 2.8216 USE_META, weight: 0.9888 cost: -0.0175 min: -0.0532 max: 2.8216 USE_META, weight: 0.9849 cost: -0.0051 min: -0.0532 max: 2.8216 USE_META, weight: 0.9368 cost: 0.1488 min: -0.0532 max: 2.8216 USE_META, weight: 0.9934 cost: -0.0319 min: -0.0532 max: 2.8216 USE_META, weight: 0.8992 cost: 0.2687 min: -0.0532 max: 2.8216 USE_META, weight: 0.9936 cost: -0.0328 min: -0.0532 max: 2.8216 USE_META, weight: 0.9936 cost: -0.0328 min: -0.0532 max: 2.8216 USE_META, weight: 0.9936 cost: -0.0328 min: -0.0532 max: 2.8216 USE_META, weight: 0.8766 cost: 0.3409 min: -0.0532 max: 2.8216 USE_META, weight: 0.3468 cost: 2.0334 min: -0.0532 max: 2.8216 USE_META, weight: 0.3837 cost: 1.9153 min: -0.0532 max: 2.8216 USE_META, weight: 0.4729 cost: 1.6305 min: -0.0532 max: 2.8216 USE_META, weight: 0.4768 cost: 1.6181 min: -0.0532 max: 2.8216 USE_META, weight: 0.3692 cost: 1.9617 min: -0.0532 max: 2.8216 USE_META, weight: 0.4614 cost: 1.6673 min: -0.0532 max: 2.8216 USE_META, weight: 0.5502 cost: 1.3835 min: -0.0532 max: 2.8216 USE_META, weight: 0.2312 cost: 2.4027 min: -0.0532 max: 2.8216 USE_META, weight: 0.4514 cost: 1.6991 min: -0.0532 max: 2.8216 USE_META, weight: 0.9537 cost: 0.0947 min: -0.0532 max: 2.8216 USE_META, weight: 0.3345 cost: 2.0727 min: -0.0532 max: 2.8216 USE_META, weight: 0.2262 cost: 2.4184 min: -0.0532 max: 2.8216 USE_META, weight: 0.2235 cost: 2.4272 min: -0.0532 max: 2.8216 USE_META, weight: 0.3609 cost: 1.9884 min: -0.0532 max: 2.8216 USE_META, weight: 0.9519 cost: 0.1006 min: -0.0532 max: 2.8216 USE_META, weight: 0.3345 cost: 2.0727 min: -0.0532 max: 2.8216 USE_META, weight: 0.1917 cost: 2.5288 min: -0.0532 max: 2.8216 USE_META, weight: 0.2426 cost: 2.3663 min: -0.0532 max: 2.8216 USE_META, weight: 0.2412 cost: 2.3705 min: -0.0532 max: 2.8216 USE_META, weight: 0.9226 cost: 0.1942 min: -0.0532 max: 2.8216 USE_META, weight: 0.7651 cost: 0.6970 min: -0.0532 max: 2.8216 USE_META, weight: 0.6932 cost: 0.9267 min: -0.0532 max: 2.8216 USE_META, weight: 0.4454 cost: 1.7182 min: -0.0532 max: 2.8216 USE_META, weight: 0.4525 cost: 1.6957 min: -0.0532 max: 2.8216 USE_META, weight: 0.9080 cost: 0.2406 min: -0.0532 max: 2.8216 USE_META, weight: 0.3512 cost: 2.0192 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.2089 cost: 2.4738 min: -0.0532 max: 2.8216 USE_META, weight: 0.3193 cost: 2.1212 min: -0.0532 max: 2.8216 USE_META, weight: 0.2585 cost: 2.3155 min: -0.0532 max: 2.8216 USE_META, weight: 0.9591 cost: 0.0776 min: -0.0532 max: 2.8216 USE_META, weight: 0.9599 cost: 0.0749 min: -0.0532 max: 2.8216 USE_META, weight: 0.9588 cost: 0.0785 min: -0.0532 max: 2.8216 USE_META, weight: 0.9581 cost: 0.0806 min: -0.0532 max: 2.8216 USE_META, weight: 0.9586 cost: 0.0792 min: -0.0532 max: 2.8216 USE_META, weight: 0.9419 cost: 0.1325 min: -0.0532 max: 2.8216 USE_META, weight: 0.9412 cost: 0.1345 min: -0.0532 max: 2.8216 USE_META, weight: 0.3112 cost: 2.1470 min: -0.0532 max: 2.8216 USE_META, weight: 0.5238 cost: 1.4679 min: -0.0532 max: 2.8216 USE_META, weight: 0.9591 cost: 0.0776 min: -0.0532 max: 2.8216 USE_META, weight: 0.9749 cost: 0.0271 min: -0.0532 max: 2.8216 USE_META, weight: 0.9460 cost: 0.1192 min: -0.0532 max: 2.8216 USE_META, weight: 0.8089 cost: 0.5573 min: -0.0532 max: 2.8216 USE_META, weight: 0.9872 cost: -0.0122 min: -0.0532 max: 2.8216 USE_META, weight: 0.9949 cost: -0.0370 min: -0.0532 max: 2.8216 USE_META, weight: 0.5137 cost: 1.5003 min: -0.0532 max: 2.8216 USE_META, weight: 0.2230 cost: 2.4286 min: -0.0532 max: 2.8216 USE_META, weight: 0.3928 cost: 1.8862 min: -0.0532 max: 2.8216 USE_META, weight: 0.2744 cost: 2.2647 min: -0.0532 max: 2.8216 USE_META, weight: 0.4184 cost: 1.8045 min: -0.0532 max: 2.8216 USE_META, weight: 0.1000 cost: 2.8216 min: -0.0532 max: 2.8216 USE_META, weight: 0.9652 cost: 0.0580 min: -0.0532 max: 2.8216 USE_META, weight: 0.9949 cost: -0.0370 min: -0.0532 max: 2.8216 USE_META, weight: 0.9721 cost: 0.0358 min: -0.0532 max: 2.8216 USE_META, weight: 0.9602 cost: 0.0740 min: -0.0532 max: 2.8216 USE_META, weight: 0.9478 cost: 0.1135 min: -0.0532 max: 2.8216 USE_META, weight: 0.9922 cost: -0.0283 min: -0.0532 max: 2.8216 USE_META, weight: 0.9435 cost: 0.1272 min: -0.0532 max: 2.8216 USE_META, weight: 0.9103 cost: 0.2332 min: -0.0532 max: 2.8216 USE_META, weight: 0.9634 cost: 0.0639 min: -0.0532 max: 2.8216 USE_META, weight: 0.8761 cost: 0.3427 min: -0.0532 max: 2.8216 USE_META, weight: 0.8412 cost: 0.4541 min: -0.0532 max: 2.8216 USE_META, weight: 0.6116 cost: 1.1875 min: -0.0532 max: 2.8216 USE_META, weight: 0.3926 cost: 1.8869 min: -0.0532 max: 2.8216 USE_META, weight: 0.4191 cost: 1.8025 min: -0.0532 max: 2.8216 USE_META, weight: 0.4715 cost: 1.6351 min: -0.0532 max: 2.8216 USE_META, weight: 0.8951 cost: 0.2820 min: -0.0532 max: 2.8216 USE_META, weight: 0.6163 cost: 1.1725 min: -0.0532 max: 2.8216 USE_META, weight: 0.3989 cost: 1.8669 min: -0.0532 max: 2.8216 USE_META, weight: 0.4438 cost: 1.7233 min: -0.0532 max: 2.8216 USE_META, weight: 0.4758 cost: 1.6213 min: -0.0532 max: 2.8216 USE_META, weight: 0.9478 cost: 0.1135 min: -0.0532 max: 2.8216 USE_META, weight: 0.9602 cost: 0.0740 min: -0.0532 max: 2.8216 USE_META, weight: 0.9721 cost: 0.0358 min: -0.0532 max: 2.8216 USE_META, weight: 0.9949 cost: -0.0370 min: -0.0532 max: 2.8216 USE_META, weight: 0.9652 cost: 0.0580 min: -0.0532 max: 2.8216 USE_META, weight: 0.4098 cost: 1.8320 min: -0.0532 max: 2.8216 USE_META, weight: 0.3542 cost: 2.0096 min: -0.0532 max: 2.8216 USE_META, weight: 0.2826 cost: 2.2383 min: -0.0532 max: 2.8216 USE_META, weight: 0.3324 cost: 2.0792 min: -0.0532 max: 2.8216 USE_META, weight: 0.3637 cost: 1.9794 min: -0.0532 max: 2.8216 USE_META, weight: 0.5845 cost: 1.2740 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2772 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.5845 cost: 1.2740 min: -0.0532 max: 2.8216 USE_META, weight: 0.9823 cost: 0.0034 min: -0.0532 max: 2.8216 USE_META, weight: 0.9647 cost: 0.0597 min: -0.0532 max: 2.8216 USE_META, weight: 0.7271 cost: 0.8185 min: -0.0532 max: 2.8216 USE_META, weight: 0.5753 cost: 1.3035 min: -0.0532 max: 2.8216 USE_META, weight: 0.6785 cost: 0.9738 min: -0.0532 max: 2.8216 USE_META, weight: 0.9103 cost: 0.2332 min: -0.0532 max: 2.8216 USE_META, weight: 0.2891 cost: 2.2177 min: -0.0532 max: 2.8216 USE_META, weight: 0.2430 cost: 2.3650 min: -0.0532 max: 2.8216 USE_META, weight: 0.6715 cost: 0.9962 min: -0.0532 max: 2.8216 USE_META, weight: 0.2764 cost: 2.2581 min: -0.0532 max: 2.8216 USE_META, weight: 0.9183 cost: 0.2077 min: -0.0532 max: 2.8216 USE_META, weight: 0.6570 cost: 1.0423 min: -0.0532 max: 2.8216 USE_META, weight: 0.2828 cost: 2.2377 min: -0.0532 max: 2.8216 USE_META, weight: 0.2812 cost: 2.2430 min: -0.0532 max: 2.8216 USE_META, weight: 0.3676 cost: 1.9670 min: -0.0532 max: 2.8216 USE_META, weight: 0.9080 cost: 0.2406 min: -0.0532 max: 2.8216 USE_META, weight: 0.6678 cost: 1.0079 min: -0.0532 max: 2.8216 USE_META, weight: 0.2838 cost: 2.2345 min: -0.0532 max: 2.8216 USE_META, weight: 0.2872 cost: 2.2236 min: -0.0532 max: 2.8216 USE_META, weight: 0.3070 cost: 2.1605 min: -0.0532 max: 2.8216 USE_META, weight: 0.5845 cost: 1.2740 min: -0.0532 max: 2.8216 USE_META, weight: 0.9800 cost: 0.0108 min: -0.0532 max: 2.8216 USE_META, weight: 0.5845 cost: 1.2740 min: -0.0532 max: 2.8216 USE_META, weight: 0.9372 cost: 0.1476 min: -0.0532 max: 2.8216 USE_META, weight: 0.9276 cost: 0.1782 min: -0.0532 max: 2.8216 USE_META, weight: 0.9367 cost: 0.1489 min: -0.0532 max: 2.8216 USE_META, weight: 0.9226 cost: 0.1940 min: -0.0532 max: 2.8216 USE_META, weight: 0.9111 cost: 0.2307 min: -0.0532 max: 2.8216 USE_META, weight: 0.8275 cost: 0.4978 min: -0.0532 max: 2.8216 USE_META, weight: 0.9834 cost: -0.0002 min: -0.0532 max: 2.8216 USE_META, weight: 0.5828 cost: 1.2795 min: -0.0532 max: 2.8216 USE_META, weight: 0.5836 cost: 1.2770 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2772 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.5835 cost: 1.2771 min: -0.0532 max: 2.8216 USE_META, weight: 0.2591 cost: 2.3135 min: -0.0532 max: 2.8216 USE_META, weight: 0.1912 cost: 2.5302 min: -0.0532 max: 2.8216 USE_META, weight: 0.2851 cost: 2.2304 min: -0.0532 max: 2.8216 USE_META, weight: 0.2623 cost: 2.3033 min: -0.0532 max: 2.8216 USE_META, weight: 0.3111 cost: 2.1473 min: -0.0532 max: 2.8216 USE_META, weight: 0.1968 cost: 2.5123 min: -0.0532 max: 2.8216 USE_META, weight: 0.2025 cost: 2.4941 min: -0.0532 max: 2.8216 USE_META, weight: 0.2996 cost: 2.1840 min: -0.0532 max: 2.8216 USE_META, weight: 0.1959 cost: 2.5154 min: -0.0532 max: 2.8216 USE_META, weight: 0.1463 cost: 2.6738 min: -0.0532 max: 2.8216 USE_META, weight: 0.3214 cost: 2.1145 min: -0.0532 max: 2.8216 USE_META, weight: 0.4547 cost: 1.6886 min: -0.0532 max: 2.8216 USE_META, weight: 0.2704 cost: 2.2773 min: -0.0532 max: 2.8216 USE_META, weight: 0.2346 cost: 2.3917 min: -0.0532 max: 2.8216 USE_META, weight: 0.3618 cost: 1.9853 min: -0.0532 max: 2.8216 USE_META, weight: 0.4340 cost: 1.7548 min: -0.0532 max: 2.8216 USE_META, weight: 0.9376 cost: 0.1463 min: -0.0532 max: 2.8216 USE_META, weight: 0.4504 cost: 1.7023 min: -0.0532 max: 2.8216 USE_META, weight: 0.6303 cost: 1.1277 min: -0.0532 max: 2.8216 USE_META, weight: 0.4117 cost: 1.8259 min: -0.0532 max: 2.8216 USE_META, weight: 0.1950 cost: 2.5182 min: -0.0532 max: 2.8216 USE_META, weight: 1.0000 cost: -0.0532 min: -0.0532 max: 2.8216 USE_META, weight: 0.7017 cost: 0.8996 min: -0.0532 max: 2.8216 USE_META, weight: 0.6827 cost: 0.9603 min: -0.0532 max: 2.8216 USE_META, weight: 0.4901 cost: 1.5755 min: -0.0532 max: 2.8216 USE_META, weight: 0.4976 cost: 1.5517 min: -0.0532 max: 2.8216 USE_META, weight: 0.5703 cost: 1.3193 min: -0.0532 max: 2.8216 USE_META, weight: 0.9828 cost: 0.0019 min: -0.0532 max: 2.8216 USE_EVALUE, weight: 0.5397 eval: 15.4390 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.5397 eval: 15.4390 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.5397 eval: 15.4390 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1214 eval: 29.4690 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1214 eval: 29.4690 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1214 eval: 29.4690 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4338 eval: 18.9910 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4338 eval: 18.9910 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4338 eval: 18.9910 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3356 eval: 22.2850 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3356 eval: 22.2850 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3356 eval: 22.2850 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.7645 eval: 7.8975 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.7645 eval: 7.8975 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.7645 eval: 7.8975 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.9588 eval: 1.3823 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.9588 eval: 1.3823 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.9588 eval: 1.3823 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.5125 eval: 16.3520 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.5125 eval: 16.3520 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.5125 eval: 16.3520 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3511 eval: 21.7640 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3511 eval: 21.7640 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3511 eval: 21.7640 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4868 eval: 17.2130 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4868 eval: 17.2130 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4868 eval: 17.2130 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1000 eval: 30.1870 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1000 eval: 30.1870 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1000 eval: 30.1870 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.2927 eval: 23.7220 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.2927 eval: 23.7220 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.2927 eval: 23.7220 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1068 eval: 29.9590 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1068 eval: 29.9590 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1068 eval: 29.9590 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4834 eval: 17.3280 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4834 eval: 17.3280 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4834 eval: 17.3280 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.9114 eval: 2.9734 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.9114 eval: 2.9734 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.9114 eval: 2.9734 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1725 eval: 27.7550 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1725 eval: 27.7550 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1725 eval: 27.7550 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3650 eval: 21.2970 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3650 eval: 21.2970 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.3650 eval: 21.2970 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1103 eval: 29.8410 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1103 eval: 29.8410 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.1103 eval: 29.8410 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4201 eval: 19.4490 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4201 eval: 19.4490 min: 0.0000 max: 30.1870 USE_EVALUE, weight: 0.4201 eval: 19.4490 min: 0.0000 max: 30.1870 Number of contacts in models: 248 Number of contacts in alignments: 57 NUMB_ALIGNS: 57 Adding 26121 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -544.7350, CN propb: -544.7350 weights: 0.3362 constraints: 1072 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 1072 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 1072 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 25049 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 25049 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 26121 # command: