# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0296/ # command:# Making conformation for sequence T0296 numbered 1 through 445 Created new target T0296 from T0296.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0296/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0296//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0296/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0296//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0296/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0296/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0296/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1j0aA expands to /projects/compbio/data/pdb/1j0a.pdb.gz 1j0aA:# T0296 read from 1j0aA/merged-good-all-a2m # 1j0aA read from 1j0aA/merged-good-all-a2m # adding 1j0aA to template set # found chain 1j0aA in template set T0296 9 :TIAMIEEQNFDIRTITMG 1j0aA 61 :LLGDALSKGADVVITVGA # choosing archetypes in rotamer library T0296 58 :VGDEIAAELGIPIVNKRV 1j0aA 86 :VTGLAAKKLGLDAILVLR T0296 86 :ATDATD 1j0aA 104 :GKEELK T0296 98 :ALDKAAKEIGVDFIG 1j0aA 110 :GNYLLDKIMGIETRV T0296 121 :GYQ 1j0aA 126 :DAK T0296 124 :KGDEILINSIPRALAETDKVCSSVNIGST 1j0aA 131 :FELMKYAEEIAEELKREGRKPYVIPPGGA T0296 157 :NMTAVADMGRIIKETANLSDMGVAKLVVFANA 1j0aA 160 :SPIGTLGYVRAVGEIATQSEVKFDSIVVAAGS T0296 197 :GAF 1j0aA 202 :LSI T0296 202 :VGEADVIINVGVSG 1j0aA 205 :LNEDIRPVGIAVGR T0296 216 :PG 1j0aA 221 :EV T0296 241 :TAFKITR 1j0aA 223 :MTSKLDN T0296 252 :VGQMASERLGVEF 1j0aA 230 :LIKEAAELLGVKV T0296 265 :GIVDLSL 1j0aA 247 :ELYDYSF T0296 275 :PAVGD 1j0aA 254 :GEYGK T0296 280 :SVARVLEEMGLE 1j0aA 262 :EVAQIIRKVGTR T0296 292 :TVGTHGTTAALALLNDQVKKGG 1j0aA 277 :ILDPVYTGKAFYGLVDLARKGE Number of specific fragments extracted= 16 number of extra gaps= 0 total=16 Number of alignments=1 # 1j0aA read from 1j0aA/merged-good-all-a2m # found chain 1j0aA in template set T0296 9 :TIAMIEEQNFDIRTITMG 1j0aA 61 :LLGDALSKGADVVITVGA T0296 58 :VGDEIAAELGIPIVNKRV 1j0aA 86 :VTGLAAKKLGLDAILVLR T0296 86 :ATDATD 1j0aA 104 :GKEELK T0296 98 :ALDKAAKEIGVDFIG 1j0aA 110 :GNYLLDKIMGIETRV T0296 121 :GYQ 1j0aA 126 :DAK T0296 124 :KGDEILINSIPRALAETDKVCSSVNIGST 1j0aA 131 :FELMKYAEEIAEELKREGRKPYVIPPGGA T0296 157 :NMTAVADMGRIIKETANLSDMGVAKLVVFANA 1j0aA 160 :SPIGTLGYVRAVGEIATQSEVKFDSIVVAAGS T0296 197 :GAF 1j0aA 202 :LSI T0296 202 :VGEADVIINVGVSGPG 1j0aA 205 :LNEDIRPVGIAVGRFG T0296 228 :GQSFDVVAETV 1j0aA 221 :EVMTSKLDNLI T0296 254 :QMASERLGVEF 1j0aA 232 :KEAAELLGVKV T0296 265 :GIVDLSL 1j0aA 247 :ELYDYSF T0296 275 :PAVGD 1j0aA 254 :GEYGK T0296 280 :SVARVLEEMGLE 1j0aA 262 :EVAQIIRKVGTR T0296 292 :TVGTHGTTAALALLNDQVKKGG 1j0aA 277 :ILDPVYTGKAFYGLVDLARKGE Number of specific fragments extracted= 15 number of extra gaps= 0 total=31 Number of alignments=2 # 1j0aA read from 1j0aA/merged-good-all-a2m # found chain 1j0aA in template set T0296 8 :ETIAMIEEQNFDI 1j0aA 60 :YLLGDALSKGADV T0296 22 :TITMGISLL 1j0aA 73 :VITVGAVHS T0296 58 :VGDEIAAELGIPIV 1j0aA 86 :VTGLAAKKLGLDAI T0296 75 :VSVTPIS 1j0aA 100 :LVLRGKE T0296 88 :DATD 1j0aA 107 :ELKG T0296 99 :LDKAAKEIGVDFIGGF 1j0aA 111 :NYLLDKIMGIETRVYD T0296 119 :QKGYQKGDEILINSIPRALAETDKVCSS 1j0aA 127 :AKDSFELMKYAEEIAEELKREGRKPYVI T0296 152 :TKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANAV 1j0aA 155 :PPGGASPIGTLGYVRAVGEIATQSEVKFDSIVVAAGSG T0296 215 :GPGVVKRALEKVRGQSFDVV 1j0aA 193 :GTLAGLSLGLSILNEDIRPV T0296 245 :ITRIGQLVGQMASERLGVEF 1j0aA 223 :MTSKLDNLIKEAAELLGVKV T0296 265 :GIVDLSLAPTPAVGDSVARVLEEMG 1j0aA 247 :ELYDYSFGEYGKITGEVAQIIRKVG T0296 290 :LETVGTHGTTAALALLNDQVKKG 1j0aA 275 :GIILDPVYTGKAFYGLVDLARKG Number of specific fragments extracted= 12 number of extra gaps= 0 total=43 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i60A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1i60A/merged-good-all-a2m # 1i60A read from 1i60A/merged-good-all-a2m # found chain 1i60A in training set T0296 7 :TETIAMIEEQNFDIRTITMGISLLD 1i60A 49 :DDLAEYFQTHHIKPLALNALVFFNN T0296 33 :IDPD 1i60A 74 :RDEK T0296 44 :IYQKITTKAANLVAVGDEI 1i60A 78 :GHNEIITEFKGMMETCKTL T0296 67 :GIPIVNKRVSVT 1i60A 97 :GVKYVVAVPLVT T0296 85 :AATDATD 1i60A 110 :QKIVKEE T0296 92 :YVVLAKALDKAAKEIGVDFIGGF 1i60A 121 :SVDVLTELSDIAEPYGVKIALEF T0296 121 :GYQKG 1i60A 144 :VGHPQ T0296 130 :INSIPRALAE 1i60A 154 :FEQAYEIVNT T0296 140 :TDKVCSSVNI 1i60A 166 :RDNVGLVLDS T0296 154 :SGINMTAVAD 1i60A 181 :MGSNIESLKQ T0296 174 :L 1i60A 191 :A T0296 176 :DMGVAKLVVFANAVED 1i60A 192 :DGKKIFIYHIDDTEDF T0296 192 :NPFM 1i60A 209 :IGFL T0296 196 :AGAFHGVGEA 1i60A 214 :DEDRVWPGQG T0296 228 :GQSFDVVAETVKK 1i60A 224 :AIDLDAHLSALKE T0296 260 :LGVEF 1i60A 237 :IGFSD T0296 266 :IVDLSL 1i60A 242 :VVSVEL T0296 273 :PTPAVGD 1i60A 248 :FRPEYYK T0296 280 :SVARVL 1i60A 256 :TAEEAI T0296 299 :TAALALLNDQVKKG 1i60A 262 :QTAKKTTVDVVSKY Number of specific fragments extracted= 20 number of extra gaps= 0 total=63 Number of alignments=4 # 1i60A read from 1i60A/merged-good-all-a2m # found chain 1i60A in training set T0296 7 :TETIAMIEEQNFDIRTITMGISLLDC 1i60A 49 :DDLAEYFQTHHIKPLALNALVFFNNR T0296 34 :DP 1i60A 75 :DE T0296 43 :KIYQKITTKAANLVAVGDEI 1i60A 77 :KGHNEIITEFKGMMETCKTL T0296 67 :GIPIVNKRVSVT 1i60A 97 :GVKYVVAVPLVT T0296 85 :AATDATD 1i60A 110 :QKIVKEE T0296 92 :YVVLAKALDKAAKEIGVDFIGGF 1i60A 121 :SVDVLTELSDIAEPYGVKIALEF T0296 121 :GYQKG 1i60A 144 :VGHPQ T0296 130 :INSIPRALAE 1i60A 154 :FEQAYEIVNT T0296 140 :TDKVCSSVNI 1i60A 166 :RDNVGLVLDS T0296 154 :SGINMTAVAD 1i60A 181 :MGSNIESLKQ T0296 174 :LSD 1i60A 191 :ADG T0296 178 :GVAKLVVFANAVED 1i60A 194 :KKIFIYHIDDTEDF T0296 192 :NPFM 1i60A 209 :IGFL T0296 196 :AGAFHGVGEA 1i60A 214 :DEDRVWPGQG T0296 228 :GQSFDVVAETVKK 1i60A 224 :AIDLDAHLSALKE T0296 260 :LGVE 1i60A 237 :IGFS T0296 265 :GIVDLSL 1i60A 241 :DVVSVEL T0296 273 :PTPAVGD 1i60A 248 :FRPEYYK T0296 280 :SVARVL 1i60A 256 :TAEEAI T0296 299 :TAALALLNDQVKKG 1i60A 262 :QTAKKTTVDVVSKY Number of specific fragments extracted= 20 number of extra gaps= 0 total=83 Number of alignments=5 # 1i60A read from 1i60A/merged-good-all-a2m # found chain 1i60A in training set T0296 3 :IR 1i60A 48 :LD T0296 8 :ETIAMIEEQNFDIRTITMGISLLDC 1i60A 50 :DLAEYFQTHHIKPLALNALVFFNNR T0296 34 :D 1i60A 75 :D T0296 42 :EKIYQKITTKAANLVAVGDEI 1i60A 76 :EKGHNEIITEFKGMMETCKTL T0296 67 :GIPIVNKRVSVTPI 1i60A 97 :GVKYVVAVPLVTEQ T0296 86 :ATDATDY 1i60A 111 :KIVKEEI T0296 93 :VVLAKALDKAAKEIGVDFIGGFSA 1i60A 122 :VDVLTELSDIAEPYGVKIALEFVG T0296 119 :QKGYQ 1i60A 146 :HPQCT T0296 124 :KGDEILINSIPRAL 1i60A 152 :NTFEQAYEIVNTVN T0296 140 :TDKVCSSVN 1i60A 166 :RDNVGLVLD T0296 154 :SGINMTAVA 1i60A 181 :MGSNIESLK T0296 173 :NLSD 1i60A 190 :QADG T0296 178 :GVAKLVVFANAVEDNPFMAGA 1i60A 194 :KKIFIYHIDDTEDFPIGFLTD T0296 199 :FHGVGEA 1i60A 217 :RVWPGQG T0296 228 :GQSFDVVAETVK 1i60A 224 :AIDLDAHLSALK T0296 259 :RLGVE 1i60A 236 :EIGFS T0296 266 :IVDLSL 1i60A 242 :VVSVEL T0296 289 :GLETVGTHGTTAALALLNDQVKKGG 1i60A 248 :FRPEYYKLTAEEAIQTAKKTTVDVV Number of specific fragments extracted= 18 number of extra gaps= 0 total=101 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1edt/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1edt expands to /projects/compbio/data/pdb/1edt.pdb.gz 1edt:Warning: there is no chain 1edt will retry with 1edtA # T0296 read from 1edt/merged-good-all-a2m # 1edt read from 1edt/merged-good-all-a2m # adding 1edt to template set # found chain 1edt in template set Warning: unaligning (T0296)T24 because of BadResidue code BAD_PEPTIDE in next template residue (1edt)A45 T0296 18 :FDIRTI 1edt 38 :FDVAVI T0296 25 :MGISLLD 1edt 46 :ANINYDT T0296 32 :CIDPDIN 1edt 60 :HFNENVQ T0296 43 :KIYQKITTKAANLVA 1edt 67 :RVLDNAVTQIRPLQQ T0296 66 :LGIPIVNK 1edt 82 :QGIKVLLS T0296 75 :VSVTPISLIGAAT 1edt 90 :VLGNHQGAGFANF T0296 88 :DATDYVVLAKALDKAAKEIGVDFIG 1edt 104 :SQQAASAFAKQLSDAVAKYGLDGVD T0296 114 :FSA 1edt 136 :YGN T0296 120 :KG 1edt 139 :NG T0296 122 :YQKGD 1edt 144 :PNDSS T0296 127 :EILINSIPRALA 1edt 150 :VHLVTALRANMP T0296 141 :DKVCSSVNIGSTKSGI 1edt 162 :DKIISLYNIGPAASRL T0296 173 :NLSD 1edt 178 :SYGG T0296 177 :MGVAKLVV 1edt 185 :SDKFDYAW T0296 192 :NPFMAGAFH 1edt 193 :NPYYGTWQV T0296 201 :GVG 1edt 203 :GIA T0296 204 :EADVIINVGVS 1edt 207 :PKAQLSPAAVE T0296 226 :VRGQSFDVVAETVKKTAFK 1edt 218 :IGRTSRSTVADLARRTVDE T0296 261 :GVEFGIVD 1edt 237 :GYGVYLTY T0296 292 :TVGTHGTTAALALLNDQVKKGGV 1edt 245 :NLDGGDRTADVSAFTRELYGSEA Number of specific fragments extracted= 20 number of extra gaps= 1 total=121 Number of alignments=7 # 1edt read from 1edt/merged-good-all-a2m # found chain 1edt in template set Warning: unaligning (T0296)T24 because of BadResidue code BAD_PEPTIDE in next template residue (1edt)A45 T0296 18 :FDIRTI 1edt 38 :FDVAVI T0296 25 :MGISLLD 1edt 46 :ANINYDT T0296 32 :CIDPD 1edt 60 :HFNEN T0296 41 :AEKIYQKITTKAANLVA 1edt 65 :VQRVLDNAVTQIRPLQQ T0296 66 :LGIPIVNK 1edt 82 :QGIKVLLS T0296 75 :VSVTPISLIGAAT 1edt 90 :VLGNHQGAGFANF T0296 88 :DATDYVVLAKALDKAAKEIGVDFIG 1edt 104 :SQQAASAFAKQLSDAVAKYGLDGVD T0296 114 :FSA 1edt 136 :YGN T0296 120 :KG 1edt 139 :NG T0296 122 :YQKGD 1edt 144 :PNDSS T0296 127 :EILINSIPRALA 1edt 150 :VHLVTALRANMP T0296 141 :DKVCSSVNIG 1edt 162 :DKIISLYNIG T0296 170 :ETANL 1edt 172 :PAASR T0296 175 :SDMGVAKLVV 1edt 183 :DVSDKFDYAW T0296 192 :NPFMAGAFH 1edt 193 :NPYYGTWQV T0296 201 :GVG 1edt 203 :GIA T0296 204 :EADVIINVGVS 1edt 207 :PKAQLSPAAVE T0296 226 :VRGQSFDVVAETVKKTA 1edt 218 :IGRTSRSTVADLARRTV T0296 258 :ER 1edt 235 :DE T0296 261 :GVEFGIVD 1edt 237 :GYGVYLTY T0296 292 :TVGTHGTTAALALLNDQVKKGGV 1edt 245 :NLDGGDRTADVSAFTRELYGSEA Number of specific fragments extracted= 21 number of extra gaps= 1 total=142 Number of alignments=8 # 1edt read from 1edt/merged-good-all-a2m # found chain 1edt in template set Warning: unaligning (T0296)T24 because of BadResidue code BAD_PEPTIDE in next template residue (1edt)A45 T0296 18 :FDIRTI 1edt 38 :FDVAVI T0296 25 :MGISLLD 1edt 46 :ANINYDT T0296 35 :PD 1edt 53 :GT T0296 37 :INRAAEKIYQKITTKAANLVA 1edt 61 :FNENVQRVLDNAVTQIRPLQQ T0296 66 :LGIPIVNK 1edt 82 :QGIKVLLS T0296 75 :VSVTPISLIGAAT 1edt 90 :VLGNHQGAGFANF T0296 88 :DATDYVVLAKALDKAAKEIGVDFIGGFSA 1edt 104 :SQQAASAFAKQLSDAVAKYGLDGVDFDDE T0296 117 :LVQKGYQKGDE 1edt 136 :YGNNGTAQPND T0296 128 :ILINSIPRALAET 1edt 151 :HLVTALRANMPDK T0296 143 :VCSSVNI 1edt 164 :IISLYNI T0296 169 :KETA 1edt 171 :GPAA T0296 173 :N 1edt 181 :G T0296 177 :MGVAKLVVF 1edt 185 :SDKFDYAWN T0296 190 :EDNPFMAGAFHGVGEADV 1edt 194 :PYYGTWQVPGIALPKAQL T0296 209 :INVGVS 1edt 212 :SPAAVE T0296 226 :VRGQSFDVVAE 1edt 218 :IGRTSRSTVAD T0296 241 :TAF 1edt 229 :LAR T0296 255 :MASER 1edt 232 :RTVDE T0296 261 :GVEFGIVDL 1edt 237 :GYGVYLTYN T0296 272 :APTPAVGDSVARVLEEMGL 1edt 246 :LDGGDRTADVSAFTRELYG Number of specific fragments extracted= 20 number of extra gaps= 1 total=162 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dosA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1dosA/merged-good-all-a2m # 1dosA read from 1dosA/merged-good-all-a2m # found chain 1dosA in training set Warning: unaligning (T0296)M195 because of BadResidue code BAD_PEPTIDE in next template residue (1dosA)D191 Warning: unaligning (T0296)A196 because of BadResidue code BAD_PEPTIDE at template residue (1dosA)D191 Warning: unaligning (T0296)D279 because of BadResidue code BAD_PEPTIDE in next template residue (1dosA)A231 T0296 4 :RQVTETIAMIEEQNFDIRTITM 1dosA 15 :DDVQKVFQVAKENNFALPAVNC T0296 33 :IDPD 1dosA 37 :VGTD T0296 55 :LVAVGDEIAAELGIPIVNK 1dosA 41 :SINAVLETAAKVKAPVIVQ T0296 75 :VSVTPISLIGAA 1dosA 60 :FSNGGASFIAGK T0296 87 :TDA 1dosA 75 :SDV T0296 90 :TDYVVLAKALDKAAKEIGVDFIGGFS 1dosA 84 :LGAISGAHHVHQMAEHYGVPVILHTD T0296 121 :GYQKGDEILINSI 1dosA 110 :HCAKKLLPWIDGL T0296 134 :PRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANL 1dosA 127 :EKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKI T0296 178 :GVAKLVVFANA 1dosA 168 :GMTLEIELGCT T0296 191 :DNPF 1dosA 186 :DNSH T0296 197 :G 1dosA 192 :A T0296 202 :VGEA 1dosA 193 :SALY T0296 214 :SGPGVVKRALEKVRGQ 1dosA 197 :TQPEDVDYAYTELSKI T0296 262 :VEFGIVDLSLAPTPAVG 1dosA 213 :SPRFTIAASFGNVHGVY T0296 291 :ETVGTHG 1dosA 232 :GNVVLTP T0296 300 :AALALLNDQVKKGGVMACNQ 1dosA 239 :TILRDSQEYVSKKHNLPHNS T0296 323 :LSGAFI 1dosA 259 :LNFVFH T0296 343 :GSLNLEKLEAMT 1dosA 267 :SGSTAQEIKDSV T0296 358 :SVGLDMIAIP 1dosA 279 :SYGVVKMNID T0296 373 :ETIAAMIADEA 1dosA 289 :TDTQWATWEGV Number of specific fragments extracted= 20 number of extra gaps= 2 total=182 Number of alignments=10 # 1dosA read from 1dosA/merged-good-all-a2m # found chain 1dosA in training set Warning: unaligning (T0296)M195 because of BadResidue code BAD_PEPTIDE in next template residue (1dosA)D191 Warning: unaligning (T0296)A196 because of BadResidue code BAD_PEPTIDE at template residue (1dosA)D191 Warning: unaligning (T0296)D279 because of BadResidue code BAD_PEPTIDE in next template residue (1dosA)A231 T0296 4 :RQVTETIAMIEEQNFDIRTITM 1dosA 15 :DDVQKVFQVAKENNFALPAVNC T0296 33 :IDP 1dosA 37 :VGT T0296 54 :NLVAVGDEIAAELGIPIVNK 1dosA 40 :DSINAVLETAAKVKAPVIVQ T0296 75 :VSVTPISLIGAA 1dosA 60 :FSNGGASFIAGK T0296 87 :TDA 1dosA 75 :SDV T0296 90 :TDYVVLAKALDKAAKEIGVDFIGGFS 1dosA 84 :LGAISGAHHVHQMAEHYGVPVILHTD T0296 121 :GYQKGDEILINSI 1dosA 110 :HCAKKLLPWIDGL T0296 134 :PRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANL 1dosA 127 :EKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKI T0296 178 :GVAKLVVFANA 1dosA 168 :GMTLEIELGCT T0296 191 :DNPF 1dosA 186 :DNSH T0296 197 :G 1dosA 192 :A T0296 202 :VGEA 1dosA 193 :SALY T0296 214 :SGPGVVKRALEKVRGQ 1dosA 197 :TQPEDVDYAYTELSKI T0296 262 :VEFGIVDLSLAPTPAVG 1dosA 213 :SPRFTIAASFGNVHGVY T0296 291 :ETVGTHG 1dosA 232 :GNVVLTP T0296 300 :AALALLNDQVKKGGVMACNQ 1dosA 239 :TILRDSQEYVSKKHNLPHNS T0296 323 :LSGAFI 1dosA 259 :LNFVFH T0296 343 :GSLNLEKLEAMT 1dosA 267 :SGSTAQEIKDSV T0296 358 :SVGLDMIAIP 1dosA 279 :SYGVVKMNID T0296 373 :ETIAAMIADEA 1dosA 289 :TDTQWATWEGV Number of specific fragments extracted= 20 number of extra gaps= 2 total=202 Number of alignments=11 # 1dosA read from 1dosA/merged-good-all-a2m # found chain 1dosA in training set Warning: unaligning (T0296)V207 because of BadResidue code BAD_PEPTIDE in next template residue (1dosA)D191 Warning: unaligning (T0296)I208 because of BadResidue code BAD_PEPTIDE at template residue (1dosA)D191 T0296 4 :RQVTETIAMIEEQNFDIRTITM 1dosA 15 :DDVQKVFQVAKENNFALPAVNC T0296 33 :ID 1dosA 37 :VG T0296 53 :ANLVAVGDEIAAELGIPIV 1dosA 39 :TDSINAVLETAAKVKAPVI T0296 75 :VSVT 1dosA 58 :VQFS T0296 79 :PISLIGAAT 1dosA 64 :GASFIAGKG T0296 89 :ATDYVVLAKALDKAAKEIGVDFIGGFSA 1dosA 83 :ILGAISGAHHVHQMAEHYGVPVILHTDH T0296 118 :VQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLS 1dosA 111 :CAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIG T0296 180 :AKLVVFANAVEDNPF 1dosA 169 :MTLEIELGCTGGEED T0296 201 :GVGEAD 1dosA 184 :GVDNSH T0296 209 :INVGVSGPGVVKRALEKVRG 1dosA 192 :ASALYTQPEDVDYAYTELSK T0296 229 :QSFDVVAETVKK 1dosA 232 :GNVVLTPTILRD T0296 252 :VGQMASERLGVE 1dosA 244 :SQEYVSKKHNLP T0296 264 :FGIV 1dosA 259 :LNFV T0296 271 :LAPTPAVG 1dosA 263 :FHGGSGST T0296 306 :NDQVKKGGV 1dosA 271 :AQEIKDSVS T0296 321 :GGLSGAFI 1dosA 280 :YGVVKMNI T0296 333 :DEGMIAAVQNG 1dosA 288 :DTDTQWATWEG Number of specific fragments extracted= 17 number of extra gaps= 1 total=219 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gtzA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gtzA expands to /projects/compbio/data/pdb/1gtz.pdb.gz 1gtzA:Skipped atom 65, because occupancy 0.3 <= existing 0.700 in 1gtzA Skipped atom 67, because occupancy 0.300 <= existing 0.700 in 1gtzA Skipped atom 69, because occupancy 0.300 <= existing 0.700 in 1gtzA Skipped atom 76, because occupancy 0.400 <= existing 0.600 in 1gtzA Skipped atom 78, because occupancy 0.400 <= existing 0.600 in 1gtzA Skipped atom 80, because occupancy 0.400 <= existing 0.600 in 1gtzA Skipped atom 221, because occupancy 0.400 <= existing 0.600 in 1gtzA Skipped atom 937, because occupancy 0.300 <= existing 0.700 in 1gtzA Skipped atom 944, because occupancy 0.500 <= existing 0.500 in 1gtzA Skipped atom 946, because occupancy 0.500 <= existing 0.500 in 1gtzA Skipped atom 948, because occupancy 0.500 <= existing 0.500 in 1gtzA Skipped atom 950, because occupancy 0.500 <= existing 0.500 in 1gtzA Skipped atom 1079, because occupancy 0.500 <= existing 0.500 in 1gtzA Skipped atom 1081, because occupancy 0.500 <= existing 0.500 in 1gtzA Skipped atom 1083, because occupancy 0.500 <= existing 0.500 in 1gtzA Skipped atom 1085, because occupancy 0.500 <= existing 0.500 in 1gtzA # T0296 read from 1gtzA/merged-good-all-a2m # 1gtzA read from 1gtzA/merged-good-all-a2m # adding 1gtzA to template set # found chain 1gtzA in template set T0296 17 :NFDIRTITMG 1gtzA 6 :NAPIMILNGP T0296 28 :SLLDCIDPDINRA 1gtzA 16 :NLNLLGQAQPEIY T0296 52 :AANLVAVGDEIAAELGIPIVNKR 1gtzA 33 :LADVEALCVKAAAAHGGTVDFRQ T0296 86 :ATDATDYVVLAKALDK 1gtzA 56 :SNHEGELVDWIHEARL T0296 106 :IGVDFIGGFSALVQK 1gtzA 72 :NHCGIVINPAAYSHT T0296 130 :INSIPRALAETDKV 1gtzA 87 :SVAILDALNTCDGL T0296 179 :VAKLVVFANAVEDNPFMAGAFHGVGEADVIIN 1gtzA 101 :PVVEVHISNIHQREPFRHHSYVSQRADGVVAG T0296 214 :SGPGVVKRALE 1gtzA 133 :CGVQGYVFGVE T0296 237 :TVKKT 1gtzA 144 :RIAAL Number of specific fragments extracted= 9 number of extra gaps= 0 total=228 Number of alignments=13 # 1gtzA read from 1gtzA/merged-good-all-a2m # found chain 1gtzA in template set T0296 16 :QNFDIRTITMG 1gtzA 5 :ANAPIMILNGP T0296 28 :SLLDCIDPDINRA 1gtzA 16 :NLNLLGQAQPEIY T0296 52 :AANLVAVGDEIAAELGIPIVNKR 1gtzA 33 :LADVEALCVKAAAAHGGTVDFRQ T0296 86 :ATDATDYVVLAKALDK 1gtzA 56 :SNHEGELVDWIHEARL T0296 106 :IGVDFIGGFSALVQK 1gtzA 72 :NHCGIVINPAAYSHT T0296 130 :INSIPRALAETDKV 1gtzA 87 :SVAILDALNTCDGL T0296 179 :VAKLVVFANAVEDNPFMAGAFHGVGEADVIIN 1gtzA 101 :PVVEVHISNIHQREPFRHHSYVSQRADGVVAG T0296 214 :SGPGVVKRALEKV 1gtzA 133 :CGVQGYVFGVERI T0296 235 :AE 1gtzA 146 :AA Number of specific fragments extracted= 9 number of extra gaps= 0 total=237 Number of alignments=14 # 1gtzA read from 1gtzA/merged-good-all-a2m # found chain 1gtzA in template set T0296 67 :GIPIV 1gtzA 6 :NAPIM T0296 75 :VSVTPISLIGAATDATDY 1gtzA 11 :ILNGPNLNLLGQAQPEIY T0296 93 :VVLAKALDKAAKEIGVDFIGGFS 1gtzA 34 :ADVEALCVKAAAAHGGTVDFRQS T0296 124 :KGDEILINSIPRALAETDKVCSS 1gtzA 57 :NHEGELVDWIHEARLNHCGIVIN T0296 151 :STK 1gtzA 80 :PAA T0296 161 :VADMGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIIN 1gtzA 83 :YSHTSVAILDALNTCDGLPVVEVHISNIHQREPFRHHSYVSQRADGVVAG T0296 214 :SGPGVVKRALEKVR 1gtzA 133 :CGVQGYVFGVERIA Number of specific fragments extracted= 7 number of extra gaps= 0 total=244 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jx6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1jx6A/merged-good-all-a2m # 1jx6A read from 1jx6A/merged-good-all-a2m # found chain 1jx6A in training set T0296 37 :INRAAEK 1jx6A 31 :YQEFLDE T0296 46 :QKITTKAANLVAVGD 1jx6A 39 :PEQRNLTNALSEAVR T0296 69 :PIVNKRVSVT 1jx6A 66 :PIKISVVYPG T0296 86 :ATDATDYVVLAKALDKAAKEIGVDF 1jx6A 76 :QQVSDYWVRNIASFEKRLYKLNINY T0296 111 :IGGF 1jx6A 102 :LNQV T0296 121 :GYQKGDEILINSIPRALAETDKVC 1jx6A 108 :RPNADIKQQSLSLMEALKSKSDYL T0296 149 :IGSTKSGIN 1jx6A 132 :IFTLDTTRH T0296 165 :GRIIKETANLSD 1jx6A 141 :RKFVEHVLDSTN T0296 180 :AKLVVFA 1jx6A 153 :TKLILQN T0296 195 :MAGAFHGVGEADVIINVGVSGPGVV 1jx6A 160 :ITTPVREWDKHQPFLYVGFDHAEGS T0296 232 :DVVAETVKKTAFK 1jx6A 185 :RELATEFGKFFPK T0296 245 :ITRI 1jx6A 211 :ISDV T0296 249 :GQLVGQMASERLGVEFGIVD 1jx6A 216 :GDTFIHQVNRDNNFELQSAY T0296 273 :PTPAVGDSVARVLEEMGLETVGTH 1jx6A 236 :YTKATKQSGYDAAKASLAKHPDVD T0296 297 :GTTAALALLNDQVKKGGV 1jx6A 264 :CSTDVALGAVDALAELGR T0296 324 :SGAFI 1jx6A 282 :EDIMI T0296 329 :PVSEDEGMIAAVQNGSLN 1jx6A 288 :GWGGGSAELDAIQKGDLD T0296 361 :LDMIAIP 1jx6A 306 :ITVMRMN T0296 373 :ETIAAMIADEAAIG 1jx6A 313 :DDTGIAMAEAIKWD T0296 388 :INMKTT 1jx6A 327 :LEDKPV T0296 399 :P 1jx6A 333 :P T0296 403 :E 1jx6A 334 :T T0296 404 :GDMIEFG 1jx6A 338 :GDFEIVT Number of specific fragments extracted= 23 number of extra gaps= 0 total=267 Number of alignments=16 # 1jx6A read from 1jx6A/merged-good-all-a2m # found chain 1jx6A in training set T0296 38 :NRAAEK 1jx6A 32 :QEFLDE T0296 46 :QKITTKAANLVAVGD 1jx6A 39 :PEQRNLTNALSEAVR T0296 69 :PIVNKRVSVT 1jx6A 66 :PIKISVVYPG T0296 86 :ATDATDYVVLAKALDKAAKEIGVDF 1jx6A 76 :QQVSDYWVRNIASFEKRLYKLNINY T0296 111 :IGGF 1jx6A 102 :LNQV T0296 121 :GYQKGDEILINSIPRALAETDKVC 1jx6A 108 :RPNADIKQQSLSLMEALKSKSDYL T0296 149 :IGSTKSGINMTAVAD 1jx6A 132 :IFTLDTTRHRKFVEH T0296 171 :TANLSD 1jx6A 147 :VLDSTN T0296 180 :AKLVVF 1jx6A 153 :TKLILQ T0296 194 :FMAGAFHGVGEADVIINVGVSGPGVVKRALEKV 1jx6A 159 :NITTPVREWDKHQPFLYVGFDHAEGSRELATEF T0296 227 :RGQS 1jx6A 196 :PKHT T0296 237 :TVKK 1jx6A 210 :YISD T0296 247 :RIGQLVGQMASERLGVEFGIVD 1jx6A 214 :VRGDTFIHQVNRDNNFELQSAY T0296 273 :PTPAVGDSVARVLEEMGLETVGTH 1jx6A 236 :YTKATKQSGYDAAKASLAKHPDVD T0296 297 :GTTAALALLNDQVKKGGV 1jx6A 264 :CSTDVALGAVDALAELGR T0296 324 :SGAFI 1jx6A 282 :EDIMI T0296 329 :PVSEDEGMIAAVQNGSLN 1jx6A 288 :GWGGGSAELDAIQKGDLD T0296 361 :LDMIAIP 1jx6A 306 :ITVMRMN T0296 373 :ETIAAMIADEAAIG 1jx6A 313 :DDTGIAMAEAIKWD T0296 388 :INMKTT 1jx6A 327 :LEDKPV T0296 399 :P 1jx6A 333 :P T0296 403 :E 1jx6A 334 :T T0296 404 :GDMIEFG 1jx6A 338 :GDFEIVT Number of specific fragments extracted= 23 number of extra gaps= 0 total=290 Number of alignments=17 # 1jx6A read from 1jx6A/merged-good-all-a2m # found chain 1jx6A in training set T0296 36 :DINRAAEK 1jx6A 30 :GYQEFLDE T0296 46 :QKITTKAANLVAVGD 1jx6A 39 :PEQRNLTNALSEAVR T0296 67 :GIPIVNK 1jx6A 64 :QRPIKIS T0296 75 :VSVT 1jx6A 71 :VVYP T0296 80 :ISL 1jx6A 75 :GQQ T0296 88 :DATDYVVLAKALDKAAKEIGVDFIGGFSALV 1jx6A 78 :VSDYWVRNIASFEKRLYKLNINYQLNQVFTR T0296 122 :YQKGDEILINSIPRALAETDKVCS 1jx6A 109 :PNADIKQQSLSLMEALKSKSDYLI T0296 147 :VNIGSTK 1jx6A 133 :FTLDTTR T0296 164 :MGRIIKETANLSD 1jx6A 140 :HRKFVEHVLDSTN T0296 180 :AKLVVF 1jx6A 153 :TKLILQ T0296 194 :FMAGAFHGVGEADVIINVGVSGPGVVKRALEKV 1jx6A 159 :NITTPVREWDKHQPFLYVGFDHAEGSRELATEF T0296 227 :RGQSF 1jx6A 197 :KHTYY T0296 233 :VVAE 1jx6A 210 :YISD T0296 247 :RIGQLVGQMASERLGVEFGIVDLSLAPT 1jx6A 214 :VRGDTFIHQVNRDNNFELQSAYYTKATK T0296 279 :DSVARVLEEM 1jx6A 242 :QSGYDAAKAS T0296 289 :GLETVGTH 1jx6A 257 :DVDFIYAC T0296 298 :TTAALALLNDQVKKGGV 1jx6A 265 :STDVALGAVDALAELGR T0296 316 :ACNQVGGLSG 1jx6A 282 :EDIMINGWGG T0296 333 :DEGMIAAVQNGSLN 1jx6A 292 :GSAELDAIQKGDLD T0296 361 :LDMIAIP 1jx6A 306 :ITVMRMN T0296 373 :ET 1jx6A 313 :DD T0296 376 :AAMIADEAAIGVINMKTT 1jx6A 315 :TGIAMAEAIKWDLEDKPV T0296 399 :PK 1jx6A 333 :PT T0296 403 :E 1jx6A 335 :V T0296 404 :GDMIEFGG 1jx6A 338 :GDFEIVTK T0296 423 :GASSV 1jx6A 346 :ADSPE Number of specific fragments extracted= 26 number of extra gaps= 0 total=316 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o60A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1o60A expands to /projects/compbio/data/pdb/1o60.pdb.gz 1o60A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1135, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 1137, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 1139, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 1141, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 1143, because occupancy 0.350 <= existing 0.650 in 1o60A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1609, because occupancy 0.500 <= existing 0.500 in 1o60A Skipped atom 1611, because occupancy 0.500 <= existing 0.500 in 1o60A Skipped atom 1613, because occupancy 0.500 <= existing 0.500 in 1o60A Skipped atom 1615, because occupancy 0.500 <= existing 0.500 in 1o60A Skipped atom 1617, because occupancy 0.500 <= existing 0.500 in 1o60A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 2036, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 2038, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 2040, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 2042, because occupancy 0.350 <= existing 0.650 in 1o60A Skipped atom 2044, because occupancy 0.350 <= existing 0.650 in 1o60A # T0296 read from 1o60A/merged-good-all-a2m # 1o60A read from 1o60A/merged-good-all-a2m # adding 1o60A to template set # found chain 1o60A in template set Warning: unaligning (T0296)Q229 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o60A)R218 Warning: unaligning (T0296)A242 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o60A)R218 T0296 21 :RTITMGI 1o60A 21 :LFGGMNV T0296 30 :L 1o60A 28 :L T0296 33 :ID 1o60A 29 :ES T0296 49 :TTKAANLVAVGDEIAAELGIPIVNKRV 1o60A 31 :RDMAMQVCEAYVKVTEKLGVPYVFKAS T0296 77 :VTP 1o60A 58 :FDK T0296 84 :GA 1o60A 61 :AN T0296 86 :ATDATDYVVLAKALDK 1o60A 71 :GPGMEEGLKIFQELKD T0296 105 :EIGVDFIG 1o60A 87 :TFGVKIIT T0296 113 :GFSA 1o60A 101 :QCQP T0296 118 :VQKGYQ 1o60A 105 :VADVVD T0296 125 :GDEILI 1o60A 120 :RQTDLV T0296 135 :RALAETDKVCSS 1o60A 126 :EAMAKTGAVINV T0296 151 :STKSGINMTAVADMGRIIKET 1o60A 138 :KKPQFLSPSQMGNIVEKIEEC T0296 178 :GVAKLVVFANAVE 1o60A 159 :GNDKIILCDRGTN T0296 200 :HGVGEA 1o60A 172 :FGYDNL T0296 212 :GV 1o60A 178 :IV T0296 215 :GPGVVKRALEKVRG 1o60A 180 :DMLGFSVMKKASKG T0296 243 :FKITRIGQLVGQM 1o60A 219 :AQVTELARSGLAV T0296 263 :EFGIVDLSLAPTPAVG 1o60A 232 :GIAGLFLEAHPNPNQA T0296 294 :GTH 1o60A 248 :KCD T0296 324 :SGAFIPVSEDEGMIAAVQN 1o60A 251 :GPSALPLSALEGFVSQMKA Number of specific fragments extracted= 21 number of extra gaps= 0 total=337 Number of alignments=19 # 1o60A read from 1o60A/merged-good-all-a2m # found chain 1o60A in template set Warning: unaligning (T0296)Q229 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o60A)R218 T0296 20 :IRTITMGI 1o60A 20 :VLFGGMNV T0296 32 :CID 1o60A 28 :LES T0296 49 :TTKAANLVAVGDEIAAELGIPIVNKRV 1o60A 31 :RDMAMQVCEAYVKVTEKLGVPYVFKAS T0296 77 :VTP 1o60A 58 :FDK T0296 84 :GAATDA 1o60A 61 :ANRSSI T0296 90 :TDYVVLAKALDK 1o60A 75 :EEGLKIFQELKD T0296 105 :EIGVDFIG 1o60A 87 :TFGVKIIT T0296 113 :GFSA 1o60A 101 :QCQP T0296 118 :VQKGYQ 1o60A 105 :VADVVD T0296 125 :GDEIL 1o60A 120 :RQTDL T0296 134 :PRALAETDKVCSS 1o60A 125 :VEAMAKTGAVINV T0296 151 :STKSGINMTAVADMGRIIKET 1o60A 138 :KKPQFLSPSQMGNIVEKIEEC T0296 178 :GVAKLVVFANAVE 1o60A 159 :GNDKIILCDRGTN T0296 200 :HGVGEA 1o60A 172 :FGYDNL T0296 212 :GV 1o60A 178 :IV T0296 215 :GPGVVKRALEKVRG 1o60A 180 :DMLGFSVMKKASKG T0296 252 :VGQMASERLGVEFGIVDLSLAPTPAVGD 1o60A 221 :VTELARSGLAVGIAGLFLEAHPNPNQAK T0296 295 :TH 1o60A 249 :CD T0296 324 :SGAFIPVSEDEGMIAAVQN 1o60A 251 :GPSALPLSALEGFVSQMKA Number of specific fragments extracted= 19 number of extra gaps= 0 total=356 Number of alignments=20 # 1o60A read from 1o60A/merged-good-all-a2m # found chain 1o60A in template set Warning: unaligning (T0296)V233 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o60A)R218 Warning: unaligning (T0296)T246 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o60A)R218 T0296 4 :RQVTE 1o60A 35 :MQVCE T0296 9 :TIAMIEEQNFDI 1o60A 41 :YVKVTEKLGVPY T0296 22 :TITMGISLLDCIDPD 1o60A 53 :VFKASFDKANRSSIH T0296 52 :AANLVAVGDEIAAELGIPIVNK 1o60A 74 :MEEGLKIFQELKDTFGVKIITD T0296 77 :V 1o60A 96 :V T0296 87 :TDATDYVVLAK 1o60A 97 :HEIYQCQPVAD T0296 107 :GVDFIGGFSALV 1o60A 108 :VVDIIQLPAFLA T0296 125 :GDEILINSIPR 1o60A 120 :RQTDLVEAMAK T0296 140 :TDKVC 1o60A 131 :TGAVI T0296 148 :NIG 1o60A 136 :NVK T0296 152 :TKSGINMTAVADMGRIIKET 1o60A 139 :KPQFLSPSQMGNIVEKIEEC T0296 178 :GVAKLVVFANAVE 1o60A 159 :GNDKIILCDRGTN T0296 202 :VGEADVIIN 1o60A 172 :FGYDNLIVD T0296 216 :PGVVKRALEKVRGQSF 1o60A 181 :MLGFSVMKKASKGSPV T0296 232 :D 1o60A 204 :L T0296 247 :RIGQLVGQMASER 1o60A 219 :AQVTELARSGLAV T0296 263 :EFGIVDLSLAPTPAVGD 1o60A 232 :GIAGLFLEAHPNPNQAK T0296 293 :VGT 1o60A 249 :CDG T0296 325 :GAFIPVSEDEGMIAAVQN 1o60A 252 :PSALPLSALEGFVSQMKA Number of specific fragments extracted= 19 number of extra gaps= 0 total=375 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c93A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c93A expands to /projects/compbio/data/pdb/1c93.pdb.gz 1c93A:# T0296 read from 1c93A/merged-good-all-a2m # 1c93A read from 1c93A/merged-good-all-a2m # adding 1c93A to template set # found chain 1c93A in template set Warning: unaligning (T0296)T24 because of BadResidue code BAD_PEPTIDE in next template residue (1c93A)A45 T0296 18 :FDIRTI 1c93A 38 :FDVAVI T0296 25 :MGISLLD 1c93A 46 :ANINYDT T0296 32 :CIDPDINR 1c93A 60 :HFNENVQR T0296 44 :IYQKITTKAANLV 1c93A 68 :VLDNAVTQIRPLQ T0296 65 :ELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIG 1c93A 81 :QQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVD T0296 113 :GFSALVQKGYQKGD 1c93A 135 :EYGNNGTAQPNDSS T0296 127 :EILINSIPRALA 1c93A 150 :VHLVTALRANMP T0296 141 :DKVCSSVNIGSTKSGIN 1c93A 162 :DKIISLYNIGPAASRLS T0296 171 :TANLSDMGVAKLVVFANAVE 1c93A 179 :YGGVDVSDKFDYAWNPYYGT T0296 197 :GAFHGVG 1c93A 199 :WQVPGIA T0296 204 :EADVIINVGVS 1c93A 207 :PKAQLSPAAVE T0296 226 :VRGQSFDVVAETVKKTAFK 1c93A 218 :IGRTSRSTVADLARRTVDE T0296 261 :GVEFGIVDL 1c93A 237 :GYGVYLTYN T0296 272 :APTPAVGDSVARVLEEMGLE 1c93A 246 :LDGGDRTADVSAFTRELYGS Number of specific fragments extracted= 14 number of extra gaps= 1 total=389 Number of alignments=22 # 1c93A read from 1c93A/merged-good-all-a2m # found chain 1c93A in template set Warning: unaligning (T0296)T24 because of BadResidue code BAD_PEPTIDE in next template residue (1c93A)A45 T0296 18 :FDIRTI 1c93A 38 :FDVAVI T0296 25 :MGISLLD 1c93A 46 :ANINYDT T0296 32 :CIDPDI 1c93A 60 :HFNENV T0296 42 :EKIYQKITTKAANLV 1c93A 66 :QRVLDNAVTQIRPLQ T0296 65 :ELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIG 1c93A 81 :QQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVD T0296 113 :GFSALVQKGYQKGD 1c93A 135 :EYGNNGTAQPNDSS T0296 127 :EILINSIPRALA 1c93A 150 :VHLVTALRANMP T0296 141 :DKVCSSVNIGSTKSGIN 1c93A 162 :DKIISLYNIGPAASRLS T0296 171 :TANLSDMGVAKLVVFANAVE 1c93A 179 :YGGVDVSDKFDYAWNPYYGT T0296 197 :GAFHGVG 1c93A 199 :WQVPGIA T0296 204 :EADVIINVGVS 1c93A 207 :PKAQLSPAAVE T0296 226 :VRGQSFDVVAETVKKTA 1c93A 218 :IGRTSRSTVADLARRTV T0296 259 :RLGVEFGIVDL 1c93A 235 :DEGYGVYLTYN T0296 272 :APTPAVGDSVARVLEEMGLE 1c93A 246 :LDGGDRTADVSAFTRELYGS Number of specific fragments extracted= 14 number of extra gaps= 1 total=403 Number of alignments=23 # 1c93A read from 1c93A/merged-good-all-a2m # found chain 1c93A in template set Warning: unaligning (T0296)T24 because of BadResidue code BAD_PEPTIDE at template residue (1c93A)A45 T0296 18 :FDIRTI 1c93A 38 :FDVAVI T0296 25 :MGISLLD 1c93A 46 :ANINYDT T0296 35 :PD 1c93A 53 :GT T0296 37 :INRAAEKIYQKITTKAANLV 1c93A 61 :FNENVQRVLDNAVTQIRPLQ T0296 65 :ELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIGGFSALVQKG 1c93A 81 :QQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDFNDQYAEYG T0296 122 :YQK 1c93A 141 :TAQ T0296 125 :GDE 1c93A 145 :NDS T0296 128 :ILINSIPRALA 1c93A 151 :HLVTALRANMP T0296 141 :DKVCSSVNIGSTKSGIN 1c93A 162 :DKIISLYNIGPAASRLS T0296 174 :LSDMGVAKLVVF 1c93A 182 :VDVSDKFDYAWN T0296 190 :EDNPFMAGAFHGVGEADV 1c93A 194 :PYYGTWQVPGIALPKAQL T0296 209 :INVGVSG 1c93A 212 :SPAAVEI T0296 227 :RGQS 1c93A 219 :GRTS T0296 235 :AETVKKTA 1c93A 223 :RSTVADLA T0296 254 :QMASER 1c93A 231 :RRTVDE T0296 261 :GVEFGIVDL 1c93A 237 :GYGVYLTYN T0296 272 :APTPAVGDSVARVLEEMGLE 1c93A 246 :LDGGDRTADVSAFTRELYGS Number of specific fragments extracted= 17 number of extra gaps= 1 total=420 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f2dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f2dA expands to /projects/compbio/data/pdb/1f2d.pdb.gz 1f2dA:# T0296 read from 1f2dA/merged-good-all-a2m # 1f2dA read from 1f2dA/merged-good-all-a2m # adding 1f2dA to template set # found chain 1f2dA in template set T0296 11 :AMIEEQNFDIRTITMG 1f2dA 60 :PDIVEGDYTHLVSIGG T0296 55 :LVAVGDEIAAELGIPIVNKRVS 1f2dA 80 :QTRMVAALAAKLGKKCVLIQED T0296 77 :VTPISLIGAATDATDYV 1f2dA 103 :VPIPEAEKDVYNRVGNI T0296 101 :KAAKEIGVDFIG 1f2dA 120 :ELSRIMGADVRV T0296 121 :GYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANA 1f2dA 135 :GFDIGMRKSFANALQELEDAGHKPYPIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVT T0296 196 :AGAFHGVGEADVIINVGVSG 1f2dA 210 :LAGMAQYGRQDDVIAIDASF T0296 230 :SFDVVAETVKK 1f2dA 230 :TSEKTKEQTLR T0296 252 :VGQMASERLGVE 1f2dA 241 :IANNTAKLIGVE T0296 267 :VDLSLA 1f2dA 260 :LDTRFA T0296 288 :MGLETVGTHGTTAALALLNDQ 1f2dA 266 :YPCYGVPNEGTIEAIRTCAEQ T0296 312 :GGVMAC 1f2dA 287 :EGVLTD T0296 329 :PVSED 1f2dA 293 :PVYEG T0296 334 :EGMIAAVQNGSLN 1f2dA 301 :QGLIALIKEDYFK Number of specific fragments extracted= 13 number of extra gaps= 0 total=433 Number of alignments=25 # 1f2dA read from 1f2dA/merged-good-all-a2m # found chain 1f2dA in template set T0296 58 :VGDEIAAELGIPIVNKRVS 1f2dA 83 :MVAALAAKLGKKCVLIQED T0296 77 :VTPISLIGAATDATDYV 1f2dA 103 :VPIPEAEKDVYNRVGNI T0296 101 :KAAKEIGVDFIG 1f2dA 120 :ELSRIMGADVRV T0296 121 :GYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANA 1f2dA 135 :GFDIGMRKSFANALQELEDAGHKPYPIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVT T0296 196 :AGAFHGVGEADVIINVGVS 1f2dA 210 :LAGMAQYGRQDDVIAIDAS T0296 229 :QSFDVVAETVKK 1f2dA 229 :FTSEKTKEQTLR T0296 252 :VGQMASERLGVE 1f2dA 241 :IANNTAKLIGVE T0296 267 :VDLSLA 1f2dA 260 :LDTRFA T0296 288 :MGLETVGTHGTTAALALLNDQ 1f2dA 266 :YPCYGVPNEGTIEAIRTCAEQ T0296 312 :GGVMAC 1f2dA 287 :EGVLTD T0296 329 :PVSED 1f2dA 293 :PVYEG T0296 334 :EGMIAAVQNGSLN 1f2dA 301 :QGLIALIKEDYFK Number of specific fragments extracted= 12 number of extra gaps= 0 total=445 Number of alignments=26 # 1f2dA read from 1f2dA/merged-good-all-a2m # found chain 1f2dA in template set T0296 10 :IAMIEEQNFD 1f2dA 59 :VPDIVEGDYT T0296 21 :RTITMGISLL 1f2dA 69 :HLVSIGGRQS T0296 54 :NLVAVGDEIAAELGIPIVNKRVSVTPI 1f2dA 79 :NQTRMVAALAAKLGKKCVLIQEDWVPI T0296 81 :SLIGAATDATDYVVLAKA 1f2dA 107 :EAEKDVYNRVGNIELSRI T0296 106 :IGVDFIGG 1f2dA 125 :MGADVRVI T0296 119 :QKGYQ 1f2dA 133 :EDGFD T0296 124 :KGDEILINSIPRALAETDKVC 1f2dA 139 :GMRKSFANALQELEDAGHKPY T0296 146 :SVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVS 1f2dA 160 :PIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVTGSTTAGILAGMAQYGRQDDVIAIDAS T0296 233 :VVAETVKKTAFK 1f2dA 229 :FTSEKTKEQTLR T0296 252 :VGQMASERLGVE 1f2dA 241 :IANNTAKLIGVE T0296 267 :VDLSLA 1f2dA 260 :LDTRFA T0296 289 :GLETVGTHGTTAALALLNDQ 1f2dA 267 :PCYGVPNEGTIEAIRTCAEQ T0296 329 :PVSED 1f2dA 293 :PVYEG T0296 334 :EGMIAAVQNGSL 1f2dA 301 :QGLIALIKEDYF Number of specific fragments extracted= 14 number of extra gaps= 0 total=459 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mjhA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1mjhA/merged-good-all-a2m # 1mjhA read from 1mjhA/merged-good-all-a2m # found chain 1mjhA in training set Warning: unaligning (T0296)I33 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mjhA)V66 T0296 4 :RQVTETIAMIEEQ 1mjhA 16 :ETAEIALKHVKAF T0296 17 :NFDIRTI 1mjhA 33 :AEEVILL T0296 25 :MGISLLDC 1mjhA 40 :HVIDEREI T0296 38 :NRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPIS 1mjhA 67 :EEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHE T0296 98 :ALDKAAKEIGVDFIG 1mjhA 111 :EIVKIAEDEGVDIII T0296 144 :CSS 1mjhA 127 :GSH T0296 149 :IGSTKSGI 1mjhA 130 :GKTNLKEI T0296 157 :NMT 1mjhA 139 :LGS T0296 164 :MGRIIKETANLS 1mjhA 142 :VTENVIKKSNKP T0296 183 :VVFANAV 1mjhA 154 :VLVVKRK Number of specific fragments extracted= 10 number of extra gaps= 0 total=469 Number of alignments=28 # 1mjhA read from 1mjhA/merged-good-all-a2m # found chain 1mjhA in training set Warning: unaligning (T0296)I33 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mjhA)V66 T0296 4 :RQVTETIAMIEEQ 1mjhA 16 :ETAEIALKHVKAF T0296 17 :NFDIRTITM 1mjhA 33 :AEEVILLHV T0296 27 :ISLLDC 1mjhA 42 :IDEREI T0296 38 :NRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPIS 1mjhA 67 :EEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHE T0296 98 :ALDKAAKEIGVDFIG 1mjhA 111 :EIVKIAEDEGVDIII T0296 144 :CSS 1mjhA 127 :GSH T0296 149 :IGSTKSGI 1mjhA 130 :GKTNLKEI T0296 157 :NM 1mjhA 139 :LG T0296 163 :DMGRIIKETANLS 1mjhA 141 :SVTENVIKKSNKP T0296 183 :VVFANAV 1mjhA 154 :VLVVKRK Number of specific fragments extracted= 10 number of extra gaps= 0 total=479 Number of alignments=29 # 1mjhA read from 1mjhA/merged-good-all-a2m # found chain 1mjhA in training set Warning: unaligning (T0296)N17 because of BadResidue code BAD_PEPTIDE in next template residue (1mjhA)T30 Warning: unaligning (T0296)D34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mjhA)V66 T0296 5 :QVTETIAMIEEQ 1mjhA 17 :TAEIALKHVKAF T0296 21 :RTITMGISLLDCI 1mjhA 35 :EVILLHVIDEREI T0296 38 :NRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISL 1mjhA 67 :EEFENELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEE T0296 99 :LDKAAKEIGVDFIGGFSA 1mjhA 112 :IVKIAEDEGVDIIIMGSH T0296 119 :QKGYQKGDEI 1mjhA 130 :GKTNLKEILL T0296 131 :NSIPRALAETDK 1mjhA 141 :SVTENVIKKSNK Number of specific fragments extracted= 6 number of extra gaps= 1 total=485 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ufoA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1ufoA/merged-good-all-a2m # 1ufoA read from 1ufoA/merged-good-all-a2m # found chain 1ufoA in training set T0296 157 :NMTAV 1ufoA 36 :SKEHI T0296 168 :IKETANLSDMGV 1ufoA 41 :LALLPGYAERGF T0296 181 :KLVVF 1ufoA 53 :LLLAF T0296 191 :DNPFMAGAFHGVGEA 1ufoA 58 :DAPRHGEREGPPPSS T0296 214 :SGPGVVKRALE 1ufoA 73 :KSPRYVEEVYR T0296 241 :TAFKITRIGQLVGQMASERLGVEFGIVDLSL 1ufoA 84 :VALGFKEEARRVAEEAERRFGLPLFLAGGSL T0296 297 :GTTAALALLN 1ufoA 115 :GAFVAHLLLA T0296 319 :QV 1ufoA 126 :GF T0296 322 :GLSGAFI 1ufoA 128 :RPRGVLA T0296 329 :PVSEDEGMIAAVQNG 1ufoA 148 :QVVEDPGVLALYQAP T0296 346 :NLEKLEAMTAICSVG 1ufoA 166 :RGEAYGGVPLLHLHG T0296 368 :EDTPAETIAAMIADE 1ufoA 184 :HIVPLARMEKTLEAL Number of specific fragments extracted= 12 number of extra gaps= 0 total=497 Number of alignments=31 # 1ufoA read from 1ufoA/merged-good-all-a2m # found chain 1ufoA in training set T0296 156 :INMTAV 1ufoA 35 :GSKEHI T0296 168 :IKETANLSDMG 1ufoA 41 :LALLPGYAERG T0296 180 :AKLVVF 1ufoA 52 :FLLLAF T0296 191 :DNPFMAGAFHGVGEA 1ufoA 58 :DAPRHGEREGPPPSS T0296 214 :SGPGVVKRALE 1ufoA 73 :KSPRYVEEVYR T0296 233 :VVAETVKK 1ufoA 84 :VALGFKEE T0296 249 :GQLVGQMASERLGVEFGIVDLSL 1ufoA 92 :ARRVAEEAERRFGLPLFLAGGSL T0296 297 :GTTAALALLN 1ufoA 115 :GAFVAHLLLA T0296 320 :V 1ufoA 127 :F T0296 322 :GLSGAFI 1ufoA 128 :RPRGVLA T0296 329 :PVSEDEGMIAAVQNG 1ufoA 148 :QVVEDPGVLALYQAP T0296 346 :NLEKLEAMTAICSVG 1ufoA 166 :RGEAYGGVPLLHLHG T0296 368 :EDTPAETIAAMIADE 1ufoA 184 :HIVPLARMEKTLEAL Number of specific fragments extracted= 13 number of extra gaps= 0 total=510 Number of alignments=32 # 1ufoA read from 1ufoA/merged-good-all-a2m # found chain 1ufoA in training set T0296 155 :GINMTAVADM 1ufoA 34 :QGSKEHILAL T0296 174 :LSDMGVAKLVVFANAVEDNPFMAGAFHGVGEA 1ufoA 44 :LPGYAERGFLLLAFDAPRHGEREGPPPSSKSP T0296 233 :VVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSL 1ufoA 76 :RYVEEVYRVALGFKEEARRVAEEAERRFGLPLFLAGGSL T0296 297 :GTTAALALLN 1ufoA 115 :GAFVAHLLLA T0296 315 :MACNQVGGLSGAFIP 1ufoA 127 :FRPRGVLAFIGSGFP T0296 330 :VSEDEGMIAAVQN 1ufoA 149 :VVEDPGVLALYQA T0296 346 :NLEKLEAMTAICSVG 1ufoA 166 :RGEAYGGVPLLHLHG T0296 368 :EDTPAETIAAMIADE 1ufoA 184 :HIVPLARMEKTLEAL T0296 387 :VINMKTTAVRI 1ufoA 201 :HYPEGRLARFV Number of specific fragments extracted= 9 number of extra gaps= 0 total=519 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z41A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z41A expands to /projects/compbio/data/pdb/1z41.pdb.gz 1z41A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0296 read from 1z41A/merged-good-all-a2m # 1z41A read from 1z41A/merged-good-all-a2m # adding 1z41A to template set # found chain 1z41A in template set T0296 4 :RQVTETIAMIEEQNFDIRTITMGI 1z41A 39 :PFHMAHYISRAIGQVGLIIVEASA T0296 28 :SLLD 1z41A 64 :NPQG T0296 32 :CIDPDINRA 1z41A 76 :IWSDEHIEG T0296 55 :LVAVGDEIA 1z41A 85 :FAKLTEQVK T0296 65 :ELGIPIVNKRVSV 1z41A 94 :EQGSKIGIQLAHA T0296 82 :LIGA 1z41A 108 :RKAE T0296 87 :TDATDYVVLAKALDKAAK 1z41A 134 :MSAEKVKETVQEFKQAAA T0296 105 :EIGVDFIG 1z41A 155 :EAGFDVIE T0296 113 :GFSALV 1z41A 168 :GYLIHE T0296 120 :KGYQKGDE 1z41A 184 :DEYGGSPE T0296 128 :ILINSIPRALAET 1z41A 195 :RFLREIIDEVKQV T0296 141 :DKVCSSVNIG 1z41A 210 :GPLFVRVSAS T0296 151 :STKSGINMTAVADMGRIIKET 1z41A 221 :YTDKGLDIADHIGFAKWMKEQ T0296 179 :VAKLVVFANA 1z41A 242 :GVDLIDCSSG T0296 197 :GAFHGVGEADV 1z41A 255 :HADINVFPGYQ T0296 216 :PGVVKRALEKV 1z41A 266 :VSFAEKIREQA T0296 229 :QSFDVVAETVKKTA 1z41A 287 :TDGSMAEEILQNGR T0296 243 :FKITR 1z41A 308 :RELLR T0296 251 :LVGQMASERLGVE 1z41A 315 :FFARTAAKQLNTE T0296 272 :APTPAV 1z41A 328 :IPAPVQ Number of specific fragments extracted= 20 number of extra gaps= 0 total=539 Number of alignments=34 # 1z41A read from 1z41A/merged-good-all-a2m # found chain 1z41A in template set T0296 3 :IRQVTETIAMIEEQNFDIRTITMGI 1z41A 82 :IEGFAKLTEQVKEQGSKIGIQLAHA T0296 29 :LLDC 1z41A 107 :GRKA T0296 33 :IDPDI 1z41A 112 :LEGDI T0296 87 :TDATDYVVLAKALDKAAK 1z41A 134 :MSAEKVKETVQEFKQAAA T0296 105 :EIGVDFIG 1z41A 155 :EAGFDVIE T0296 113 :GFSALV 1z41A 168 :GYLIHE T0296 120 :KGYQKGDE 1z41A 184 :DEYGGSPE T0296 128 :ILINSIPRALAET 1z41A 195 :RFLREIIDEVKQV T0296 141 :DKVCSSVNIG 1z41A 210 :GPLFVRVSAS T0296 151 :STKSGINMTAVADMGRIIKET 1z41A 221 :YTDKGLDIADHIGFAKWMKEQ T0296 179 :VAKLVVFANA 1z41A 242 :GVDLIDCSSG T0296 197 :GAFHGVGEADV 1z41A 255 :HADINVFPGYQ T0296 216 :PGVVKRALEKV 1z41A 266 :VSFAEKIREQA T0296 229 :QSFDVVAETVKKTAFKITRIGQL 1z41A 287 :TDGSMAEEILQNGRADLIFIGRE T0296 252 :VGQMASERLGVEF 1z41A 316 :FARTAAKQLNTEI T0296 273 :PTPAVG 1z41A 329 :PAPVQY Number of specific fragments extracted= 16 number of extra gaps= 0 total=555 Number of alignments=35 # 1z41A read from 1z41A/merged-good-all-a2m # found chain 1z41A in template set T0296 4 :RQVTETIAMIEEQNFDIRTITMG 1z41A 39 :PFHMAHYISRAIGQVGLIIVEAS T0296 27 :ISLLDCIDPD 1z41A 63 :VNPQGRITDQ T0296 38 :N 1z41A 79 :D T0296 50 :TKAANLVAVGDEIAA 1z41A 80 :EHIEGFAKLTEQVKE T0296 66 :LGIPIVNK 1z41A 95 :QGSKIGIQ T0296 77 :VTPISLIGAAT 1z41A 103 :LAHAGRKAELE T0296 88 :DATDYVVLAKALDKAAK 1z41A 135 :SAEKVKETVQEFKQAAA T0296 105 :EIGVDFIGGFSA 1z41A 155 :EAGFDVIEIHAA T0296 120 :KGYQKGDEILINSIPRALAE 1z41A 184 :DEYGGSPENRYRFLREIIDE T0296 140 :TDKVCSSVNIG 1z41A 209 :DGPLFVRVSAS T0296 151 :STKSGINMTAVADMGRIIKET 1z41A 221 :YTDKGLDIADHIGFAKWMKEQ T0296 178 :GVAKLVVFANAVEDNPFMAGAFHGVG 1z41A 242 :GVDLIDCSSGALVHADINVFPGYQVS T0296 207 :VIINVG 1z41A 279 :ATGAVG T0296 213 :VSGPGVVKRALEK 1z41A 286 :ITDGSMAEEILQN T0296 228 :GQ 1z41A 299 :GR T0296 230 :SFDVVAETVKK 1z41A 302 :DLIFIGRELLR T0296 250 :QLVGQMASERLGVE 1z41A 314 :PFFARTAAKQLNTE Number of specific fragments extracted= 17 number of extra gaps= 0 total=572 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ur4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ur4A expands to /projects/compbio/data/pdb/1ur4.pdb.gz 1ur4A:# T0296 read from 1ur4A/merged-good-all-a2m # 1ur4A read from 1ur4A/merged-good-all-a2m # adding 1ur4A to template set # found chain 1ur4A in template set T0296 2 :DIRQVTETIAMIEEQNFDIRTITMGISL 1ur4A 87 :DLEKAIQIGKRATANGMKLLADFHYSDF T0296 30 :LDCIDPDINRAAEKIYQKITTKAANLVA 1ur4A 125 :KAWANLNFEDKKTALYQYTKQSLKAMKA T0296 66 :LGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIG 1ur4A 153 :AGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETD T0296 140 :TDKVCSSVNIGSTKSG 1ur4A 195 :SNILVALHFTNPETSG T0296 160 :AVADMGRIIKET 1ur4A 211 :RYAWIAETLHRH T0296 201 :GVGEA 1ur4A 223 :HVDYD T0296 208 :IINVGVSGP 1ur4A 228 :VFASSYYPF T0296 227 :RGQSFDVVAETVK 1ur4A 237 :WHGTLKNLTSVLT T0296 255 :MASERLGVEFGIVDLSLAPT 1ur4A 250 :SVADTYGKKVMVAETSYTYT T0296 275 :PAVGD 1ur4A 281 :PKNGQ T0296 289 :GLETVGTHGTTAALALLNDQVKKGGVMACN 1ur4A 287 :LNNPVTVQGQANAVRDVIQAVSDVGEAGIG T0296 320 :VGGLSGAFIPV 1ur4A 317 :VFYWEPAWIPV T0296 331 :SEDEGMIAAVQN 1ur4A 331 :HRLEKNKALWET Number of specific fragments extracted= 13 number of extra gaps= 0 total=585 Number of alignments=37 # 1ur4A read from 1ur4A/merged-good-all-a2m # found chain 1ur4A in template set T0296 2 :DIRQVTETIAMIEEQNFDIRTITMGISL 1ur4A 87 :DLEKAIQIGKRATANGMKLLADFHYSDF T0296 30 :LDCIDPDINRAAEKIYQKITTKAANLVA 1ur4A 125 :KAWANLNFEDKKTALYQYTKQSLKAMKA T0296 66 :LGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIG 1ur4A 153 :AGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRETD T0296 140 :TDKVCSSVNIGSTKSG 1ur4A 195 :SNILVALHFTNPETSG T0296 160 :AVADMGRIIKET 1ur4A 211 :RYAWIAETLHRH T0296 201 :GVGEA 1ur4A 223 :HVDYD T0296 208 :IINVGVSGP 1ur4A 228 :VFASSYYPF T0296 227 :RGQSFDVVAETVKK 1ur4A 237 :WHGTLKNLTSVLTS T0296 256 :ASERLGVEFGIVDLSLAPT 1ur4A 251 :VADTYGKKVMVAETSYTYT T0296 275 :PAVGD 1ur4A 281 :PKNGQ T0296 289 :GLETVGTHGTTAALALLNDQVKKGGVMACN 1ur4A 287 :LNNPVTVQGQANAVRDVIQAVSDVGEAGIG T0296 320 :VGGLSGAFIPV 1ur4A 317 :VFYWEPAWIPV T0296 331 :SEDEGMIAAVQN 1ur4A 331 :HRLEKNKALWET Number of specific fragments extracted= 13 number of extra gaps= 0 total=598 Number of alignments=38 # 1ur4A read from 1ur4A/merged-good-all-a2m # found chain 1ur4A in template set T0296 2 :DIRQVTETIAMIEEQNFDIRTITMGIS 1ur4A 87 :DLEKAIQIGKRATANGMKLLADFHYSD T0296 29 :LLDCIDPDINRAAEKIYQKITTKAANLVA 1ur4A 124 :PKAWANLNFEDKKTALYQYTKQSLKAMKA T0296 66 :LGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEI 1ur4A 153 :AGIDIGMVQVGNETNGGLAGETDWAKMSQLFNAGSQAVRET T0296 107 :GVDFIGGFSALV 1ur4A 196 :NILVALHFTNPE T0296 153 :KSG 1ur4A 208 :TSG T0296 160 :AVADMGRIIKETA 1ur4A 211 :RYAWIAETLHRHH T0296 179 :VAKLVVFANAV 1ur4A 225 :DYDVFASSYYP T0296 226 :VRGQSFDVVAETV 1ur4A 236 :FWHGTLKNLTSVL T0296 254 :QMASERLGVEFGIVDLSL 1ur4A 249 :TSVADTYGKKVMVAETSY T0296 272 :APTPAVG 1ur4A 280 :APKNGQT T0296 289 :GLETVGTHGTTAALALLNDQVKKGGV 1ur4A 287 :LNNPVTVQGQANAVRDVIQAVSDVGE T0296 316 :ACNQVGGLSGAFIPVS 1ur4A 313 :AGIGVFYWEPAWIPVG T0296 334 :EGMIAAVQN 1ur4A 334 :EKNKALWET Number of specific fragments extracted= 13 number of extra gaps= 0 total=611 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1e4iA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1e4iA expands to /projects/compbio/data/pdb/1e4i.pdb.gz 1e4iA:# T0296 read from 1e4iA/merged-good-all-a2m # 1e4iA read from 1e4iA/merged-good-all-a2m # adding 1e4iA to template set # found chain 1e4iA in template set Warning: unaligning (T0296)C32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)D90 Warning: unaligning (T0296)I33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)D90 Warning: unaligning (T0296)S76 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)W122 Warning: unaligning (T0296)V77 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)W122 Warning: unaligning (T0296)A186 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)N222 Warning: unaligning (T0296)N187 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)N222 Warning: unaligning (T0296)A272 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1e4iA)S297 Warning: unaligning (T0296)P273 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1e4iA)S297 Warning: unaligning (T0296)I398 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)S399 Warning: unaligning (T0296)P399 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)S399 T0296 3 :IRQVTETIAMIEEQNFDIRTITM 1e4iA 58 :YHRYEEDIRLMKELGIRTYRFSV T0296 29 :LLD 1e4iA 86 :FPN T0296 34 :DPDI 1e4iA 91 :GEVN T0296 46 :QKITTKAANLVAVGD 1e4iA 95 :QKGLDYYHRVVDLLN T0296 65 :ELGIPIVNKRV 1e4iA 110 :DNGIEPFCTLY T0296 78 :TPISLIGA 1e4iA 123 :DLPQALQD T0296 86 :ATDATDYVVLAKAL 1e4iA 133 :GWGNRRTIQAFVQF T0296 100 :DKAAKEI 1e4iA 148 :ETMFREF T0296 107 :GVDFIG 1e4iA 157 :KIQHWL T0296 113 :GFSALV 1e4iA 166 :EPWCIA T0296 119 :QKGYQKGDEILINSIPRALA 1e4iA 180 :HAPGLTNLQTAIDVGHHLLV T0296 160 :AVADMGRIIKETA 1e4iA 200 :AHGLSVRRFRELG T0296 179 :VAKLVVF 1e4iA 214 :SGQIGIA T0296 188 :AVE 1e4iA 223 :VSW T0296 210 :NVGVSGPGVVKRALEKV 1e4iA 226 :AVPYSTSEEDKAACART T0296 227 :RGQSFDVVAETVKKTAFKITR 1e4iA 256 :QGSYPQFLVDWFAEQGATVPI T0296 256 :ASERLGVEFGIVDLSL 1e4iA 280 :DMDIIGEPIDMIGINY T0296 274 :TPAVGD 1e4iA 304 :NPEAGF T0296 288 :MGLETVGTHGTTAALAL 1e4iA 323 :DIGWPVESRGLYEVLHY T0296 317 :CNQVGGLSGAFIPVS 1e4iA 340 :LQKYGNIDIYITENG T0296 342 :NGSLNLEKLEA 1e4iA 363 :NGKVQDDRRIS T0296 374 :TIAAMIADEAAIGVINMKTTAVRI 1e4iA 374 :YMQQHLVQVHRTIHDGLHVKGYMA Number of specific fragments extracted= 22 number of extra gaps= 5 total=633 Number of alignments=40 # 1e4iA read from 1e4iA/merged-good-all-a2m # found chain 1e4iA in template set Warning: unaligning (T0296)C32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)D90 Warning: unaligning (T0296)I33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)D90 Warning: unaligning (T0296)S76 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)W122 Warning: unaligning (T0296)V77 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)W122 Warning: unaligning (T0296)A186 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)N222 Warning: unaligning (T0296)N187 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)N222 Warning: unaligning (T0296)A272 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1e4iA)S297 Warning: unaligning (T0296)P273 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1e4iA)S297 Warning: unaligning (T0296)I398 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)S399 Warning: unaligning (T0296)P399 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)S399 T0296 3 :IRQVTETIAMIEEQNFDIRTITM 1e4iA 58 :YHRYEEDIRLMKELGIRTYRFSV T0296 29 :LLD 1e4iA 86 :FPN T0296 34 :DPDIN 1e4iA 91 :GEVNQ T0296 47 :KITTKAANLVAVGD 1e4iA 96 :KGLDYYHRVVDLLN T0296 65 :ELGIPIVNKRV 1e4iA 110 :DNGIEPFCTLY T0296 78 :TPISLIGAA 1e4iA 123 :DLPQALQDA T0296 87 :TDATDYVVLAKAL 1e4iA 134 :WGNRRTIQAFVQF T0296 100 :DKAAKEI 1e4iA 148 :ETMFREF T0296 107 :GVDFIG 1e4iA 157 :KIQHWL T0296 113 :GFSALV 1e4iA 166 :EPWCIA T0296 119 :QKGYQKGDEILINSIPRAL 1e4iA 180 :HAPGLTNLQTAIDVGHHLL T0296 159 :TAVADMGRIIKET 1e4iA 199 :VAHGLSVRRFREL T0296 175 :SDM 1e4iA 212 :GTS T0296 180 :AKLVVF 1e4iA 215 :GQIGIA T0296 188 :AVE 1e4iA 223 :VSW T0296 210 :NVGVSGPGVVKRALEKV 1e4iA 226 :AVPYSTSEEDKAACART T0296 227 :RGQSFDVVAETVKKTAFKITRI 1e4iA 256 :QGSYPQFLVDWFAEQGATVPIQ T0296 249 :G 1e4iA 279 :G T0296 256 :ASERLGVEFGIVDLSL 1e4iA 280 :DMDIIGEPIDMIGINY T0296 274 :TPAVGD 1e4iA 304 :NPEAGF T0296 288 :MGLETVGTHGTTAALAL 1e4iA 323 :DIGWPVESRGLYEVLHY T0296 317 :CNQVGGLSGAFIPVS 1e4iA 340 :LQKYGNIDIYITENG T0296 342 :NGSLNLEKLEA 1e4iA 363 :NGKVQDDRRIS T0296 374 :TIAAMIADEAAIGVINMKTTAVRI 1e4iA 374 :YMQQHLVQVHRTIHDGLHVKGYMA Number of specific fragments extracted= 24 number of extra gaps= 5 total=657 Number of alignments=41 # 1e4iA read from 1e4iA/merged-good-all-a2m # found chain 1e4iA in template set Warning: unaligning (T0296)G84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)D90 Warning: unaligning (T0296)A85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)D90 Warning: unaligning (T0296)S270 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1e4iA)N222 Warning: unaligning (T0296)L271 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1e4iA)N222 T0296 49 :TTKAANLVAVGDEI 1e4iA 58 :YHRYEEDIRLMKEL T0296 67 :GIPIVNKRVSVTPISLI 1e4iA 72 :GIRTYRFSVSWPRIFPN T0296 86 :ATDATDYVVLAKALDKAAKEIGVDFIG 1e4iA 91 :GEVNQKGLDYYHRVVDLLNDNGIEPFC T0296 113 :GFSALVQKGYQKGDEI 1e4iA 124 :LPQALQDAGGWGNRRT T0296 158 :MTAVADMGRIIKETA 1e4iA 140 :IQAFVQFAETMFREF T0296 177 :MGVAKLVVFANAVE 1e4iA 155 :HGKIQHWLTFNEPW T0296 195 :MAGAFHGVGEADV 1e4iA 172 :FLSNMLGVHAPGL T0296 229 :QSFDVV 1e4iA 185 :TNLQTA T0296 239 :KKTAFKITRIGQLVGQMA 1e4iA 191 :IDVGHHLLVAHGLSVRRF T0296 258 :ERLGVEFGIVDL 1e4iA 209 :RELGTSGQIGIA T0296 272 :APT 1e4iA 223 :VSW T0296 275 :PAVGD 1e4iA 230 :STSEE T0296 280 :SVARVLEEM 1e4iA 238 :ACARTISLH T0296 298 :TTAALALLND 1e4iA 247 :SDWFLQPIYQ T0296 321 :GG 1e4iA 257 :GS T0296 332 :EDEGMIAAVQNGSLN 1e4iA 259 :YPQFLVDWFAEQGAT T0296 364 :IAIPED 1e4iA 274 :VPIQDG T0296 384 :AIGVINMKTTAVRII 1e4iA 280 :DMDIIGEPIDMIGIN Number of specific fragments extracted= 18 number of extra gaps= 2 total=675 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vhwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1vhwA/merged-good-all-a2m # 1vhwA read from 1vhwA/merged-good-all-a2m # found chain 1vhwA in training set T0296 145 :SSVNIGSTKSG 1vhwA 56 :RRISVMGHGMG T0296 158 :MTAVADMGRIIKETA 1vhwA 67 :IPSCSIYVTELIKDY T0296 178 :GVAKLVVFANA 1vhwA 82 :GVKKIIRVGSC T0296 190 :E 1vhwA 94 :A T0296 198 :AFHGVGEADVIINVGVS 1vhwA 95 :VNEGIKVRDVVIGMGAC T0296 215 :GPGVV 1vhwA 113 :DSKVN T0296 223 :LEKVRGQS 1vhwA 118 :RIRFKDHD T0296 232 :DVVAETVKK 1vhwA 132 :YKMVKAAEE T0296 256 :ASERLGVEFGIVDLSLAPTPAVGD 1vhwA 141 :AAKARGIDVKVGNLFSAELFYTPD T0296 280 :SVARVLEEMGLETVGTH 1vhwA 166 :SMFDVMDKYGIVGVEME T0296 302 :LALLNDQVKKGGVMAC 1vhwA 183 :AAGIYGVAAEYGAKAL T0296 355 :AICSVG 1vhwA 199 :AICTVS T0296 362 :DMIAIPEDTPAETIAAMIADEAAIGV 1vhwA 205 :DHIKTGEQTTSEERQNTFNEMIEIAL Number of specific fragments extracted= 13 number of extra gaps= 0 total=688 Number of alignments=43 # 1vhwA read from 1vhwA/merged-good-all-a2m # found chain 1vhwA in training set T0296 145 :SSVNIGSTKSG 1vhwA 56 :RRISVMGHGMG T0296 158 :MTAVADMGRIIKETA 1vhwA 67 :IPSCSIYVTELIKDY T0296 178 :GVAKLVVFANAVE 1vhwA 82 :GVKKIIRVGSCGA T0296 198 :AFHGVGEADVIINVGVS 1vhwA 95 :VNEGIKVRDVVIGMGAC T0296 215 :GPGVV 1vhwA 113 :DSKVN T0296 223 :LEKVRGQS 1vhwA 118 :RIRFKDHD T0296 232 :DVVAETVKK 1vhwA 132 :YKMVKAAEE T0296 256 :ASERLGVEFGIVDLSLAPTPAVGD 1vhwA 141 :AAKARGIDVKVGNLFSAELFYTPD T0296 280 :SVARVLEEMGLETVGTH 1vhwA 166 :SMFDVMDKYGIVGVEME T0296 302 :LALLNDQVKKGGVMAC 1vhwA 183 :AAGIYGVAAEYGAKAL T0296 355 :AICSVG 1vhwA 199 :AICTVS T0296 362 :DMIAIPEDTPAETIAAMIADEAAIGV 1vhwA 205 :DHIKTGEQTTSEERQNTFNEMIEIAL Number of specific fragments extracted= 12 number of extra gaps= 0 total=700 Number of alignments=44 # 1vhwA read from 1vhwA/merged-good-all-a2m # found chain 1vhwA in training set T0296 75 :VSVTPISL 1vhwA 16 :VVLMPGDP T0296 97 :KALDKAAKEI 1vhwA 24 :LRAKYIAENF T0296 111 :IGGFSALVQKGYQK 1vhwA 34 :LDNAVQVCDVRNMF T0296 139 :ETDKVCSS 1vhwA 54 :KGRRISVM T0296 153 :KSGINMTAVADMGRIIKETAN 1vhwA 62 :GHGMGIPSCSIYVTELIKDYG T0296 179 :VAKLVVFANAVEDNP 1vhwA 83 :VKKIIRVGSCGAVNE T0296 201 :GVGEADVIINVGVS 1vhwA 98 :GIKVRDVVIGMGAC T0296 215 :GPGVVKR 1vhwA 113 :DSKVNRI T0296 225 :KVRGQSFD 1vhwA 120 :RFKDHDFA T0296 233 :VVAETVKKTAFK 1vhwA 129 :IADYKMVKAAEE T0296 256 :ASERLGVEFGIVDLSLAPTPAVGD 1vhwA 141 :AAKARGIDVKVGNLFSAELFYTPD T0296 280 :SVARVLEEMGLETVGTH 1vhwA 166 :SMFDVMDKYGIVGVEME T0296 302 :LALLNDQVKKGGV 1vhwA 183 :AAGIYGVAAEYGA T0296 325 :GA 1vhwA 196 :KA T0296 354 :TAICSVG 1vhwA 198 :LAICTVS T0296 362 :DMIAIPEDTPAETIAAMIADEAAIGV 1vhwA 205 :DHIKTGEQTTSEERQNTFNEMIEIAL Number of specific fragments extracted= 16 number of extra gaps= 0 total=716 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j0dA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1j0dA expands to /projects/compbio/data/pdb/1j0d.pdb.gz 1j0dA:# T0296 read from 1j0dA/merged-good-all-a2m # 1j0dA read from 1j0dA/merged-good-all-a2m # adding 1j0dA to template set # found chain 1j0dA in template set T0296 10 :IAMIEEQNFDIRTITMG 1j0dA 59 :VPDIVEGDYTHLVSIGG T0296 56 :VAVGDEIAAELGIPIVNKRVS 1j0dA 81 :TRMVAALAAKLGKKCVLIQED T0296 77 :VTPISLIGAATDATDYV 1j0dA 103 :VPIPEAEKDVYNRVGNI T0296 101 :KAAKEIGVDFIG 1j0dA 120 :ELSRIMGADVRV T0296 121 :GYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANA 1j0dA 135 :GFDIGMRKSFANALQELEDAGHKPYPIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVT T0296 196 :AGAFHGVGEADVIINVGVSG 1j0dA 210 :LAGMAQYGRQDDVIAIDASF T0296 230 :SFDVVAETVKK 1j0dA 230 :TSEKTKEQTLR T0296 252 :VGQMASERLGVE 1j0dA 241 :IANNTAKLIGVE T0296 267 :VDLSLA 1j0dA 260 :LDTRFA T0296 273 :PTPAVGDSVARVLEEMGLETVGTH 1j0dA 272 :PNEGTIEAIRTCAEQEGVLTDPVY T0296 298 :TTAALALLNDQVKK 1j0dA 296 :EGKSMQGLIALIKE T0296 343 :G 1j0dA 310 :D Number of specific fragments extracted= 12 number of extra gaps= 0 total=728 Number of alignments=46 # 1j0dA read from 1j0dA/merged-good-all-a2m # found chain 1j0dA in template set T0296 10 :IAMIEEQNFDIRTITMG 1j0dA 59 :VPDIVEGDYTHLVSIGG T0296 55 :LVAVGDEIAAELGIPIVNKRVS 1j0dA 80 :QTRMVAALAAKLGKKCVLIQED T0296 77 :VTPISLIGAATDATDYV 1j0dA 103 :VPIPEAEKDVYNRVGNI T0296 101 :KAAKEIGVDFIG 1j0dA 120 :ELSRIMGADVRV T0296 121 :GYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANA 1j0dA 135 :GFDIGMRKSFANALQELEDAGHKPYPIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVT T0296 196 :AGAFHGVGEADVIINVGVSG 1j0dA 210 :LAGMAQYGRQDDVIAIDASF T0296 230 :SFDVVAETVKK 1j0dA 230 :TSEKTKEQTLR T0296 252 :VGQMASERLGVE 1j0dA 241 :IANNTAKLIGVE T0296 267 :VDLSLA 1j0dA 260 :LDTRFA T0296 273 :PTPAVGDSVARVLEEMGLETVGTH 1j0dA 272 :PNEGTIEAIRTCAEQEGVLTDPVY T0296 298 :TTAALALLNDQVKK 1j0dA 296 :EGKSMQGLIALIKE T0296 343 :G 1j0dA 310 :D Number of specific fragments extracted= 12 number of extra gaps= 0 total=740 Number of alignments=47 # 1j0dA read from 1j0dA/merged-good-all-a2m # found chain 1j0dA in template set T0296 10 :IAMIEEQNFD 1j0dA 59 :VPDIVEGDYT T0296 21 :RTITMGISLLD 1j0dA 69 :HLVSIGGRQSN T0296 55 :LVAVGDEIAAELGIPIVNKRVSVTPI 1j0dA 80 :QTRMVAALAAKLGKKCVLIQEDWVPI T0296 81 :SLIGAATDATDYVVLAKA 1j0dA 107 :EAEKDVYNRVGNIELSRI T0296 106 :IGVDFIGG 1j0dA 125 :MGADVRVI T0296 119 :QKGYQ 1j0dA 133 :EDGFD T0296 124 :KGDEILINSIPRALAETDKVC 1j0dA 139 :GMRKSFANALQELEDAGHKPY T0296 146 :SVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSG 1j0dA 160 :PIPAGCSEHKYGGLGFVGFADEVINQEVELGIKFDKIVVCCVTGSTTAGILAGMAQYGRQDDVIAIDASF T0296 234 :VAETVKKTAFK 1j0dA 230 :TSEKTKEQTLR T0296 252 :VGQMASERLGVE 1j0dA 241 :IANNTAKLIGVE T0296 267 :VDLSLA 1j0dA 260 :LDTRFA T0296 273 :PTPAVGDSVARVLEEMGLETVG 1j0dA 272 :PNEGTIEAIRTCAEQEGVLTDP T0296 296 :HGTTAALALLNDQVKK 1j0dA 294 :VYEGKSMQGLIALIKE Number of specific fragments extracted= 13 number of extra gaps= 0 total=753 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qtwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1qtwA/merged-good-all-a2m # 1qtwA read from 1qtwA/merged-good-all-a2m # found chain 1qtwA in training set Warning: unaligning (T0296)G84 because of BadResidue code BAD_PEPTIDE in next template residue (1qtwA)M115 Warning: unaligning (T0296)A85 because of BadResidue code BAD_PEPTIDE at template residue (1qtwA)M115 Warning: unaligning (T0296)V213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qtwA)I263 Warning: unaligning (T0296)S214 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qtwA)I263 T0296 1 :MDIRQVTETIAMIEEQNFD 1qtwA 44 :LTTQTIDEFKAACEKYHYT T0296 29 :LLDCIDPDI 1qtwA 66 :ILPHDSYLI T0296 38 :NRAAEKIYQKITTKAA 1qtwA 81 :TEALEKSRDAFIDEMQ T0296 62 :IAAELGIPIVNKRV 1qtwA 97 :RCEQLGLSLLNFHP T0296 83 :I 1qtwA 113 :H T0296 86 :ATDATDYVVLAKAL 1qtwA 116 :QISEEDCLARIAES T0296 100 :DKAAKEI 1qtwA 131 :NIALDKT T0296 107 :GVDFIG 1qtwA 139 :GVTAVI T0296 119 :QKGYQKGDEILINSIPRALAETDKVCSSVN 1qtwA 150 :QGSNLGFKFEHLAAIIDGVEDKSRVGVCID T0296 155 :GI 1qtwA 187 :GY T0296 157 :NMTAVADMGRIIKETANL 1qtwA 192 :TPAECEKTFADFARTVGF T0296 178 :GVAKLVVFANAVEDNPFMAGAFHGVGEAD 1qtwA 210 :KYLRGMHLNDAKSTFGSRVDRHHSLGEGN T0296 207 :VIINVG 1qtwA 256 :IPLILE T0296 215 :GPGVVKRALEKVRG 1qtwA 264 :NPDIWAEEIAWLKA Number of specific fragments extracted= 14 number of extra gaps= 2 total=767 Number of alignments=49 # 1qtwA read from 1qtwA/merged-good-all-a2m # found chain 1qtwA in training set Warning: unaligning (T0296)G84 because of BadResidue code BAD_PEPTIDE in next template residue (1qtwA)M115 Warning: unaligning (T0296)A85 because of BadResidue code BAD_PEPTIDE at template residue (1qtwA)M115 Warning: unaligning (T0296)V213 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qtwA)I263 Warning: unaligning (T0296)S214 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qtwA)I263 T0296 1 :MDIRQVTETIAMIEEQNFD 1qtwA 44 :LTTQTIDEFKAACEKYHYT T0296 29 :LLDCIDPDI 1qtwA 66 :ILPHDSYLI T0296 38 :NRAAEKIYQKITTKAA 1qtwA 81 :TEALEKSRDAFIDEMQ T0296 62 :IAAELGIPIVNKRV 1qtwA 97 :RCEQLGLSLLNFHP T0296 83 :I 1qtwA 113 :H T0296 86 :ATDATDYVVLAKAL 1qtwA 116 :QISEEDCLARIAES T0296 100 :DKAAKEI 1qtwA 131 :NIALDKT T0296 107 :GVDFIG 1qtwA 139 :GVTAVI T0296 119 :QKGYQKGDEILINSIPRALAETDKVCSSVN 1qtwA 150 :QGSNLGFKFEHLAAIIDGVEDKSRVGVCID T0296 155 :GI 1qtwA 187 :GY T0296 157 :NMTAVADMGRIIKETANL 1qtwA 192 :TPAECEKTFADFARTVGF T0296 178 :GVAKLVVFANAVEDNPFMAGAFHGVGEAD 1qtwA 210 :KYLRGMHLNDAKSTFGSRVDRHHSLGEGN T0296 207 :VIINVG 1qtwA 256 :IPLILE T0296 215 :GPGVVKRALEKVRG 1qtwA 264 :NPDIWAEEIAWLKA Number of specific fragments extracted= 14 number of extra gaps= 2 total=781 Number of alignments=50 # 1qtwA read from 1qtwA/merged-good-all-a2m # found chain 1qtwA in training set Warning: unaligning (T0296)G84 because of BadResidue code BAD_PEPTIDE in next template residue (1qtwA)M115 Warning: unaligning (T0296)A85 because of BadResidue code BAD_PEPTIDE at template residue (1qtwA)M115 Warning: unaligning (T0296)S270 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qtwA)I263 Warning: unaligning (T0296)L271 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qtwA)I263 Warning: unaligning (T0296)T292 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1qtwA)V284 Warning: unaligning (T0296)V293 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1qtwA)V284 T0296 2 :DIRQVTETIAMIEEQNFD 1qtwA 45 :TTQTIDEFKAACEKYHYT T0296 30 :LDCIDPDI 1qtwA 67 :LPHDSYLI T0296 38 :NRAAEKIYQKITTKA 1qtwA 81 :TEALEKSRDAFIDEM T0296 57 :AVG 1qtwA 96 :QRC T0296 64 :AELGIPIVN 1qtwA 99 :EQLGLSLLN T0296 77 :VTPISL 1qtwA 108 :FHPGSH T0296 86 :ATDATDYVVLAKA 1qtwA 116 :QISEEDCLARIAE T0296 99 :LDKAAKEI 1qtwA 130 :INIALDKT T0296 107 :GVDFIGGFSA 1qtwA 139 :GVTAVIENTA T0296 118 :VQKGYQKGDEILINSIPRALAETDKVCSSVN 1qtwA 149 :GQGSNLGFKFEHLAAIIDGVEDKSRVGVCID T0296 154 :SGINMTAVADMGRIIKETANLSD 1qtwA 189 :DLRTPAECEKTFADFARTVGFKY T0296 180 :AKLVVFANAVEDNPFMAGAFHGVGEADV 1qtwA 212 :LRGMHLNDAKSTFGSRVDRHHSLGEGNI T0296 215 :GPGVVKRALE 1qtwA 240 :GHDAFRWIMQ T0296 225 :KVRG 1qtwA 252 :RFDG T0296 264 :FGIVDL 1qtwA 256 :IPLILE T0296 272 :AP 1qtwA 264 :NP T0296 275 :PAVGDSVARVLEEMGLE 1qtwA 266 :DIWAEEIAWLKAQQTEK Number of specific fragments extracted= 17 number of extra gaps= 3 total=798 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p1xA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0296 read from 1p1xA/merged-good-all-a2m # 1p1xA read from 1p1xA/merged-good-all-a2m # found chain 1p1xA in training set Warning: unaligning (T0296)L29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p1xA)F76 Warning: unaligning (T0296)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p1xA)F76 Warning: unaligning (T0296)L117 because of BadResidue code BAD_PEPTIDE in next template residue (1p1xA)K146 Warning: unaligning (T0296)G125 because of BadResidue code BAD_PEPTIDE at template residue (1p1xA)K146 Warning: unaligning (T0296)V147 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p1xA)S169 Warning: unaligning (T0296)N148 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p1xA)S169 Warning: unaligning (T0296)G150 because of BadResidue code BAD_PEPTIDE in next template residue (1p1xA)K172 Warning: unaligning (T0296)S151 because of BadResidue code BAD_PEPTIDE at template residue (1p1xA)K172 Warning: unaligning (T0296)L290 because last residue in template chain is (1p1xA)H250 T0296 1 :MDIRQVTETIAMIEEQN 1p1xA 48 :IYPRFIPIARKTLKEQG T0296 18 :FDIRTIT 1p1xA 68 :IRIATVT T0296 31 :DCIDPDINRAAEKIYQKI 1p1xA 77 :PHGNDDIDIALAETRAAI T0296 65 :ELGIPIVN 1p1xA 95 :AYGADEVD T0296 76 :SVTPISLIGAA 1p1xA 103 :VVFPYRALMAG T0296 88 :DATDYVVLAKALDKAAKEIGVDFIG 1p1xA 114 :NEQVGFDLVKACKEACAAANVLLKV T0296 113 :GFSA 1p1xA 141 :ETGE T0296 126 :DEILINSIPRALAETDKVCSS 1p1xA 147 :DEALIRKASEISIKAGADFIK T0296 149 :I 1p1xA 170 :T T0296 152 :TKSGINMTAVADMGRIIKETANLSD 1p1xA 173 :VAVNATPESARIMMEVIRDMGVEKT T0296 180 :AKLVVF 1p1xA 198 :VGFKPA T0296 200 :HGVGE 1p1xA 204 :GGVRT T0296 231 :FDV 1p1xA 209 :AED T0296 249 :GQLVGQMASERLG 1p1xA 212 :AQKYLAIADELFG T0296 264 :FGIVD 1p1xA 233 :YRFGA T0296 278 :GDSVARVLEEMG 1p1xA 238 :SSLLASLLKALG Number of specific fragments extracted= 16 number of extra gaps= 4 total=814 Number of alignments=52 # 1p1xA read from 1p1xA/merged-good-all-a2m # found chain 1p1xA in training set Warning: unaligning (T0296)L29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p1xA)F76 Warning: unaligning (T0296)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p1xA)F76 Warning: unaligning (T0296)L117 because of BadResidue code BAD_PEPTIDE in next template residue (1p1xA)K146 Warning: unaligning (T0296)G125 because of BadResidue code BAD_PEPTIDE at template residue (1p1xA)K146 Warning: unaligning (T0296)V147 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p1xA)S169 Warning: unaligning (T0296)N148 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p1xA)S169 Warning: unaligning (T0296)G150 because of BadResidue code BAD_PEPTIDE in next template residue (1p1xA)K172 Warning: unaligning (T0296)S151 because of BadResidue code BAD_PEPTIDE at template residue (1p1xA)K172 Warning: unaligning (T0296)L290 because last residue in template chain is (1p1xA)H250 T0296 1 :MDIRQVTETIAMIEEQNF 1p1xA 48 :IYPRFIPIARKTLKEQGT T0296 20 :IRTITMG 1p1xA 68 :IRIATVT T0296 31 :DCIDPDINRAAEKIYQKI 1p1xA 77 :PHGNDDIDIALAETRAAI T0296 65 :ELGIPIVNK 1p1xA 95 :AYGADEVDV T0296 77 :VTPISLIGAA 1p1xA 104 :VFPYRALMAG T0296 88 :DATDYVVLAKALDKAAKEIGVDFIG 1p1xA 114 :NEQVGFDLVKACKEACAAANVLLKV T0296 113 :GFSA 1p1xA 141 :ETGE T0296 126 :DEILINSIPRALAETDKVCSS 1p1xA 147 :DEALIRKASEISIKAGADFIK T0296 149 :I 1p1xA 170 :T T0296 152 :TKSGINMTAVADMGRIIKETANLSD 1p1xA 173 :VAVNATPESARIMMEVIRDMGVEKT T0296 180 :AKLVVFANAVE 1p1xA 198 :VGFKPAGGVRT T0296 216 :PGVVKR 1p1xA 209 :AEDAQK T0296 252 :VGQMASERLG 1p1xA 215 :YLAIADELFG T0296 264 :FGIVD 1p1xA 233 :YRFGA T0296 278 :GDSVARVLEEMG 1p1xA 238 :SSLLASLLKALG Number of specific fragments extracted= 15 number of extra gaps= 4 total=829 Number of alignments=53 # 1p1xA read from 1p1xA/merged-good-all-a2m # found chain 1p1xA in training set Warning: unaligning (T0296)L29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p1xA)F76 Warning: unaligning (T0296)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p1xA)F76 Warning: unaligning (T0296)Q119 because of BadResidue code BAD_PEPTIDE in next template residue (1p1xA)K146 Warning: unaligning (T0296)G125 because of BadResidue code BAD_PEPTIDE at template residue (1p1xA)K146 Warning: unaligning (T0296)V147 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p1xA)S169 Warning: unaligning (T0296)N148 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p1xA)S169 Warning: unaligning (T0296)G150 because of BadResidue code BAD_PEPTIDE in next template residue (1p1xA)K172 Warning: unaligning (T0296)S151 because of BadResidue code BAD_PEPTIDE at template residue (1p1xA)K172 Warning: unaligning (T0296)L290 because last residue in template chain is (1p1xA)H250 T0296 3 :IRQVTETIAMIEEQNFD 1p1xA 50 :PRFIPIARKTLKEQGTP T0296 20 :IRTITMG 1p1xA 68 :IRIATVT T0296 31 :DCIDPDINR 1p1xA 77 :PHGNDDIDI T0296 55 :LVAVGDEIAA 1p1xA 86 :ALAETRAAIA T0296 66 :LGIPIVN 1p1xA 96 :YGADEVD T0296 76 :SVTPISLIGA 1p1xA 103 :VVFPYRALMA T0296 87 :TDATDYVVLAKALDKAAKEIGVDFIGGFSALV 1p1xA 113 :GNEQVGFDLVKACKEACAAANVLLKVIIETGE T0296 126 :DEILINSIPRALAETDKVCSS 1p1xA 147 :DEALIRKASEISIKAGADFIK T0296 149 :I 1p1xA 170 :T T0296 152 :TKSGINMTAVADMGRIIKETANLSD 1p1xA 173 :VAVNATPESARIMMEVIRDMGVEKT T0296 180 :AKLV 1p1xA 198 :VGFK T0296 198 :AFHGVGEA 1p1xA 202 :PAGGVRTA T0296 247 :RIGQLVGQMASERLG 1p1xA 210 :EDAQKYLAIADELFG T0296 264 :FGI 1p1xA 235 :FGA T0296 270 :S 1p1xA 238 :S T0296 279 :DSVARVLEEMG 1p1xA 239 :SLLASLLKALG Number of specific fragments extracted= 16 number of extra gaps= 4 total=845 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1brwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1brwA expands to /projects/compbio/data/pdb/1brw.pdb.gz 1brwA:# T0296 read from 1brwA/merged-good-all-a2m # 1brwA read from 1brwA/merged-good-all-a2m # adding 1brwA to template set # found chain 1brwA in template set Warning: unaligning (T0296)G113 because of BadResidue code BAD_PEPTIDE in next template residue (1brwA)T154 T0296 1 :MDIRQVTETIAMIEEQNF 1brwA 16 :LTKEEIEWIVRGYTNGDI T0296 33 :IDPDINRAAEKIY 1brwA 34 :PDYQMSALAMAIY T0296 46 :QKITTKAANLVA 1brwA 53 :EETAALTMAMVQ T0296 66 :LGIPIVNKRVS 1brwA 102 :VGVPVAKMSGR T0296 77 :VTPISLIGA 1brwA 117 :TGGTIDKLE T0296 86 :ATDATDYVVL 1brwA 133 :EISKDEFIRL T0296 103 :AKEIGVDFIG 1brwA 143 :VNENGIAIIG T0296 114 :FSALVQKGYQKGDEILINSIP 1brwA 164 :LYALRDVTATVNSIPLIASSI T0296 135 :RALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVV 1brwA 188 :KIAAGADAIVLDVKTGAGAFMKKLDEARRLARVMVDIGKRVGRRTMAVIS T0296 187 :NAVE 1brwA 238 :DMSQ T0296 195 :MAGA 1brwA 242 :PLGY T0296 212 :GVSGPGVVKRALEKVRGQSFDVVA 1brwA 246 :AVGNALEVKEAIETLKGNGPHDLT T0296 247 :RIGQLVGQMASERLG 1brwA 270 :ELCLTLGSHMVYLAE T0296 273 :PTPAVG 1brwA 285 :KAPSLD T0296 300 :AALALLNDQVKKGGVMAC 1brwA 291 :EARRLLEEAIRSGAAIAA T0296 336 :MIAAVQNGSL 1brwA 309 :FKTFLAAQGG T0296 346 :NLEKLEAMTA 1brwA 325 :DLDKLPKAAY T0296 361 :LDMIAIPED 1brwA 335 :TSTVTAAAD T0296 375 :IAAMIADEAAIGV 1brwA 351 :ADDIGTAAMWLGA T0296 400 :KGKEGD 1brwA 365 :RAKKED T0296 406 :MIEFGGLLGT 1brwA 377 :GIVLHKKIGD T0296 420 :KVNGAS 1brwA 387 :RVQKGE Number of specific fragments extracted= 22 number of extra gaps= 1 total=867 Number of alignments=55 # 1brwA read from 1brwA/merged-good-all-a2m # found chain 1brwA in template set Warning: unaligning (T0296)G113 because of BadResidue code BAD_PEPTIDE in next template residue (1brwA)T154 T0296 1 :MDIRQVTETIAMIEEQNF 1brwA 16 :LTKEEIEWIVRGYTNGDI T0296 33 :IDPDINRAAEKIY 1brwA 34 :PDYQMSALAMAIY T0296 46 :QKITTKAANLVA 1brwA 53 :EETAALTMAMVQ T0296 66 :LGIPIVNKRVS 1brwA 102 :VGVPVAKMSGR T0296 77 :VTPISLIGAA 1brwA 117 :TGGTIDKLES T0296 87 :TDATDYVVL 1brwA 134 :ISKDEFIRL T0296 103 :AKEIGVDFIG 1brwA 143 :VNENGIAIIG T0296 114 :FSALVQKGYQKGDEILINSIP 1brwA 164 :LYALRDVTATVNSIPLIASSI T0296 135 :RALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVV 1brwA 188 :KIAAGADAIVLDVKTGAGAFMKKLDEARRLARVMVDIGKRVGRRTMAVIS T0296 187 :NAVE 1brwA 238 :DMSQ T0296 195 :MAGA 1brwA 242 :PLGY T0296 212 :GVSGPGVVKRALEKVRGQSFDVVAETVK 1brwA 246 :AVGNALEVKEAIETLKGNGPHDLTELCL T0296 251 :LVGQMASERLG 1brwA 274 :TLGSHMVYLAE T0296 273 :PTPAVG 1brwA 285 :KAPSLD T0296 300 :AALALLNDQVKKGGVMAC 1brwA 291 :EARRLLEEAIRSGAAIAA T0296 336 :MIAAVQNGSL 1brwA 309 :FKTFLAAQGG T0296 346 :NLEKLEAMTA 1brwA 325 :DLDKLPKAAY T0296 361 :LDMIAIPED 1brwA 335 :TSTVTAAAD T0296 375 :IAAMIADEAAIGV 1brwA 351 :ADDIGTAAMWLGA T0296 400 :KGKEGD 1brwA 365 :RAKKED T0296 406 :MIEFGGLLGT 1brwA 377 :GIVLHKKIGD T0296 420 :KVNGAS 1brwA 387 :RVQKGE Number of specific fragments extracted= 22 number of extra gaps= 1 total=889 Number of alignments=56 # 1brwA read from 1brwA/merged-good-all-a2m # found chain 1brwA in template set Warning: unaligning (T0296)G113 because of BadResidue code BAD_PEPTIDE in next template residue (1brwA)T154 Warning: unaligning (T0296)F114 because of BadResidue code BAD_PEPTIDE at template residue (1brwA)T154 Warning: unaligning (T0296)K120 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1brwA)D156 Warning: unaligning (T0296)G121 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1brwA)D156 T0296 66 :LGIPIVN 1brwA 102 :VGVPVAK T0296 75 :VSVTPISLIGAAT 1brwA 109 :MSGRGLGHTGGTI T0296 88 :DATDY 1brwA 135 :SKDEF T0296 100 :DKAAKEIGVDFIG 1brwA 140 :IRLVNENGIAIIG T0296 122 :YQKGDEILINSIPR 1brwA 157 :LTPADKKLYALRDV T0296 136 :ALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSD 1brwA 189 :IAAGADAIVLDVKTGAGAFMKKLDEARRLARVMVDIGKRVG T0296 180 :AKLVVFANAVED 1brwA 230 :RRTMAVISDMSQ T0296 198 :AFH 1brwA 242 :PLG T0296 211 :VGVSGPGVVKRALEKVRGQSFDVVAE 1brwA 245 :YAVGNALEVKEAIETLKGNGPHDLTE T0296 248 :IGQLVGQMASERLGV 1brwA 271 :LCLTLGSHMVYLAEK T0296 272 :APTPA 1brwA 286 :APSLD T0296 300 :AALALLNDQVKKGGVMA 1brwA 291 :EARRLLEEAIRSGAAIA T0296 335 :GMIAAVQNGSL 1brwA 308 :AFKTFLAAQGG T0296 346 :NLEKLEAMT 1brwA 325 :DLDKLPKAA T0296 362 :DMIAIPED 1brwA 336 :STVTAAAD T0296 375 :IAAMIADEAAIGV 1brwA 351 :ADDIGTAAMWLGA T0296 399 :PKGKE 1brwA 364 :GRAKK T0296 404 :GDMIEFGGLLGT 1brwA 375 :AVGIVLHKKIGD T0296 420 :KVNGAS 1brwA 387 :RVQKGE Number of specific fragments extracted= 19 number of extra gaps= 1 total=908 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1uhvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1uhvA expands to /projects/compbio/data/pdb/1uhv.pdb.gz 1uhvA:# T0296 read from 1uhvA/merged-good-all-a2m # 1uhvA read from 1uhvA/merged-good-all-a2m # adding 1uhvA to template set # found chain 1uhvA in template set Warning: unaligning (T0296)G26 because of BadResidue code BAD_PEPTIDE in next template residue (1uhvA)F102 Warning: unaligning (T0296)I27 because of BadResidue code BAD_PEPTIDE at template residue (1uhvA)F102 Warning: unaligning (T0296)A326 because of BadResidue code BAD_PEPTIDE in next template residue (1uhvA)T316 Warning: unaligning (T0296)F327 because of BadResidue code BAD_PEPTIDE at template residue (1uhvA)T316 T0296 2 :DIRQVTETIAMIEEQNFDI 1uhvA 78 :NFTYIDRIFDSFLEIGIRP T0296 22 :TITM 1uhvA 97 :FVEI T0296 28 :SLLDCIDPDI 1uhvA 103 :MPKKLASGTQ T0296 41 :AEKIYQKITTKAANLVAVGDE 1uhvA 127 :YEKWSDLVKAVLHHFISRYGI T0296 63 :AAELGIPIVNKR 1uhvA 148 :EEVLKWPFEIWN T0296 80 :ISLIGAATDATDYVVLAKALDKAAKEI 1uhvA 163 :LKEFWKDADEKEYFKLYKVTAKAIKEV T0296 107 :GVDFIGG 1uhvA 192 :NLKVGGP T0296 122 :YQKGDEILINSIPRALAETDKVCSSV 1uhvA 200 :ICGGADYWIEDFLNFCYEENVPVDFV T0296 180 :AKLVVFANAVEDNPFMAGAF 1uhvA 226 :SRHAYTSKQGEYTPHLIYQE T0296 213 :VSGPGV 1uhvA 246 :IMPSEY T0296 222 :ALEK 1uhvA 252 :MLNE T0296 231 :FDVVAETVKKTAFK 1uhvA 256 :FKTVREIIKNSHFP T0296 261 :GVEFGIVDLSLAPTPA 1uhvA 270 :NLPFHITEYNTSYSPQ T0296 290 :LETVGTHGTTAALALLN 1uhvA 286 :NPVHDTPFNAAYIARIL T0296 314 :VMACNQVGGLSG 1uhvA 303 :SEGGDYVDSFSY T0296 328 :IP 1uhvA 317 :FS T0296 330 :VSED 1uhvA 320 :VFEE T0296 342 :NGSLN 1uhvA 324 :RDVPR T0296 355 :AICSVGLDMIAIP 1uhvA 334 :GFGLVALNMIPKP T0296 378 :MIADEAAIG 1uhvA 347 :TFYTFKFFN T0296 389 :NMKTTAVRIIP 1uhvA 374 :DDGSVALIAWN T0296 400 :KGKE 1uhvA 387 :MDKT T0296 404 :GDMIEF 1uhvA 394 :DEDYEV T0296 418 :VMKV 1uhvA 400 :EIPV Number of specific fragments extracted= 24 number of extra gaps= 2 total=932 Number of alignments=58 # 1uhvA read from 1uhvA/merged-good-all-a2m # found chain 1uhvA in template set Warning: unaligning (T0296)G26 because of BadResidue code BAD_PEPTIDE in next template residue (1uhvA)F102 Warning: unaligning (T0296)I27 because of BadResidue code BAD_PEPTIDE at template residue (1uhvA)F102 Warning: unaligning (T0296)A326 because of BadResidue code BAD_PEPTIDE in next template residue (1uhvA)T316 Warning: unaligning (T0296)F327 because of BadResidue code BAD_PEPTIDE at template residue (1uhvA)T316 T0296 2 :DIRQVTETIAMIEEQNFDI 1uhvA 78 :NFTYIDRIFDSFLEIGIRP T0296 22 :TITM 1uhvA 97 :FVEI T0296 28 :SLLDCIDPDI 1uhvA 103 :MPKKLASGTQ T0296 41 :AEKIYQKITTKAANLVAVGDE 1uhvA 127 :YEKWSDLVKAVLHHFISRYGI T0296 63 :AAELGIPIVNKR 1uhvA 148 :EEVLKWPFEIWN T0296 80 :ISLIGAATDATDYVVLAKALDKAAKEI 1uhvA 163 :LKEFWKDADEKEYFKLYKVTAKAIKEV T0296 107 :GVDFIG 1uhvA 192 :NLKVGG T0296 122 :YQKGDEILINSIPRALAETDKVCSSV 1uhvA 200 :ICGGADYWIEDFLNFCYEENVPVDFV T0296 180 :AKLVVFANAVEDNPFMAGAF 1uhvA 226 :SRHAYTSKQGEYTPHLIYQE T0296 213 :VSGPG 1uhvA 246 :IMPSE T0296 221 :RALEK 1uhvA 251 :YMLNE T0296 231 :FDVVAETVKKTAFK 1uhvA 256 :FKTVREIIKNSHFP T0296 261 :GVEFGIVDLSLAPTPA 1uhvA 270 :NLPFHITEYNTSYSPQ T0296 290 :LETVGTHGTTAALALLN 1uhvA 286 :NPVHDTPFNAAYIARIL T0296 314 :VMACNQVGGLSG 1uhvA 303 :SEGGDYVDSFSY T0296 328 :IP 1uhvA 317 :FS T0296 330 :VSED 1uhvA 320 :VFEE T0296 342 :NGSLN 1uhvA 324 :RDVPR T0296 355 :AICSVGLDMIAIP 1uhvA 334 :GFGLVALNMIPKP T0296 378 :MIADEAAIG 1uhvA 347 :TFYTFKFFN T0296 389 :NMKTTAVRIIP 1uhvA 374 :DDGSVALIAWN T0296 400 :KGKE 1uhvA 387 :MDKT T0296 404 :GDMIEF 1uhvA 394 :DEDYEV T0296 418 :VMKV 1uhvA 400 :EIPV Number of specific fragments extracted= 24 number of extra gaps= 2 total=956 Number of alignments=59 # 1uhvA read from 1uhvA/merged-good-all-a2m # found chain 1uhvA in template set Warning: unaligning (T0296)G26 because of BadResidue code BAD_PEPTIDE in next template residue (1uhvA)F102 Warning: unaligning (T0296)I27 because of BadResidue code BAD_PEPTIDE at template residue (1uhvA)F102 Warning: unaligning (T0296)A326 because of BadResidue code BAD_PEPTIDE in next template residue (1uhvA)T316 Warning: unaligning (T0296)F327 because of BadResidue code BAD_PEPTIDE at template residue (1uhvA)T316 T0296 2 :DIRQVTETIAMIEEQNFDI 1uhvA 78 :NFTYIDRIFDSFLEIGIRP T0296 22 :TITM 1uhvA 97 :FVEI T0296 28 :SLLDCIDPD 1uhvA 103 :MPKKLASGT T0296 41 :AEKIYQKITTKAANLVAVGDE 1uhvA 127 :YEKWSDLVKAVLHHFISRYGI T0296 63 :AAELGIPIVNK 1uhvA 148 :EEVLKWPFEIW T0296 77 :VTP 1uhvA 159 :NEP T0296 80 :ISLIGAATDATDYVVLAKALDKAAKEI 1uhvA 163 :LKEFWKDADEKEYFKLYKVTAKAIKEV T0296 107 :GVDFIGGFSA 1uhvA 192 :NLKVGGPAIC T0296 155 :GINMTAVADMGRIIKETA 1uhvA 202 :GGADYWIEDFLNFCYEEN T0296 178 :GVAKLVVFANAVEDNPFM 1uhvA 220 :VPVDFVSRHAYTSKQGEY T0296 204 :EA 1uhvA 238 :TP T0296 207 :VIINVGVSG 1uhvA 240 :HLIYQEIMP T0296 219 :VKRALEKV 1uhvA 249 :SEYMLNEF T0296 232 :DVVAETVKK 1uhvA 257 :KTVREIIKN T0296 261 :GVEFGIVDLSLAPTP 1uhvA 270 :NLPFHITEYNTSYSP T0296 289 :GLETVGTHGTTAALALLND 1uhvA 285 :QNPVHDTPFNAAYIARILS T0296 315 :MACNQVGGLSG 1uhvA 304 :EGGDYVDSFSY T0296 328 :I 1uhvA 317 :F Number of specific fragments extracted= 18 number of extra gaps= 2 total=974 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ceo/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ceo expands to /projects/compbio/data/pdb/1ceo.pdb.gz 1ceo:Warning: there is no chain 1ceo will retry with 1ceoA # T0296 read from 1ceo/merged-good-all-a2m # 1ceo read from 1ceo/merged-good-all-a2m # adding 1ceo to template set # found chain 1ceo in template set Warning: unaligning (T0296)G113 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ceo)S103 Warning: unaligning (T0296)Y122 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ceo)S103 Warning: unaligning (T0296)G321 because of BadResidue code BAD_PEPTIDE in next template residue (1ceo)N314 Warning: unaligning (T0296)G322 because of BadResidue code BAD_PEPTIDE at template residue (1ceo)N314 T0296 7 :TETIAMIEEQNFDIRTITMGISLL 1ceo 31 :EKDIETIAEAGFDHVRLPFDYPII T0296 33 :IDPD 1ceo 55 :ESDD T0296 88 :DA 1ceo 59 :NV T0296 90 :TDYVVLAKALDKAAKEIGVDFIG 1ceo 65 :EDGLSYIDRCLEWCKKYNLGLVL T0296 123 :Q 1ceo 104 :T T0296 124 :KGDEI 1ceo 110 :NQQKR T0296 129 :LINSIPRALAETDKVCSSV 1ceo 118 :IWRFLAKRYINEREHIAFE T0296 148 :NIGSTKSGINMTAVADMGRIIKETANLS 1ceo 140 :QVVEPDSTRWNKLMLECIKAIREIDSTM T0296 181 :K 1ceo 168 :W T0296 183 :VVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVK 1ceo 169 :LYIGGNNYNSPDELKNLADIDDDYIVYNFHFYNPFFFT T0296 221 :RALEKVRG 1ceo 214 :ESAMAYNR T0296 229 :QSFDVV 1ceo 230 :EGIEEF T0296 235 :AETVKKTAFKI 1ceo 255 :KELLRKDLKPA T0296 254 :QMASERLGVEFGIVDLSL 1ceo 266 :IEFREKKKCKLYCGEFGV T0296 290 :LETVGTHGTTAALALLNDQVKKGGVMAC 1ceo 284 :IAIADLESRIKWHEDYISLLEEYDIGGA T0296 320 :V 1ceo 312 :V T0296 323 :LSGAFIPVS 1ceo 315 :YKKMDFEIY T0296 332 :EDEGMIAAVQ 1ceo 330 :VSQELVNILA Number of specific fragments extracted= 18 number of extra gaps= 1 total=992 Number of alignments=61 # 1ceo read from 1ceo/merged-good-all-a2m # found chain 1ceo in template set Warning: unaligning (T0296)G113 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ceo)S103 Warning: unaligning (T0296)Y122 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ceo)S103 Warning: unaligning (T0296)G321 because of BadResidue code BAD_PEPTIDE in next template residue (1ceo)N314 Warning: unaligning (T0296)G322 because of BadResidue code BAD_PEPTIDE at template residue (1ceo)N314 T0296 7 :TETIAMIEEQNFDIRTITMGISL 1ceo 31 :EKDIETIAEAGFDHVRLPFDYPI T0296 32 :CIDPD 1ceo 54 :IESDD T0296 88 :DA 1ceo 59 :NV T0296 90 :TDYVVLAKALDKAAKEIGVDFIG 1ceo 65 :EDGLSYIDRCLEWCKKYNLGLVL T0296 123 :Q 1ceo 104 :T T0296 124 :KGDEI 1ceo 110 :NQQKR T0296 129 :LINSIPRALAETDKVCSSV 1ceo 118 :IWRFLAKRYINEREHIAFE T0296 148 :NIGSTKSGINMTAVADMGRIIKETANL 1ceo 140 :QVVEPDSTRWNKLMLECIKAIREIDST T0296 181 :K 1ceo 168 :W T0296 183 :VVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVK 1ceo 169 :LYIGGNNYNSPDELKNLADIDDDYIVYNFHFYNPFFFT T0296 221 :RALEKVRG 1ceo 234 :EFVKNNPK T0296 231 :FDVVAETVKK 1ceo 255 :KELLRKDLKP T0296 253 :GQMASERLGVEFGIVDLSL 1ceo 265 :AIEFREKKKCKLYCGEFGV T0296 290 :LETVGTHGTTAALALLNDQVKKGGVMAC 1ceo 284 :IAIADLESRIKWHEDYISLLEEYDIGGA T0296 320 :V 1ceo 312 :V T0296 323 :LSGAFIPVS 1ceo 315 :YKKMDFEIY T0296 332 :EDEGMIAAVQ 1ceo 330 :VSQELVNILA Number of specific fragments extracted= 17 number of extra gaps= 1 total=1009 Number of alignments=62 # 1ceo read from 1ceo/merged-good-all-a2m # found chain 1ceo in template set Warning: unaligning (T0296)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ceo)S103 Warning: unaligning (T0296)Q319 because of BadResidue code BAD_PEPTIDE in next template residue (1ceo)N314 Warning: unaligning (T0296)V320 because of BadResidue code BAD_PEPTIDE at template residue (1ceo)N314 T0296 8 :ETIAMIEEQNFDI 1ceo 32 :KDIETIAEAGFDH T0296 23 :ITMGISLLDCIDPD 1ceo 45 :VRLPFDYPIIESDD T0296 37 :INRAA 1ceo 60 :VGEYK T0296 46 :QKITTKAANLVAVGD 1ceo 65 :EDGLSYIDRCLEWCK T0296 65 :ELGIPIVNKRVSVT 1ceo 80 :KYNLGLVLDMHHAP T0296 88 :DATDYVVLA 1ceo 107 :EDPNQQKRF T0296 97 :KALDKAAKEIG 1ceo 117 :DIWRFLAKRYI T0296 108 :VDFIGGFSA 1ceo 133 :IAFELLNQV T0296 122 :YQKGDEIL 1ceo 142 :VEPDSTRW T0296 158 :MTAVADMGRIIKETANLS 1ceo 150 :NKLMLECIKAIREIDSTM T0296 181 :K 1ceo 168 :W T0296 183 :VVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVK 1ceo 169 :LYIGGNNYNSPDELKNLADIDDDYIVYNFHFYNPFFFT T0296 221 :RALEK 1ceo 234 :EFVKN T0296 226 :VRGQSFD 1ceo 248 :LNNLKLN T0296 235 :AE 1ceo 255 :KE T0296 241 :TAFKITRIG 1ceo 257 :LLRKDLKPA T0296 254 :QMASERLGVEFGIVDLSLAPTPAV 1ceo 266 :IEFREKKKCKLYCGEFGVIAIADL T0296 279 :DSVARVLEE 1ceo 290 :ESRIKWHED T0296 305 :LNDQVKKGGVMACN 1ceo 299 :YISLLEEYDIGGAV T0296 321 :GGLSGAFI 1ceo 315 :YKKMDFEI T0296 330 :VSED 1ceo 323 :YNED T0296 334 :EGMIAAV 1ceo 332 :QELVNIL Number of specific fragments extracted= 22 number of extra gaps= 1 total=1031 Number of alignments=63 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0296//projects/compbio/experiments/protein-predict/casp7/T0296/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0296//projects/compbio/experiments/protein-predict/casp7/T0296/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0296/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0296/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)V108.CB) [> 3.5156 = 5.8594 < 7.6172] w=1.0000 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)D109.CB) [> 3.7157 = 6.1928 < 8.0507] w=0.9773 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)I111.CB) [> 3.6128 = 6.0214 < 7.8278] w=0.9338 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)I111.CB) [> 3.8916 = 6.4859 < 8.4317] w=0.9120 to align # Constraint # added constraint: constraint((T0296)P69.CB, (T0296)D109.CB) [> 3.4281 = 5.7135 < 7.4275] w=0.8671 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)F110.CB) [> 3.8475 = 6.4125 < 8.3363] w=0.8434 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)I70.CB) [> 3.8637 = 6.4395 < 8.3714] w=0.8192 to align # Constraint # added constraint: constraint((T0296)K73.CB, (T0296)G112.CA) [> 3.4747 = 5.7912 < 7.5286] w=0.8179 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)D109.CB) [> 3.5998 = 5.9998 < 7.7997] w=0.7947 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)I68.CB) [> 3.7709 = 6.2848 < 8.1703] w=0.7558 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)V71.CB) [> 3.1562 = 5.2603 < 6.8384] w=0.7556 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)P69.CB) [> 3.2760 = 5.4600 < 7.0980] w=0.7488 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)V108.CB) [> 3.9824 = 6.6373 < 8.6285] w=0.7078 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)I70.CB) [> 3.3195 = 5.5325 < 7.1923] w=0.7062 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)V71.CB) [> 4.0419 = 6.7365 < 8.7574] w=0.7019 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)I70.CB) [> 4.0379 = 6.7299 < 8.7488] w=0.6895 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)N72.CB) [> 4.0971 = 6.8284 < 8.8770] w=0.6823 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)F110.CB) [> 3.3682 = 5.6137 < 7.2978] w=0.6815 to align # Constraint # added constraint: constraint((T0296)K73.CB, (T0296)I111.CB) [> 3.8554 = 6.4256 < 8.3533] w=0.6804 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)N72.CB) [> 3.6013 = 6.0022 < 7.8029] w=0.6613 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)K73.CB) [> 3.9869 = 6.6448 < 8.6382] w=0.6566 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)I70.CB) [> 3.9351 = 6.5585 < 8.5261] w=0.6557 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)K73.CB) [> 3.9941 = 6.6568 < 8.6538] w=0.6445 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)V71.CB) [> 3.7191 = 6.1985 < 8.0580] w=0.6326 to align # Constraint # added constraint: constraint((T0296)R74.CB, (T0296)G112.CA) [> 3.6196 = 6.0327 < 7.8425] w=0.6316 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)G112.CA) [> 4.1242 = 6.8737 < 8.9358] w=0.6302 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)V71.CB) [> 3.9112 = 6.5186 < 8.4742] w=0.6223 to align # Constraint # added constraint: constraint((T0296)C144.CB, (T0296)K181.CB) [> 3.3137 = 5.5229 < 7.1798] w=0.6151 to align # Constraint # added constraint: constraint((T0296)D19.CB, (T0296)P69.CB) [> 3.5530 = 5.9217 < 7.6982] w=0.6119 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)G112.CA) [> 3.8800 = 6.4666 < 8.4066] w=0.5990 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)K73.CB) [> 3.5229 = 5.8715 < 7.6329] w=0.5886 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)N72.CB) [> 3.6320 = 6.0533 < 7.8693] w=0.5772 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)V184.CB) [> 3.9756 = 6.6260 < 8.6138] w=0.5705 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)I68.CB) [> 3.3830 = 5.6383 < 7.3297] w=0.5480 to align # Constraint # added constraint: constraint((T0296)F18.CB, (T0296)I68.CB) [> 3.9414 = 6.5690 < 8.5397] w=0.5430 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)V108.CB) [> 3.2262 = 5.3769 < 6.9900] w=0.5429 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)I209.CB) [> 3.7979 = 6.3298 < 8.2288] w=0.5415 to align # Constraint # added constraint: constraint((T0296)I168.CB, (T0296)L182.CB) [> 3.8131 = 6.3552 < 8.2618] w=0.5369 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)V143.CB) [> 3.0220 = 5.0367 < 6.5477] w=0.5328 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)S146.CB) [> 3.4672 = 5.7787 < 7.5123] w=0.5327 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)V183.CB) [> 3.6121 = 6.0202 < 7.8263] w=0.5283 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)S145.CB) [> 3.2827 = 5.4712 < 7.1125] w=0.5280 to align # Constraint # added constraint: constraint((T0296)D19.CB, (T0296)I68.CB) [> 4.0575 = 6.7626 < 8.7913] w=0.5276 to align # Constraint # added constraint: constraint((T0296)C144.CB, (T0296)A180.CB) [> 3.6634 = 6.1057 < 7.9374] w=0.5257 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)R74.CB) [> 3.5268 = 5.8780 < 7.6414] w=0.5220 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)I209.CB) [> 3.5514 = 5.9190 < 7.6947] w=0.5200 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)V207.CB) [> 3.3415 = 5.5691 < 7.2398] w=0.5200 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)F110.CB) [> 4.0537 = 6.7562 < 8.7831] w=0.5001 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)L182.CB) [> 3.7967 = 6.3278 < 8.2262] w=0.5001 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)D268.CB) [> 3.5821 = 5.9701 < 7.7611] w=0.4984 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)V267.CB) [> 3.9333 = 6.5554 < 8.5221] w=0.4984 to align # Constraint # added constraint: constraint((T0296)G59.CA, (T0296)I70.CB) [> 3.7900 = 6.3166 < 8.2116] w=0.4912 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)C144.CB) [> 3.7780 = 6.2967 < 8.1858] w=0.4885 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)C144.CB) [> 3.2560 = 5.4266 < 7.0546] w=0.4885 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)C144.CB) [> 3.9023 = 6.5038 < 8.4549] w=0.4885 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)N72.CB) [> 3.8701 = 6.4502 < 8.3852] w=0.4825 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)A180.CB) [> 3.6827 = 6.1379 < 7.9793] w=0.4817 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)K181.CB) [> 3.7214 = 6.2024 < 8.0631] w=0.4816 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)V183.CB) [> 3.9500 = 6.5833 < 8.5583] w=0.4796 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)V184.CB) [> 3.7645 = 6.2742 < 8.1564] w=0.4792 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)R74.CB) [> 3.5098 = 5.8496 < 7.6045] w=0.4780 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)V207.CB) [> 3.6343 = 6.0571 < 7.8742] w=0.4749 to align # Constraint # added constraint: constraint((T0296)C144.CB, (T0296)L182.CB) [> 4.0153 = 6.6921 < 8.6997] w=0.4746 to align # Constraint # added constraint: constraint((T0296)I133.CB, (T0296)C144.CB) [> 4.1587 = 6.9312 < 9.0105] w=0.4744 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)I208.CB) [> 3.5159 = 5.8598 < 7.6178] w=0.4733 to align # Constraint # added constraint: constraint((T0296)A96.CB, (T0296)A136.CB) [> 3.6941 = 6.1568 < 8.0039] w=0.4655 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)S145.CB) [> 3.9421 = 6.5701 < 8.5412] w=0.4648 to align # Constraint # added constraint: constraint((T0296)D109.CB, (T0296)V143.CB) [> 3.6321 = 6.0535 < 7.8696] w=0.4599 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)V75.CB) [> 3.2778 = 5.4630 < 7.1019] w=0.4547 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)V75.CB) [> 3.7755 = 6.2924 < 8.1802] w=0.4541 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)I209.CB) [> 4.1059 = 6.8432 < 8.8962] w=0.4535 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)N210.CB) [> 4.1421 = 6.9036 < 8.9746] w=0.4523 to align # Constraint # added constraint: constraint((T0296)R74.CB, (T0296)I111.CB) [> 4.0591 = 6.7652 < 8.7947] w=0.4486 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)N210.CB) [> 3.5681 = 5.9468 < 7.7308] w=0.4471 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)K142.CB) [> 3.3679 = 5.6132 < 7.2972] w=0.4384 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)V77.CB) [> 3.7793 = 6.2988 < 8.1884] w=0.4360 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)V183.CB) [> 3.8797 = 6.4662 < 8.4061] w=0.4329 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)K181.CB) [> 3.2819 = 5.4698 < 7.1107] w=0.4316 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)I208.CB) [> 4.1684 = 6.9473 < 9.0315] w=0.4292 to align # Constraint # added constraint: constraint((T0296)L99.CB, (T0296)F110.CB) [> 3.5308 = 5.8846 < 7.6500] w=0.4150 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)V75.CB) [> 3.8788 = 6.4646 < 8.4040] w=0.4139 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)L182.CB) [> 3.7192 = 6.1987 < 8.0583] w=0.4114 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V211.CB) [> 3.5235 = 5.8726 < 7.6343] w=0.4070 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)I208.CB) [> 3.9902 = 6.6503 < 8.6454] w=0.4014 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)V143.CB) [> 4.1418 = 6.9029 < 8.9738] w=0.3905 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)V207.CB) [> 4.0160 = 6.6933 < 8.7013] w=0.3849 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)G212.CA) [> 3.8189 = 6.3649 < 8.2744] w=0.3843 to align # Constraint # added constraint: constraint((T0296)I10.CB, (T0296)L66.CB) [> 3.8063 = 6.3438 < 8.2470] w=0.3826 to align # Constraint # added constraint: constraint((T0296)V93.CB, (T0296)S132.CB) [> 3.1612 = 5.2687 < 6.8493] w=0.3711 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)G112.CA) [> 3.7195 = 6.1992 < 8.0590] w=0.3694 to align # Constraint # added constraint: constraint((T0296)D109.CB, (T0296)K142.CB) [> 3.5941 = 5.9902 < 7.7873] w=0.3691 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)S76.CB) [> 4.0776 = 6.7960 < 8.8348] w=0.3690 to align # Constraint # added constraint: constraint((T0296)D100.CB, (T0296)F110.CB) [> 3.6450 = 6.0750 < 7.8975] w=0.3688 to align # Constraint # added constraint: constraint((T0296)N148.CB, (T0296)V184.CB) [> 3.2773 = 5.4622 < 7.1009] w=0.3669 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)I266.CB) [> 3.6669 = 6.1115 < 7.9449] w=0.3625 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)G265.CA) [> 3.3928 = 5.6546 < 7.3510] w=0.3625 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)I208.CB) [> 3.8021 = 6.3368 < 8.2379] w=0.3609 to align # Constraint # added constraint: constraint((T0296)I13.CB, (T0296)I68.CB) [> 4.3965 = 7.3274 < 9.5257] w=0.3591 to align # Constraint # added constraint: constraint((T0296)E14.CB, (T0296)L66.CB) [> 3.3340 = 5.5567 < 7.2237] w=0.3589 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)L269.CB) [> 3.6969 = 6.1614 < 8.0098] w=0.3583 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)V267.CB) [> 4.2099 = 7.0165 < 9.1215] w=0.3583 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)V267.CB) [> 3.0963 = 5.1605 < 6.7086] w=0.3583 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)A180.CB) [> 3.7916 = 6.3194 < 8.2152] w=0.3570 to align # Constraint # added constraint: constraint((T0296)A52.CB, (T0296)I106.CB) [> 3.6033 = 6.0055 < 7.8072] w=0.3503 to align # Constraint # added constraint: constraint((T0296)A96.CB, (T0296)I133.CB) [> 3.2604 = 5.4340 < 7.0642] w=0.3489 to align # Constraint # added constraint: constraint((T0296)I68.CB, (T0296)V108.CB) [> 4.1157 = 6.8595 < 8.9173] w=0.3483 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)I111.CB) [> 3.7292 = 6.2154 < 8.0800] w=0.3480 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)V143.CB) [> 4.4956 = 7.4927 < 9.7405] w=0.3472 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)S76.CB) [> 4.0475 = 6.7458 < 8.7696] w=0.3444 to align # Constraint # added constraint: constraint((T0296)K73.CB, (T0296)G113.CA) [> 3.6739 = 6.1233 < 7.9602] w=0.3425 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)V267.CB) [> 3.9289 = 6.5482 < 8.5126] w=0.3420 to align # Constraint # added constraint: constraint((T0296)I10.CB, (T0296)I62.CB) [> 3.8880 = 6.4800 < 8.4240] w=0.3413 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)V207.CB) [> 4.2425 = 7.0709 < 9.1922] w=0.3412 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)R74.CB) [> 3.7665 = 6.2775 < 8.1608] w=0.3407 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)G113.CA) [> 4.0773 = 6.7955 < 8.8342] w=0.3394 to align # Constraint # added constraint: constraint((T0296)I168.CB, (T0296)V179.CB) [> 3.4353 = 5.7254 < 7.4431] w=0.3379 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)A188.CB) [> 3.1219 = 5.2032 < 6.7641] w=0.3350 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)D109.CB) [> 3.9762 = 6.6270 < 8.6151] w=0.3348 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V184.CB) [> 3.8039 = 6.3398 < 8.2418] w=0.3344 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)G297.CA) [> 3.8976 = 6.4960 < 8.4448] w=0.3333 to align # Constraint # added constraint: constraint((T0296)Y45.CB, (T0296)A102.CB) [> 4.0297 = 6.7162 < 8.7310] w=0.3300 to align # Constraint # added constraint: constraint((T0296)K97.CB, (T0296)A136.CB) [> 3.3938 = 5.6564 < 7.3533] w=0.3265 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)A301.CB) [> 3.5266 = 5.8776 < 7.6409] w=0.3253 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)S146.CB) [> 3.0613 = 5.1021 < 6.6327] w=0.3246 to align # Constraint # added constraint: constraint((T0296)V56.CB, (T0296)I106.CB) [> 3.5183 = 5.8639 < 7.6230] w=0.3241 to align # Constraint # added constraint: constraint((T0296)A103.CB, (T0296)K142.CB) [> 3.3316 = 5.5526 < 7.2184] w=0.3240 to align # Constraint # added constraint: constraint((T0296)N148.CB, (T0296)V183.CB) [> 3.8784 = 6.4640 < 8.4031] w=0.3238 to align # Constraint # added constraint: constraint((T0296)D100.CB, (T0296)A136.CB) [> 3.1538 = 5.2563 < 6.8332] w=0.3228 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)I266.CB) [> 3.7388 = 6.2313 < 8.1006] w=0.3217 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)K181.CB) [> 3.3835 = 5.6391 < 7.3308] w=0.3215 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)R74.CB) [> 3.4653 = 5.7755 < 7.5081] w=0.3214 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)D268.CB) [> 3.4568 = 5.7613 < 7.4897] w=0.3189 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)D268.CB) [> 4.1052 = 6.8419 < 8.8945] w=0.3189 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)F264.CB) [> 2.7708 = 4.6180 < 6.0034] w=0.3189 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)V184.CB) [> 4.1220 = 6.8701 < 8.9311] w=0.3187 to align # Constraint # added constraint: constraint((T0296)V56.CB, (T0296)I70.CB) [> 3.8500 = 6.4167 < 8.3417] w=0.3187 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)V143.CB) [> 3.9833 = 6.6388 < 8.6305] w=0.3186 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)D268.CB) [> 3.5791 = 5.9652 < 7.7548] w=0.3170 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)L269.CB) [> 3.4519 = 5.7532 < 7.4791] w=0.3168 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)G59.CA) [> 3.7006 = 6.1677 < 8.0181] w=0.3168 to align # Constraint # added constraint: constraint((T0296)A162.CB, (T0296)L260.CB) [> 3.6892 = 6.1486 < 7.9932] w=0.3157 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)G212.CA) [> 3.2857 = 5.4761 < 7.1190] w=0.3142 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)V211.CB) [> 4.3069 = 7.1782 < 9.3317] w=0.3135 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)N210.CB) [> 2.6448 = 4.4079 < 5.7303] w=0.3131 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)G107.CA) [> 4.2145 = 7.0242 < 9.1315] w=0.3127 to align # Constraint # added constraint: constraint((T0296)G253.CA, (T0296)F264.CB) [> 3.8249 = 6.3748 < 8.2873] w=0.3114 to align # Constraint # added constraint: constraint((T0296)A96.CB, (T0296)G112.CA) [> 4.2896 = 7.1494 < 9.2942] w=0.3033 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)C144.CB) [> 3.3694 = 5.6156 < 7.3003] w=0.3014 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)F264.CB) [> 3.4453 = 5.7422 < 7.4648] w=0.2998 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)K142.CB) [> 4.0779 = 6.7964 < 8.8354] w=0.2993 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)A198.CB) [> 3.7829 = 6.3048 < 8.1963] w=0.2993 to align # Constraint # added constraint: constraint((T0296)G113.CA, (T0296)S146.CB) [> 3.1875 = 5.3126 < 6.9063] w=0.2988 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)K181.CB) [> 4.2724 = 7.1207 < 9.2569] w=0.2975 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)G112.CA) [> 4.0899 = 6.8166 < 8.8616] w=0.2973 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)K73.CB) [> 3.6711 = 6.1186 < 7.9541] w=0.2967 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)I133.CB) [> 4.1453 = 6.9088 < 8.9814] w=0.2967 to align # Constraint # added constraint: constraint((T0296)A96.CB, (T0296)F110.CB) [> 3.9006 = 6.5010 < 8.4513] w=0.2965 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)I106.CB) [> 4.5110 = 7.5183 < 9.7738] w=0.2965 to align # Constraint # added constraint: constraint((T0296)D109.CB, (T0296)K181.CB) [> 3.7257 = 6.2095 < 8.0724] w=0.2965 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)I266.CB) [> 3.0815 = 5.1358 < 6.6765] w=0.2963 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)T298.CB) [> 3.4797 = 5.7996 < 7.5394] w=0.2959 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)L182.CB) [> 4.3769 = 7.2949 < 9.4833] w=0.2947 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)L55.CB) [> 4.0580 = 6.7633 < 8.7923] w=0.2941 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)I111.CB) [> 3.7991 = 6.3319 < 8.2315] w=0.2939 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)L182.CB) [> 4.2419 = 7.0699 < 9.1908] w=0.2938 to align # Constraint # added constraint: constraint((T0296)I83.CB, (T0296)Y92.CB) [> 3.3241 = 5.5401 < 7.2022] w=0.2936 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)G112.CA) [> 4.1604 = 6.9340 < 9.0142] w=0.2928 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)V211.CB) [> 3.9023 = 6.5037 < 8.4549] w=0.2923 to align # Constraint # added constraint: constraint((T0296)K169.CB, (T0296)V202.CB) [> 4.0693 = 6.7822 < 8.8168] w=0.2908 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)V75.CB) [> 4.1245 = 6.8741 < 8.9364] w=0.2905 to align # Constraint # added constraint: constraint((T0296)K153.CB, (T0296)A188.CB) [> 4.2009 = 7.0016 < 9.1020] w=0.2905 to align # Constraint # added constraint: constraint((T0296)I149.CB, (T0296)A188.CB) [> 3.2132 = 5.3554 < 6.9620] w=0.2896 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)A180.CB) [> 3.9050 = 6.5084 < 8.4609] w=0.2799 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)V179.CB) [> 3.3384 = 5.5639 < 7.2331] w=0.2787 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)G265.CA) [> 4.4424 = 7.4039 < 9.6251] w=0.2785 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)I266.CB) [> 4.1146 = 6.8576 < 8.9149] w=0.2769 to align # Constraint # added constraint: constraint((T0296)S28.CB, (T0296)V77.CB) [> 3.8426 = 6.4044 < 8.3257] w=0.2760 to align # Constraint # added constraint: constraint((T0296)I168.CB, (T0296)A180.CB) [> 3.8957 = 6.4928 < 8.4407] w=0.2756 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V267.CB) [> 3.3824 = 5.6373 < 7.3284] w=0.2748 to align # Constraint # added constraint: constraint((T0296)Y92.CB, (T0296)L129.CB) [> 3.3142 = 5.5236 < 7.1807] w=0.2746 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)A103.CB) [> 3.8397 = 6.3995 < 8.3193] w=0.2743 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)V143.CB) [> 4.3709 = 7.2849 < 9.4703] w=0.2741 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)L182.CB) [> 3.3331 = 5.5551 < 7.2216] w=0.2741 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)S145.CB) [> 4.1799 = 6.9665 < 9.0564] w=0.2738 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)F114.CB) [> 3.3445 = 5.5741 < 7.2463] w=0.2724 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)F264.CB) [> 3.9303 = 6.5505 < 8.5156] w=0.2722 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)V183.CB) [> 3.8399 = 6.3998 < 8.3197] w=0.2720 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)V267.CB) [> 3.3702 = 5.6170 < 7.3021] w=0.2720 to align # Constraint # added constraint: constraint((T0296)A63.CB, (T0296)V108.CB) [> 3.4220 = 5.7033 < 7.4143] w=0.2713 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)G113.CA) [> 3.9190 = 6.5317 < 8.4912] w=0.2712 to align # Constraint # added constraint: constraint((T0296)M158.CB, (T0296)M255.CB) [> 3.5824 = 5.9706 < 7.7618] w=0.2706 to align # Constraint # added constraint: constraint((T0296)I130.CB, (T0296)M164.CB) [> 3.9488 = 6.5814 < 8.5558] w=0.2706 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)G113.CA) [> 3.8552 = 6.4254 < 8.3530] w=0.2705 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)L302.CB) [> 3.8676 = 6.4460 < 8.3798] w=0.2697 to align # Constraint # added constraint: constraint((T0296)G59.CA, (T0296)N72.CB) [> 4.4515 = 7.4191 < 9.6449] w=0.2695 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)A301.CB) [> 4.1004 = 6.8340 < 8.8841] w=0.2689 to align # Constraint # added constraint: constraint((T0296)F114.CB, (T0296)I133.CB) [> 3.5211 = 5.8685 < 7.6290] w=0.2688 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)V179.CB) [> 3.7423 = 6.2371 < 8.1083] w=0.2682 to align # Constraint # added constraint: constraint((T0296)I149.CB, (T0296)V184.CB) [> 4.0950 = 6.8251 < 8.8726] w=0.2680 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)V211.CB) [> 3.8617 = 6.4361 < 8.3669] w=0.2678 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)S270.CB) [> 3.3998 = 5.6664 < 7.3663] w=0.2669 to align # Constraint # added constraint: constraint((T0296)D19.CB, (T0296)G67.CA) [> 4.6795 = 7.7991 < 10.1389] w=0.2615 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)I68.CB) [> 3.4799 = 5.7998 < 7.5397] w=0.2591 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)L305.CB) [> 3.3696 = 5.6160 < 7.3008] w=0.2575 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)V147.CB) [> 4.2745 = 7.1241 < 9.2613] w=0.2563 to align # Constraint # added constraint: constraint((T0296)N148.CB, (T0296)A186.CB) [> 3.6740 = 6.1233 < 7.9602] w=0.2540 to align # Constraint # added constraint: constraint((T0296)A103.CB, (T0296)L137.CB) [> 3.7062 = 6.1771 < 8.0302] w=0.2539 to align # Constraint # added constraint: constraint((T0296)L99.CB, (T0296)A136.CB) [> 4.2119 = 7.0198 < 9.1257] w=0.2537 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)I266.CB) [> 3.8418 = 6.4031 < 8.3240] w=0.2527 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)G265.CA) [> 3.5201 = 5.8668 < 7.6269] w=0.2527 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)V262.CB) [> 3.5287 = 5.8812 < 7.6455] w=0.2527 to align # Constraint # added constraint: constraint((T0296)G113.CA, (T0296)S145.CB) [> 3.6426 = 6.0710 < 7.8924] w=0.2526 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)N72.CB) [> 4.1304 = 6.8840 < 8.9492] w=0.2523 to align # Constraint # added constraint: constraint((T0296)I149.CB, (T0296)A186.CB) [> 3.5406 = 5.9010 < 7.6712] w=0.2517 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)V267.CB) [> 3.8776 = 6.4627 < 8.4016] w=0.2512 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)S214.CB) [> 3.0676 = 5.1127 < 6.6465] w=0.2509 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)G265.CA) [> 3.7780 = 6.2967 < 8.1857] w=0.2509 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)I266.CB) [> 2.9196 = 4.8660 < 6.3258] w=0.2499 to align # Constraint # added constraint: constraint((T0296)I149.CB, (T0296)F185.CB) [> 3.7543 = 6.2571 < 8.1342] w=0.2498 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)K181.CB) [> 4.0636 = 6.7727 < 8.8046] w=0.2496 to align # Constraint # added constraint: constraint((T0296)M158.CB, (T0296)V252.CB) [> 3.5070 = 5.8449 < 7.5984] w=0.2488 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)I168.CB) [> 4.0051 = 6.6751 < 8.6777] w=0.2479 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)G112.CA) [> 4.0737 = 6.7895 < 8.8263] w=0.2479 to align # Constraint # added constraint: constraint((T0296)T171.CB, (T0296)A180.CB) [> 3.8146 = 6.3577 < 8.2650] w=0.2470 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)D268.CB) [> 3.7338 = 6.2230 < 8.0899] w=0.2457 to align # Constraint # added constraint: constraint((T0296)K169.CB, (T0296)V179.CB) [> 3.6530 = 6.0884 < 7.9149] w=0.2451 to align # Constraint # added constraint: constraint((T0296)T152.CB, (T0296)V184.CB) [> 4.0409 = 6.7348 < 8.7552] w=0.2440 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)L99.CB) [> 4.2426 = 7.0711 < 9.1924] w=0.2365 to align # Constraint # added constraint: constraint((T0296)A52.CB, (T0296)A102.CB) [> 3.5948 = 5.9913 < 7.7887] w=0.2362 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)I266.CB) [> 3.1411 = 5.2352 < 6.8057] w=0.2332 to align # Constraint # added constraint: constraint((T0296)A96.CB, (T0296)S132.CB) [> 2.7445 = 4.5742 < 5.9464] w=0.2317 to align # Constraint # added constraint: constraint((T0296)V93.CB, (T0296)L129.CB) [> 4.2552 = 7.0921 < 9.2197] w=0.2308 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)L302.CB) [> 3.7058 = 6.1763 < 8.0292] w=0.2307 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)I70.CB) [> 3.4361 = 5.7269 < 7.4449] w=0.2307 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V202.CB) [> 3.8816 = 6.4693 < 8.4101] w=0.2293 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)V213.CB) [> 3.9678 = 6.6129 < 8.5968] w=0.2291 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)A205.CB) [> 3.0024 = 5.0040 < 6.5051] w=0.2284 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)A205.CB) [> 3.4370 = 5.7284 < 7.4469] w=0.2284 to align # Constraint # added constraint: constraint((T0296)T78.CB, (T0296)G113.CA) [> 3.8814 = 6.4689 < 8.4096] w=0.2281 to align # Constraint # added constraint: constraint((T0296)G113.CA, (T0296)N148.CB) [> 3.9691 = 6.6151 < 8.5997] w=0.2280 to align # Constraint # added constraint: constraint((T0296)F114.CB, (T0296)I130.CB) [> 3.9562 = 6.5936 < 8.5717] w=0.2280 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)S76.CB) [> 4.2223 = 7.0371 < 9.1482] w=0.2278 to align # Constraint # added constraint: constraint((T0296)A138.CB, (T0296)T171.CB) [> 3.5838 = 5.9731 < 7.7650] w=0.2271 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)A103.CB) [> 3.6380 = 6.0633 < 7.8823] w=0.2270 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)D109.CB) [> 3.6436 = 6.0726 < 7.8944] w=0.2270 to align # Constraint # added constraint: constraint((T0296)R135.CB, (T0296)T171.CB) [> 3.7226 = 6.2043 < 8.0656] w=0.2268 to align # Constraint # added constraint: constraint((T0296)K73.CB, (T0296)F114.CB) [> 3.7982 = 6.3303 < 8.2293] w=0.2266 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)G121.CA) [> 3.4435 = 5.7391 < 7.4609] w=0.2266 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)V77.CB) [> 3.8025 = 6.3375 < 8.2388] w=0.2265 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)G212.CA) [> 3.9839 = 6.6398 < 8.6317] w=0.2264 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)S115.CB) [> 4.1852 = 6.9753 < 9.0680] w=0.2257 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)V183.CB) [> 3.6204 = 6.0340 < 7.8442] w=0.2254 to align # Constraint # added constraint: constraint((T0296)S151.CB, (T0296)A160.CB) [> 4.1436 = 6.9059 < 8.9777] w=0.2250 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)A222.CB) [> 3.5251 = 5.8752 < 7.6377] w=0.2241 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)D206.CB) [> 3.1955 = 5.3259 < 6.9237] w=0.2239 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)L55.CB) [> 3.2699 = 5.4499 < 7.0849] w=0.2239 to align # Constraint # added constraint: constraint((T0296)I149.CB, (T0296)V183.CB) [> 3.7461 = 6.2434 < 8.1165] w=0.2234 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)L269.CB) [> 2.9779 = 4.9632 < 6.4522] w=0.2225 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)I266.CB) [> 3.9922 = 6.6536 < 8.6497] w=0.2225 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)G265.CA) [> 3.6131 = 6.0218 < 7.8284] w=0.2225 to align # Constraint # added constraint: constraint((T0296)I10.CB, (T0296)I68.CB) [> 3.6690 = 6.1151 < 7.9496] w=0.2222 to align # Constraint # added constraint: constraint((T0296)A52.CB, (T0296)V108.CB) [> 4.1199 = 6.8665 < 8.9265] w=0.2156 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)I68.CB) [> 2.5822 = 4.3037 < 5.5947] w=0.2153 to align # Constraint # added constraint: constraint((T0296)T49.CB, (T0296)A102.CB) [> 3.2801 = 5.4668 < 7.1068] w=0.2143 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)F199.CB) [> 3.5900 = 5.9833 < 7.7783] w=0.2109 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)A180.CB) [> 3.3844 = 5.6407 < 7.3329] w=0.2105 to align # Constraint # added constraint: constraint((T0296)T49.CB, (T0296)E105.CB) [> 3.5314 = 5.8857 < 7.6514] w=0.2099 to align # Constraint # added constraint: constraint((T0296)G84.CA, (T0296)L129.CB) [> 3.9599 = 6.5998 < 8.5798] w=0.2094 to align # Constraint # added constraint: constraint((T0296)I130.CB, (T0296)V179.CB) [> 3.5629 = 5.9382 < 7.7196] w=0.2092 to align # Constraint # added constraint: constraint((T0296)G113.CA, (T0296)V147.CB) [> 3.9603 = 6.6005 < 8.5807] w=0.2092 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)L271.CB) [> 3.9665 = 6.6109 < 8.5941] w=0.2091 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)S146.CB) [> 3.3922 = 5.6536 < 7.3497] w=0.2084 to align # Constraint # added constraint: constraint((T0296)I10.CB, (T0296)G67.CA) [> 4.2368 = 7.0614 < 9.1798] w=0.2084 to align # Constraint # added constraint: constraint((T0296)L99.CB, (T0296)I133.CB) [> 3.3938 = 5.6564 < 7.3533] w=0.2083 to align # Constraint # added constraint: constraint((T0296)A52.CB, (T0296)I70.CB) [> 3.5847 = 5.9744 < 7.7668] w=0.2083 to align # Constraint # added constraint: constraint((T0296)N54.CB, (T0296)L66.CB) [> 3.8610 = 6.4350 < 8.3655] w=0.2083 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)L66.CB) [> 3.3953 = 5.6588 < 7.3564] w=0.2083 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)G67.CA) [> 4.3504 = 7.2507 < 9.4259] w=0.2083 to align # Constraint # added constraint: constraint((T0296)V56.CB, (T0296)G67.CA) [> 3.6857 = 6.1428 < 7.9856] w=0.2083 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)S214.CB) [> 4.3195 = 7.1992 < 9.3590] w=0.2073 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)E263.CB) [> 4.0789 = 6.7982 < 8.8377] w=0.2072 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)V234.CB) [> 3.2974 = 5.4957 < 7.1444] w=0.2070 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)F264.CB) [> 4.0551 = 6.7585 < 8.7861] w=0.2066 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)A102.CB) [> 4.2932 = 7.1553 < 9.3019] w=0.2065 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)I209.CB) [> 3.6760 = 6.1267 < 7.9647] w=0.2064 to align # Constraint # added constraint: constraint((T0296)I130.CB, (T0296)S145.CB) [> 3.9551 = 6.5919 < 8.5695] w=0.2063 to align # Constraint # added constraint: constraint((T0296)D206.CB, (T0296)F264.CB) [> 4.4087 = 7.3478 < 9.5521] w=0.2062 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)F264.CB) [> 3.5001 = 5.8335 < 7.5836] w=0.2062 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)E263.CB) [> 3.2876 = 5.4793 < 7.1231] w=0.2060 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)V262.CB) [> 3.8284 = 6.3806 < 8.2948] w=0.2060 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)N210.CB) [> 3.5885 = 5.9808 < 7.7750] w=0.2057 to align # Constraint # added constraint: constraint((T0296)P79.CB, (T0296)Y92.CB) [> 3.6255 = 6.0425 < 7.8553] w=0.2055 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)T78.CB) [> 4.0463 = 6.7439 < 8.7670] w=0.2054 to align # Constraint # added constraint: constraint((T0296)F114.CB, (T0296)S145.CB) [> 4.1667 = 6.9446 < 9.0280] w=0.2053 to align # Constraint # added constraint: constraint((T0296)G59.CA, (T0296)I68.CB) [> 2.8212 = 4.7021 < 6.1127] w=0.2045 to align # Constraint # added constraint: constraint((T0296)V277.CB, (T0296)A300.CB) [> 3.8070 = 6.3450 < 8.2485] w=0.2043 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)G265.CA) [> 3.8505 = 6.4176 < 8.3428] w=0.2042 to align # Constraint # added constraint: constraint((T0296)L82.CB, (T0296)Y92.CB) [> 3.9684 = 6.6139 < 8.5981] w=0.2041 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)V161.CB) [> 3.7497 = 6.2496 < 8.1244] w=0.2040 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)V184.CB) [> 3.6286 = 6.0477 < 7.8620] w=0.2038 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)L269.CB) [> 3.9649 = 6.6081 < 8.5906] w=0.2038 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)I149.CB) [> 3.9357 = 6.5595 < 8.5273] w=0.2037 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)D268.CB) [> 3.5109 = 5.8515 < 7.6070] w=0.2035 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)L129.CB) [> 4.1428 = 6.9047 < 8.9761] w=0.2035 to align # Constraint # added constraint: constraint((T0296)T9.CB, (T0296)I20.CB) [> 4.3093 = 7.1822 < 9.3369] w=0.2031 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)F185.CB) [> 3.8771 = 6.4618 < 8.4004] w=0.2031 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)A256.CB) [> 3.4063 = 5.6771 < 7.3803] w=0.2030 to align # Constraint # added constraint: constraint((T0296)N131.CB, (T0296)I167.CB) [> 3.3761 = 5.6269 < 7.3150] w=0.2030 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)V147.CB) [> 3.2242 = 5.3737 < 6.9857] w=0.2030 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)I168.CB) [> 3.8219 = 6.3698 < 8.2807] w=0.2027 to align # Constraint # added constraint: constraint((T0296)I168.CB, (T0296)V183.CB) [> 4.1385 = 6.8975 < 8.9667] w=0.2025 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)S115.CB) [> 3.3957 = 5.6595 < 7.3573] w=0.2025 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)V147.CB) [> 4.0135 = 6.6892 < 8.6959] w=0.2023 to align # Constraint # added constraint: constraint((T0296)M195.CB, (T0296)G212.CA) [> 4.1360 = 6.8934 < 8.9614] w=0.2023 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)I209.CB) [> 3.2969 = 5.4948 < 7.1433] w=0.2022 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)D268.CB) [> 4.0818 = 6.8030 < 8.8439] w=0.2020 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)F114.CB) [> 4.1359 = 6.8931 < 8.9611] w=0.2020 to align # Constraint # added constraint: constraint((T0296)I168.CB, (T0296)F199.CB) [> 4.6182 = 7.6969 < 10.0060] w=0.2017 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)A300.CB) [> 3.5653 = 5.9421 < 7.7248] w=0.2016 to align # Constraint # added constraint: constraint((T0296)E127.CB, (T0296)I167.CB) [> 4.0459 = 6.7432 < 8.7662] w=0.2014 to align # Constraint # added constraint: constraint((T0296)M158.CB, (T0296)A256.CB) [> 2.1314 = 3.5523 < 4.6179] w=0.2013 to align # Constraint # added constraint: constraint((T0296)G165.CA, (T0296)V226.CB) [> 3.5277 = 5.8794 < 7.6433] w=0.2012 to align # Constraint # added constraint: constraint((T0296)I130.CB, (T0296)I167.CB) [> 3.9109 = 6.5182 < 8.4736] w=0.2012 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)F110.CB) [> 4.2301 = 7.0502 < 9.1653] w=0.2010 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)T87.CB) [> 4.2723 = 7.1205 < 9.2566] w=0.2009 to align # Constraint # added constraint: constraint((T0296)I10.CB, (T0296)G59.CA) [> 4.2063 = 7.0105 < 9.1137] w=0.1996 to align # Constraint # added constraint: constraint((T0296)I48.CB, (T0296)A102.CB) [> 3.0155 = 5.0258 < 6.5336] w=0.1899 to align # Constraint # added constraint: constraint((T0296)A41.CB, (T0296)L95.CB) [> 4.0093 = 6.6823 < 8.6869] w=0.1899 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)S145.CB) [> 4.0186 = 6.6977 < 8.7071] w=0.1895 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)G113.CA) [> 3.8884 = 6.4807 < 8.4249] w=0.1875 to align # Constraint # added constraint: constraint((T0296)I80.CB, (T0296)A116.CB) [> 2.9860 = 4.9766 < 6.4696] w=0.1865 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)G212.CA) [> 3.9454 = 6.5757 < 8.5484] w=0.1857 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)E263.CB) [> 3.1845 = 5.3075 < 6.8998] w=0.1855 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)V262.CB) [> 3.7076 = 6.1793 < 8.0331] w=0.1855 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)H200.CB) [> 2.8540 = 4.7566 < 6.1836] w=0.1845 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)H200.CB) [> 3.5773 = 5.9621 < 7.7507] w=0.1845 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)V213.CB) [> 3.1475 = 5.2458 < 6.8195] w=0.1842 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V213.CB) [> 3.1947 = 5.3245 < 6.9218] w=0.1842 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)T237.CB) [> 3.8151 = 6.3585 < 8.2660] w=0.1841 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)A205.CB) [> 4.0277 = 6.7128 < 8.7266] w=0.1839 to align # Constraint # added constraint: constraint((T0296)V189.CB, (T0296)A205.CB) [> 3.3369 = 5.5614 < 7.2299] w=0.1839 to align # Constraint # added constraint: constraint((T0296)V189.CB, (T0296)H200.CB) [> 3.3855 = 5.6425 < 7.3353] w=0.1839 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)A222.CB) [> 3.4445 = 5.7409 < 7.4632] w=0.1839 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)I80.CB) [> 3.0393 = 5.0655 < 6.5852] w=0.1838 to align # Constraint # added constraint: constraint((T0296)S28.CB, (T0296)S76.CB) [> 3.0393 = 5.0655 < 6.5852] w=0.1836 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)E204.CB) [> 3.5274 = 5.8790 < 7.6427] w=0.1835 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)G203.CA) [> 3.5855 = 5.9758 < 7.7685] w=0.1835 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)V233.CB) [> 4.4021 = 7.3368 < 9.5378] w=0.1834 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)L137.CB) [> 4.6186 = 7.6977 < 10.0070] w=0.1831 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)F264.CB) [> 3.7490 = 6.2483 < 8.1228] w=0.1829 to align # Constraint # added constraint: constraint((T0296)A86.CB, (T0296)L95.CB) [> 4.0358 = 6.7264 < 8.7443] w=0.1828 to align # Constraint # added constraint: constraint((T0296)F199.CB, (T0296)I208.CB) [> 3.6144 = 6.0240 < 7.8312] w=0.1827 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)P79.CB) [> 3.7086 = 6.1810 < 8.0354] w=0.1824 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)T78.CB) [> 3.9648 = 6.6080 < 8.5904] w=0.1822 to align # Constraint # added constraint: constraint((T0296)S28.CB, (T0296)T78.CB) [> 3.9088 = 6.5146 < 8.4690] w=0.1822 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)A256.CB) [> 4.0095 = 6.6825 < 8.6873] w=0.1818 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)L269.CB) [> 3.5547 = 5.9245 < 7.7018] w=0.1816 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)A272.CB) [> 3.1288 = 5.2146 < 6.7790] w=0.1815 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)L95.CB) [> 3.9220 = 6.5367 < 8.4978] w=0.1815 to align # Constraint # added constraint: constraint((T0296)T78.CB, (T0296)T87.CB) [> 4.2313 = 7.0521 < 9.1677] w=0.1814 to align # Constraint # added constraint: constraint((T0296)I80.CB, (T0296)F114.CB) [> 4.0169 = 6.6948 < 8.7032] w=0.1813 to align # Constraint # added constraint: constraint((T0296)L82.CB, (T0296)D91.CB) [> 3.7295 = 6.2158 < 8.0806] w=0.1807 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)I111.CB) [> 4.0089 = 6.6815 < 8.6859] w=0.1805 to align # Constraint # added constraint: constraint((T0296)K239.CB, (T0296)Q254.CB) [> 3.8114 = 6.3523 < 8.2579] w=0.1804 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)G121.CA) [> 3.4256 = 5.7093 < 7.4221] w=0.1803 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)G197.CA) [> 4.4908 = 7.4847 < 9.7301] w=0.1803 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)C144.CB) [> 4.3732 = 7.2887 < 9.4754] w=0.1802 to align # Constraint # added constraint: constraint((T0296)I13.CB, (T0296)L66.CB) [> 4.2290 = 7.0483 < 9.1628] w=0.1800 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)S76.CB) [> 3.6985 = 6.1641 < 8.0133] w=0.1798 to align # Constraint # added constraint: constraint((T0296)A11.CB, (T0296)L66.CB) [> 3.8861 = 6.4768 < 8.4198] w=0.1798 to align # Constraint # added constraint: constraint((T0296)N148.CB, (T0296)N157.CB) [> 4.1567 = 6.9278 < 9.0061] w=0.1795 to align # Constraint # added constraint: constraint((T0296)M195.CB, (T0296)V211.CB) [> 4.3463 = 7.2439 < 9.4170] w=0.1795 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)V207.CB) [> 4.1879 = 6.9798 < 9.0737] w=0.1795 to align # Constraint # added constraint: constraint((T0296)F18.CB, (T0296)C144.CB) [> 3.4201 = 5.7002 < 7.4103] w=0.1794 to align # Constraint # added constraint: constraint((T0296)F18.CB, (T0296)V143.CB) [> 3.4445 = 5.7409 < 7.4632] w=0.1794 to align # Constraint # added constraint: constraint((T0296)S154.CB, (T0296)N187.CB) [> 4.0087 = 6.6812 < 8.6855] w=0.1792 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)S146.CB) [> 3.5338 = 5.8897 < 7.6566] w=0.1790 to align # Constraint # added constraint: constraint((T0296)I149.CB, (T0296)M158.CB) [> 3.2054 = 5.3423 < 6.9450] w=0.1787 to align # Constraint # added constraint: constraint((T0296)I83.CB, (T0296)L95.CB) [> 3.2263 = 5.3771 < 6.9903] w=0.1787 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)I328.CB) [> 3.8198 = 6.3664 < 8.2763] w=0.1782 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)N187.CB) [> 3.8328 = 6.3880 < 8.3044] w=0.1777 to align # Constraint # added constraint: constraint((T0296)S151.CB, (T0296)A188.CB) [> 3.7585 = 6.2642 < 8.1434] w=0.1773 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)A339.CB) [> 3.9918 = 6.6529 < 8.6488] w=0.1765 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)I68.CB) [> 3.5061 = 5.8435 < 7.5966] w=0.1687 to align # Constraint # added constraint: constraint((T0296)C32.CB, (T0296)I44.CB) [> 3.4807 = 5.8012 < 7.5416] w=0.1676 to align # Constraint # added constraint: constraint((T0296)I44.CB, (T0296)L99.CB) [> 3.5648 = 5.9413 < 7.7237] w=0.1671 to align # Constraint # added constraint: constraint((T0296)A53.CB, (T0296)I106.CB) [> 4.1261 = 6.8769 < 8.9399] w=0.1647 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)L269.CB) [> 4.1527 = 6.9212 < 8.9976] w=0.1645 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)I266.CB) [> 3.5895 = 5.9825 < 7.7772] w=0.1645 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)F264.CB) [> 3.6887 = 6.1478 < 7.9922] w=0.1636 to align # Constraint # added constraint: constraint((T0296)V238.CB, (T0296)F264.CB) [> 3.4509 = 5.7515 < 7.4769] w=0.1634 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V238.CB) [> 4.5112 = 7.5187 < 9.7743] w=0.1630 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)T237.CB) [> 2.7246 = 4.5411 < 5.9034] w=0.1630 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)L95.CB) [> 4.3005 = 7.1675 < 9.3178] w=0.1628 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)L82.CB) [> 3.3330 = 5.5550 < 7.2214] w=0.1627 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)A316.CB) [> 4.2504 = 7.0840 < 9.2092] w=0.1623 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)S145.CB) [> 4.0752 = 6.7920 < 8.8295] w=0.1622 to align # Constraint # added constraint: constraint((T0296)V93.CB, (T0296)I133.CB) [> 3.7805 = 6.3007 < 8.1910] w=0.1619 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)V238.CB) [> 4.2228 = 7.0381 < 9.1495] w=0.1618 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)L182.CB) [> 4.0847 = 6.8078 < 8.8501] w=0.1618 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)S324.CB) [> 3.7147 = 6.1912 < 8.0486] w=0.1616 to align # Constraint # added constraint: constraint((T0296)V238.CB, (T0296)G265.CA) [> 4.2857 = 7.1428 < 9.2857] w=0.1616 to align # Constraint # added constraint: constraint((T0296)C32.CB, (T0296)V77.CB) [> 3.9748 = 6.6247 < 8.6122] w=0.1614 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)L55.CB) [> 4.0585 = 6.7642 < 8.7935] w=0.1614 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)G265.CA) [> 3.4395 = 5.7326 < 7.4523] w=0.1610 to align # Constraint # added constraint: constraint((T0296)A235.CB, (T0296)G312.CA) [> 3.4713 = 5.7856 < 7.5213] w=0.1610 to align # Constraint # added constraint: constraint((T0296)S28.CB, (T0296)V75.CB) [> 4.2797 = 7.1329 < 9.2727] w=0.1609 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)L269.CB) [> 4.1825 = 6.9709 < 9.0621] w=0.1608 to align # Constraint # added constraint: constraint((T0296)L30.CB, (T0296)Y92.CB) [> 3.3446 = 5.5743 < 7.2466] w=0.1607 to align # Constraint # added constraint: constraint((T0296)A96.CB, (T0296)L137.CB) [> 3.7193 = 6.1989 < 8.0585] w=0.1607 to align # Constraint # added constraint: constraint((T0296)N148.CB, (T0296)F185.CB) [> 3.4215 = 5.7025 < 7.4132] w=0.1606 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)D268.CB) [> 4.1933 = 6.9889 < 9.0855] w=0.1602 to align # Constraint # added constraint: constraint((T0296)V6.CB, (T0296)T22.CB) [> 3.6797 = 6.1329 < 7.9727] w=0.1602 to align # Constraint # added constraint: constraint((T0296)S28.CB, (T0296)P79.CB) [> 3.1904 = 5.3173 < 6.9125] w=0.1601 to align # Constraint # added constraint: constraint((T0296)P273.CB, (T0296)G294.CA) [> 3.3002 = 5.5004 < 7.1505] w=0.1599 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)F185.CB) [> 4.2014 = 7.0024 < 9.1032] w=0.1595 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)V184.CB) [> 3.5821 = 5.9702 < 7.7612] w=0.1594 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)E263.CB) [> 4.3388 = 7.2313 < 9.4007] w=0.1593 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)N210.CB) [> 3.0346 = 5.0577 < 6.5750] w=0.1592 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)L305.CB) [> 4.0617 = 6.7696 < 8.8005] w=0.1591 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)A198.CB) [> 3.7359 = 6.2265 < 8.0944] w=0.1590 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)A186.CB) [> 3.6351 = 6.0585 < 7.8760] w=0.1588 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)S270.CB) [> 4.0559 = 6.7598 < 8.7877] w=0.1588 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)D268.CB) [> 3.9101 = 6.5168 < 8.4719] w=0.1588 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V218.CB) [> 3.3069 = 5.5114 < 7.1649] w=0.1587 to align # Constraint # added constraint: constraint((T0296)K240.CB, (T0296)M255.CB) [> 3.8237 = 6.3729 < 8.2847] w=0.1586 to align # Constraint # added constraint: constraint((T0296)M158.CB, (T0296)R221.CB) [> 2.8629 = 4.7715 < 6.2030] w=0.1586 to align # Constraint # added constraint: constraint((T0296)K104.CB, (T0296)T140.CB) [> 3.8500 = 6.4166 < 8.3416] w=0.1583 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)G253.CA) [> 3.3367 = 5.5612 < 7.2295] w=0.1583 to align # Constraint # added constraint: constraint((T0296)D163.CB, (T0296)A198.CB) [> 4.1486 = 6.9143 < 8.9886] w=0.1580 to align # Constraint # added constraint: constraint((T0296)T159.CB, (T0296)L260.CB) [> 4.3355 = 7.2257 < 9.3935] w=0.1577 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)S145.CB) [> 3.4638 = 5.7730 < 7.5049] w=0.1577 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)I111.CB) [> 4.4746 = 7.4577 < 9.6951] w=0.1576 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)I149.CB) [> 3.7075 = 6.1792 < 8.0329] w=0.1575 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)A300.CB) [> 3.9805 = 6.6342 < 8.6245] w=0.1574 to align # Constraint # added constraint: constraint((T0296)T237.CB, (T0296)V252.CB) [> 3.6965 = 6.1608 < 8.0091] w=0.1573 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)A160.CB) [> 4.4209 = 7.3682 < 9.5787] w=0.1572 to align # Constraint # added constraint: constraint((T0296)G278.CA, (T0296)A303.CB) [> 3.9972 = 6.6620 < 8.6605] w=0.1572 to align # Constraint # added constraint: constraint((T0296)A52.CB, (T0296)R74.CB) [> 3.5974 = 5.9957 < 7.7944] w=0.1571 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)S145.CB) [> 4.2488 = 7.0814 < 9.2058] w=0.1571 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)L55.CB) [> 4.1767 = 6.9611 < 9.0494] w=0.1571 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)D206.CB) [> 4.2707 = 7.1178 < 9.2532] w=0.1571 to align # Constraint # added constraint: constraint((T0296)V238.CB, (T0296)G253.CA) [> 4.0381 = 6.7301 < 8.7491] w=0.1570 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)D206.CB) [> 3.7149 = 6.1916 < 8.0491] w=0.1568 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)D206.CB) [> 4.4202 = 7.3669 < 9.5770] w=0.1568 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)F185.CB) [> 4.0577 = 6.7628 < 8.7916] w=0.1565 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)G265.CA) [> 3.3434 = 5.5724 < 7.2441] w=0.1563 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)V320.CB) [> 3.5548 = 5.9247 < 7.7021] w=0.1562 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)G294.CA) [> 3.4313 = 5.7189 < 7.4346] w=0.1561 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)I209.CB) [> 4.3943 = 7.3238 < 9.5210] w=0.1561 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)I111.CB) [> 4.0446 = 6.7411 < 8.7634] w=0.1558 to align # Constraint # added constraint: constraint((T0296)V147.CB, (T0296)M164.CB) [> 3.8720 = 6.4534 < 8.3894] w=0.1553 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)V183.CB) [> 3.9365 = 6.5609 < 8.5292] w=0.1546 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)A326.CB) [> 4.3895 = 7.3159 < 9.5106] w=0.1546 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)G325.CA) [> 3.6813 = 6.1355 < 7.9762] w=0.1546 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)I70.CB) [> 4.2815 = 7.1358 < 9.2766] w=0.1441 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)V71.CB) [> 3.3769 = 5.6281 < 7.3166] w=0.1438 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)F199.CB) [> 2.8467 = 4.7445 < 6.1678] w=0.1438 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)A272.CB) [> 3.3697 = 5.6161 < 7.3010] w=0.1429 to align # Constraint # added constraint: constraint((T0296)V189.CB, (T0296)A198.CB) [> 2.7226 = 4.5376 < 5.8989] w=0.1423 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)L269.CB) [> 3.9784 = 6.6306 < 8.6198] w=0.1404 to align # Constraint # added constraint: constraint((T0296)F18.CB, (T0296)V267.CB) [> 4.2708 = 7.1180 < 9.2535] w=0.1401 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)Y45.CB) [> 4.6964 = 7.8273 < 10.1754] w=0.1401 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)I83.CB) [> 4.2468 = 7.0780 < 9.2014] w=0.1401 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)S81.CB) [> 2.8835 = 4.8059 < 6.2477] w=0.1401 to align # Constraint # added constraint: constraint((T0296)V93.CB, (T0296)I128.CB) [> 3.9123 = 6.5205 < 8.4767] w=0.1401 to align # Constraint # added constraint: constraint((T0296)M177.CB, (T0296)V202.CB) [> 3.3320 = 5.5533 < 7.2192] w=0.1401 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)V202.CB) [> 4.1242 = 6.8738 < 8.9359] w=0.1401 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)V202.CB) [> 3.0976 = 5.1627 < 6.7115] w=0.1401 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)E263.CB) [> 4.2778 = 7.1296 < 9.2685] w=0.1401 to align # Constraint # added constraint: constraint((T0296)D206.CB, (T0296)E263.CB) [> 2.4222 = 4.0370 < 5.2481] w=0.1401 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)V262.CB) [> 3.3786 = 5.6311 < 7.3204] w=0.1401 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)T241.CB) [> 2.8064 = 4.6774 < 6.0806] w=0.1401 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)G265.CA) [> 4.0691 = 6.7818 < 8.8163] w=0.1401 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)V267.CB) [> 3.5148 = 5.8580 < 7.6154] w=0.1401 to align # Constraint # added constraint: constraint((T0296)L174.CB, (T0296)L260.CB) [> 3.4413 = 5.7355 < 7.4562] w=0.1399 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)A180.CB) [> 4.3182 = 7.1969 < 9.3560] w=0.1397 to align # Constraint # added constraint: constraint((T0296)I83.CB, (T0296)L129.CB) [> 3.8029 = 6.3382 < 8.2397] w=0.1396 to align # Constraint # added constraint: constraint((T0296)I33.CB, (T0296)Y45.CB) [> 3.7897 = 6.3161 < 8.2109] w=0.1396 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)K181.CB) [> 3.6758 = 6.1262 < 7.9641] w=0.1391 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)L182.CB) [> 3.8806 = 6.4677 < 8.4080] w=0.1391 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)H200.CB) [> 4.3949 = 7.3249 < 9.5223] w=0.1391 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)F199.CB) [> 3.7431 = 6.2385 < 8.1101] w=0.1391 to align # Constraint # added constraint: constraint((T0296)K225.CB, (T0296)V234.CB) [> 3.7321 = 6.2201 < 8.0861] w=0.1385 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)S76.CB) [> 3.8494 = 6.4157 < 8.3404] w=0.1383 to align # Constraint # added constraint: constraint((T0296)I27.CB, (T0296)G84.CA) [> 3.9154 = 6.5257 < 8.4834] w=0.1380 to align # Constraint # added constraint: constraint((T0296)V6.CB, (T0296)L66.CB) [> 3.0364 = 5.0606 < 6.5788] w=0.1378 to align # Constraint # added constraint: constraint((T0296)F231.CB, (T0296)Q308.CB) [> 3.0993 = 5.1655 < 6.7152] w=0.1376 to align # Constraint # added constraint: constraint((T0296)G165.CA, (T0296)R259.CB) [> 4.2390 = 7.0651 < 9.1846] w=0.1375 to align # Constraint # added constraint: constraint((T0296)I37.CB, (T0296)V94.CB) [> 4.0862 = 6.8103 < 8.8534] w=0.1375 to align # Constraint # added constraint: constraint((T0296)L82.CB, (T0296)Y122.CB) [> 4.0185 = 6.6975 < 8.7068] w=0.1375 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)D141.CB) [> 4.2473 = 7.0789 < 9.2025] w=0.1374 to align # Constraint # added constraint: constraint((T0296)A235.CB, (T0296)V309.CB) [> 4.2720 = 7.1200 < 9.2559] w=0.1373 to align # Constraint # added constraint: constraint((T0296)I33.CB, (T0296)T78.CB) [> 4.1041 = 6.8401 < 8.8921] w=0.1372 to align # Constraint # added constraint: constraint((T0296)G125.CA, (T0296)G155.CA) [> 4.5389 = 7.5648 < 9.8342] w=0.1372 to align # Constraint # added constraint: constraint((T0296)V234.CB, (T0296)L305.CB) [> 3.8404 = 6.4006 < 8.3208] w=0.1371 to align # Constraint # added constraint: constraint((T0296)F231.CB, (T0296)L304.CB) [> 3.0005 = 5.0008 < 6.5011] w=0.1371 to align # Constraint # added constraint: constraint((T0296)F194.CB, (T0296)G212.CA) [> 3.8525 = 6.4208 < 8.3470] w=0.1369 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)G212.CA) [> 3.8106 = 6.3510 < 8.2563] w=0.1369 to align # Constraint # added constraint: constraint((T0296)S28.CB, (T0296)I80.CB) [> 3.9692 = 6.6153 < 8.5999] w=0.1369 to align # Constraint # added constraint: constraint((T0296)L30.CB, (T0296)I48.CB) [> 4.7411 = 7.9019 < 10.2725] w=0.1367 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)V56.CB) [> 3.9525 = 6.5876 < 8.5638] w=0.1366 to align # Constraint # added constraint: constraint((T0296)S115.CB, (T0296)I149.CB) [> 3.6507 = 6.0844 < 7.9097] w=0.1365 to align # Constraint # added constraint: constraint((T0296)D126.CB, (T0296)A160.CB) [> 3.7832 = 6.3054 < 8.1970] w=0.1364 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)Y92.CB) [> 4.0624 = 6.7707 < 8.8019] w=0.1364 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)L99.CB) [> 3.8898 = 6.4830 < 8.4279] w=0.1362 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)A303.CB) [> 2.7250 = 4.5416 < 5.9040] w=0.1361 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)L304.CB) [> 3.3395 = 5.5659 < 7.2357] w=0.1361 to align # Constraint # added constraint: constraint((T0296)I33.CB, (T0296)P79.CB) [> 3.2183 = 5.3637 < 6.9729] w=0.1360 to align # Constraint # added constraint: constraint((T0296)I13.CB, (T0296)T22.CB) [> 4.1024 = 6.8373 < 8.8885] w=0.1360 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)L174.CB) [> 3.6354 = 6.0591 < 7.8768] w=0.1359 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)A205.CB) [> 3.1389 = 5.2315 < 6.8009] w=0.1359 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)F199.CB) [> 4.3689 = 7.2815 < 9.4659] w=0.1359 to align # Constraint # added constraint: constraint((T0296)M164.CB, (T0296)A198.CB) [> 3.7771 = 6.2951 < 8.1836] w=0.1359 to align # Constraint # added constraint: constraint((T0296)N157.CB, (T0296)V252.CB) [> 3.7857 = 6.3096 < 8.2025] w=0.1359 to align # Constraint # added constraint: constraint((T0296)V93.CB, (T0296)F110.CB) [> 3.8433 = 6.4055 < 8.3271] w=0.1359 to align # Constraint # added constraint: constraint((T0296)A235.CB, (T0296)V267.CB) [> 3.6019 = 6.0032 < 7.8042] w=0.1359 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)A272.CB) [> 3.5958 = 5.9930 < 7.7909] w=0.1359 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)V234.CB) [> 2.7293 = 4.5488 < 5.9134] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)A272.CB) [> 3.1382 = 5.2303 < 6.7994] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)L271.CB) [> 4.2528 = 7.0880 < 9.2144] w=0.1359 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)L271.CB) [> 3.7846 = 6.3077 < 8.2000] w=0.1359 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)D268.CB) [> 4.0274 = 6.7123 < 8.7260] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G201.CA, (T0296)V262.CB) [> 3.3035 = 5.5058 < 7.1576] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G201.CA, (T0296)L260.CB) [> 4.7340 = 7.8901 < 10.2571] w=0.1359 to align # Constraint # added constraint: constraint((T0296)H200.CB, (T0296)V262.CB) [> 3.0276 = 5.0460 < 6.5599] w=0.1359 to align # Constraint # added constraint: constraint((T0296)H200.CB, (T0296)S257.CB) [> 3.9400 = 6.5666 < 8.5366] w=0.1359 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)L260.CB) [> 4.6047 = 7.6745 < 9.9769] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)V262.CB) [> 3.4092 = 5.6821 < 7.3867] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)L260.CB) [> 4.2905 = 7.1508 < 9.2961] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)S257.CB) [> 3.0593 = 5.0989 < 6.6286] w=0.1359 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)G253.CA) [> 3.4254 = 5.7090 < 7.4217] w=0.1359 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)I208.CB) [> 3.3357 = 5.5595 < 7.2274] w=0.1359 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)V143.CB) [> 3.9197 = 6.5329 < 8.4928] w=0.1357 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)S115.CB) [> 4.0069 = 6.6781 < 8.6815] w=0.1357 to align # Constraint # added constraint: constraint((T0296)M158.CB, (T0296)G217.CA) [> 4.5604 = 7.6006 < 9.8808] w=0.1355 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)A301.CB) [> 3.8908 = 6.4847 < 8.4301] w=0.1354 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)L304.CB) [> 4.1482 = 6.9136 < 8.9877] w=0.1354 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)L305.CB) [> 3.0150 = 5.0250 < 6.5325] w=0.1354 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)A301.CB) [> 3.8758 = 6.4596 < 8.3975] w=0.1354 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A301.CB) [> 2.1754 = 3.6256 < 4.7133] w=0.1354 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)A301.CB) [> 4.7147 = 7.8578 < 10.2152] w=0.1354 to align # Constraint # added constraint: constraint((T0296)S280.CB, (T0296)A303.CB) [> 2.9497 = 4.9161 < 6.3910] w=0.1354 to align # Constraint # added constraint: constraint((T0296)V281.CB, (T0296)T299.CB) [> 2.6764 = 4.4607 < 5.7989] w=0.1354 to align # Constraint # added constraint: constraint((T0296)V284.CB, (T0296)L302.CB) [> 3.3404 = 5.5673 < 7.2375] w=0.1354 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)V309.CB) [> 3.7066 = 6.1776 < 8.0309] w=0.1354 to align # Constraint # added constraint: constraint((T0296)M164.CB, (T0296)L182.CB) [> 4.0391 = 6.7318 < 8.7514] w=0.1353 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)I111.CB) [> 4.4529 = 7.4214 < 9.6479] w=0.1353 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)V218.CB) [> 4.0841 = 6.8068 < 8.8489] w=0.1352 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)S324.CB) [> 4.1727 = 6.9545 < 9.0409] w=0.1351 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)A180.CB) [> 3.1061 = 5.1769 < 6.7300] w=0.1350 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)L182.CB) [> 3.8050 = 6.3417 < 8.2442] w=0.1350 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)V207.CB) [> 3.6726 = 6.1210 < 7.9574] w=0.1350 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)F110.CB) [> 4.3076 = 7.1793 < 9.3331] w=0.1348 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)V320.CB) [> 4.3234 = 7.2057 < 9.3674] w=0.1348 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V252.CB) [> 3.4566 = 5.7610 < 7.4893] w=0.1348 to align # Constraint # added constraint: constraint((T0296)S154.CB, (T0296)E190.CB) [> 3.6822 = 6.1369 < 7.9780] w=0.1348 to align # Constraint # added constraint: constraint((T0296)L285.CB, (T0296)T299.CB) [> 3.1890 = 5.3149 < 6.9094] w=0.1344 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)L137.CB) [> 4.1879 = 6.9799 < 9.0738] w=0.1342 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)L129.CB) [> 4.7235 = 7.8725 < 10.2343] w=0.1342 to align # Constraint # added constraint: constraint((T0296)E127.CB, (T0296)I149.CB) [> 4.4090 = 7.3484 < 9.5529] w=0.1342 to align # Constraint # added constraint: constraint((T0296)K169.CB, (T0296)G178.CA) [> 3.8127 = 6.3545 < 8.2608] w=0.1341 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)S146.CB) [> 3.4011 = 5.6684 < 7.3690] w=0.1341 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V226.CB) [> 3.7705 = 6.2842 < 8.1695] w=0.1340 to align # Constraint # added constraint: constraint((T0296)P275.CB, (T0296)I328.CB) [> 3.9952 = 6.6587 < 8.6563] w=0.1340 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)V183.CB) [> 4.2983 = 7.1638 < 9.3129] w=0.1339 to align # Constraint # added constraint: constraint((T0296)I156.CB, (T0296)V189.CB) [> 4.6238 = 7.7064 < 10.0183] w=0.1339 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)F185.CB) [> 3.4324 = 5.7206 < 7.4368] w=0.1338 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)A256.CB) [> 3.0496 = 5.0826 < 6.6074] w=0.1337 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)G203.CA) [> 3.8104 = 6.3507 < 8.2559] w=0.1335 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)S146.CB) [> 4.0100 = 6.6833 < 8.6883] w=0.1335 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)V161.CB) [> 4.2593 = 7.0989 < 9.2286] w=0.1334 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)V252.CB) [> 3.1739 = 5.2899 < 6.8769] w=0.1334 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)F327.CB) [> 3.7253 = 6.2088 < 8.0714] w=0.1333 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)G215.CA) [> 4.5894 = 7.6490 < 9.9438] w=0.1331 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)V184.CB) [> 3.9364 = 6.5607 < 8.5289] w=0.1329 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)A339.CB) [> 3.5456 = 5.9093 < 7.6821] w=0.1328 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)V211.CB) [> 4.0888 = 6.8147 < 8.8591] w=0.1328 to align # Constraint # added constraint: constraint((T0296)G278.CA, (T0296)T295.CB) [> 4.0732 = 6.7886 < 8.8252] w=0.1328 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)L323.CB) [> 3.9126 = 6.5209 < 8.4772] w=0.1325 to align # Constraint # added constraint: constraint((T0296)A172.CB, (T0296)V202.CB) [> 4.2538 = 7.0897 < 9.2166] w=0.1325 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)A355.CB) [> 4.1929 = 6.9883 < 9.0847] w=0.1323 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)I328.CB) [> 2.8247 = 4.7079 < 6.1203] w=0.1323 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)F327.CB) [> 4.4993 = 7.4988 < 9.7484] w=0.1323 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)A326.CB) [> 3.3567 = 5.5944 < 7.2727] w=0.1323 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)A326.CB) [> 3.2741 = 5.4569 < 7.0939] w=0.1323 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)M288.CB) [> 3.9463 = 6.5771 < 8.5503] w=0.1318 to align # Constraint # added constraint: constraint((T0296)T299.CB, (T0296)P329.CB) [> 4.1623 = 6.9371 < 9.0183] w=0.1317 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)A303.CB) [> 3.9085 = 6.5142 < 8.4685] w=0.1316 to align # Constraint # added constraint: constraint((T0296)V281.CB, (T0296)A300.CB) [> 3.5535 = 5.9225 < 7.6992] w=0.1311 to align # Constraint # added constraint: constraint((T0296)V281.CB, (T0296)A303.CB) [> 3.8472 = 6.4121 < 8.3357] w=0.1311 to align # Constraint # added constraint: constraint((T0296)T274.CB, (T0296)A301.CB) [> 3.2589 = 5.4315 < 7.0610] w=0.1309 to align # Constraint # added constraint: constraint((T0296)V218.CB, (T0296)M406.CB) [> 3.8635 = 6.4391 < 8.3708] w=0.1309 to align # Constraint # added constraint: constraint((T0296)G217.CA, (T0296)M406.CB) [> 3.7416 = 6.2360 < 8.1068] w=0.1309 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)E139.CB) [> 4.2204 = 7.0341 < 9.1443] w=0.1309 to align # Constraint # added constraint: constraint((T0296)C32.CB, (T0296)K43.CB) [> 3.7161 = 6.1936 < 8.0516] w=0.1223 to align # Constraint # added constraint: constraint((T0296)I44.CB, (T0296)A98.CB) [> 3.7115 = 6.1858 < 8.0416] w=0.1215 to align # Constraint # added constraint: constraint((T0296)A41.CB, (T0296)A98.CB) [> 2.8993 = 4.8322 < 6.2818] w=0.1215 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)A301.CB) [> 3.9639 = 6.6066 < 8.5885] w=0.1207 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)D268.CB) [> 3.7399 = 6.2332 < 8.1032] w=0.1198 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)S270.CB) [> 3.6725 = 6.1208 < 7.9570] w=0.1198 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)S270.CB) [> 3.5211 = 5.8684 < 7.6290] w=0.1198 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)A198.CB) [> 3.4647 = 5.7744 < 7.5068] w=0.1187 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)S324.CB) [> 4.4174 = 7.3623 < 9.5710] w=0.1175 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)S324.CB) [> 2.9506 = 4.9177 < 6.3930] w=0.1175 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A222.CB) [> 3.7183 = 6.1971 < 8.0562] w=0.1174 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)G325.CA) [> 4.0062 = 6.6769 < 8.6800] w=0.1173 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)G325.CA) [> 4.2287 = 7.0479 < 9.1622] w=0.1173 to align # Constraint # added constraint: constraint((T0296)Y122.CB, (T0296)G155.CA) [> 4.4801 = 7.4668 < 9.7069] w=0.1172 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)L323.CB) [> 3.2598 = 5.4331 < 7.0630] w=0.1172 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)L323.CB) [> 3.8214 = 6.3690 < 8.2797] w=0.1172 to align # Constraint # added constraint: constraint((T0296)T241.CB, (T0296)G265.CA) [> 3.7307 = 6.2178 < 8.0831] w=0.1168 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)T241.CB) [> 4.2384 = 7.0640 < 9.1832] w=0.1168 to align # Constraint # added constraint: constraint((T0296)A85.CB, (T0296)Y122.CB) [> 3.1520 = 5.2533 < 6.8293] w=0.1168 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)I37.CB) [> 3.6729 = 6.1215 < 7.9580] w=0.1168 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)V226.CB) [> 4.0245 = 6.7075 < 8.7198] w=0.1166 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)V226.CB) [> 3.5586 = 5.9311 < 7.7104] w=0.1166 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)G212.CA) [> 4.3789 = 7.2981 < 9.4876] w=0.1164 to align # Constraint # added constraint: constraint((T0296)I156.CB, (T0296)V202.CB) [> 3.6225 = 6.0375 < 7.8488] w=0.1163 to align # Constraint # added constraint: constraint((T0296)R227.CB, (T0296)V277.CB) [> 4.1151 = 6.8584 < 8.9160] w=0.1163 to align # Constraint # added constraint: constraint((T0296)F199.CB, (T0296)N210.CB) [> 3.3040 = 5.5066 < 7.1586] w=0.1161 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)V58.CB) [> 4.1765 = 6.9609 < 9.0492] w=0.1160 to align # Constraint # added constraint: constraint((T0296)A242.CB, (T0296)E287.CB) [> 3.0997 = 5.1661 < 6.7160] w=0.1160 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)V77.CB) [> 4.4728 = 7.4546 < 9.6910] w=0.1159 to align # Constraint # added constraint: constraint((T0296)V58.CB, (T0296)I68.CB) [> 4.4407 = 7.4012 < 9.6216] w=0.1158 to align # Constraint # added constraint: constraint((T0296)L30.CB, (T0296)S76.CB) [> 3.7041 = 6.1735 < 8.0256] w=0.1156 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)S214.CB) [> 3.7593 = 6.2655 < 8.1452] w=0.1156 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)N210.CB) [> 4.5618 = 7.6030 < 9.8839] w=0.1156 to align # Constraint # added constraint: constraint((T0296)T49.CB, (T0296)A98.CB) [> 4.1459 = 6.9098 < 8.9828] w=0.1154 to align # Constraint # added constraint: constraint((T0296)P216.CB, (T0296)L304.CB) [> 3.5223 = 5.8705 < 7.6316] w=0.1153 to align # Constraint # added constraint: constraint((T0296)I128.CB, (T0296)T171.CB) [> 3.7748 = 6.2914 < 8.1788] w=0.1153 to align # Constraint # added constraint: constraint((T0296)I83.CB, (T0296)T152.CB) [> 3.1423 = 5.2372 < 6.8084] w=0.1153 to align # Constraint # added constraint: constraint((T0296)A242.CB, (T0296)V262.CB) [> 4.4132 = 7.3553 < 9.5619] w=0.1152 to align # Constraint # added constraint: constraint((T0296)L30.CB, (T0296)V75.CB) [> 4.4455 = 7.4091 < 9.6319] w=0.1148 to align # Constraint # added constraint: constraint((T0296)C32.CB, (T0296)I48.CB) [> 3.8943 = 6.4904 < 8.4376] w=0.1148 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)V309.CB) [> 3.7335 = 6.2224 < 8.0892] w=0.1147 to align # Constraint # added constraint: constraint((T0296)V238.CB, (T0296)V309.CB) [> 3.7920 = 6.3200 < 8.2161] w=0.1147 to align # Constraint # added constraint: constraint((T0296)S81.CB, (T0296)A116.CB) [> 3.1593 = 5.2654 < 6.8451] w=0.1146 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)I167.CB) [> 3.0420 = 5.0699 < 6.5909] w=0.1144 to align # Constraint # added constraint: constraint((T0296)A40.CB, (T0296)L95.CB) [> 4.1011 = 6.8351 < 8.8856] w=0.1144 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)V234.CB) [> 4.0855 = 6.8092 < 8.8519] w=0.1143 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)F199.CB) [> 4.3018 = 7.1696 < 9.3205] w=0.1140 to align # Constraint # added constraint: constraint((T0296)P79.CB, (T0296)S115.CB) [> 4.4658 = 7.4429 < 9.6758] w=0.1140 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)I62.CB) [> 3.9203 = 6.5339 < 8.4941] w=0.1140 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)G212.CA) [> 3.1841 = 5.3068 < 6.8989] w=0.1140 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)V213.CB) [> 3.4694 = 5.7824 < 7.5171] w=0.1140 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)V314.CB) [> 4.0871 = 6.8118 < 8.8553] w=0.1139 to align # Constraint # added constraint: constraint((T0296)M12.CB, (T0296)I156.CB) [> 3.9959 = 6.6599 < 8.6579] w=0.1139 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)D206.CB) [> 3.9146 = 6.5243 < 8.4816] w=0.1139 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)L304.CB) [> 4.5862 = 7.6437 < 9.9369] w=0.1136 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)A301.CB) [> 4.5168 = 7.5280 < 9.7864] w=0.1136 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)L305.CB) [> 4.4656 = 7.4427 < 9.6756] w=0.1136 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)L304.CB) [> 2.2873 = 3.8121 < 4.9557] w=0.1136 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)A301.CB) [> 2.4161 = 4.0269 < 5.2350] w=0.1136 to align # Constraint # added constraint: constraint((T0296)P273.CB, (T0296)A300.CB) [> 3.8703 = 6.4505 < 8.3857] w=0.1136 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)S214.CB) [> 3.4325 = 5.7208 < 7.4371] w=0.1136 to align # Constraint # added constraint: constraint((T0296)V277.CB, (T0296)L302.CB) [> 4.3104 = 7.1839 < 9.3391] w=0.1135 to align # Constraint # added constraint: constraint((T0296)D34.CB, (T0296)K51.CB) [> 3.5643 = 5.9405 < 7.7227] w=0.1133 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)S270.CB) [> 3.3081 = 5.5135 < 7.1675] w=0.1133 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)V234.CB) [> 3.4208 = 5.7014 < 7.4118] w=0.1133 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)A172.CB) [> 3.6663 = 6.1105 < 7.9437] w=0.1133 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V183.CB) [> 4.0588 = 6.7647 < 8.7941] w=0.1131 to align # Constraint # added constraint: constraint((T0296)R166.CB, (T0296)R259.CB) [> 4.3219 = 7.2032 < 9.3642] w=0.1131 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)V267.CB) [> 4.6668 = 7.7780 < 10.1114] w=0.1131 to align # Constraint # added constraint: constraint((T0296)S151.CB, (T0296)N187.CB) [> 3.8895 = 6.4825 < 8.4272] w=0.1130 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)V340.CB) [> 4.1166 = 6.8611 < 8.9194] w=0.1130 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)V320.CB) [> 3.6592 = 6.0987 < 7.9283] w=0.1130 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)F231.CB) [> 4.5074 = 7.5123 < 9.7659] w=0.1128 to align # Constraint # added constraint: constraint((T0296)Q119.CB, (T0296)M195.CB) [> 3.6344 = 6.0574 < 7.8746] w=0.1128 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V219.CB) [> 3.3685 = 5.6141 < 7.2983] w=0.1127 to align # Constraint # added constraint: constraint((T0296)P273.CB, (T0296)V293.CB) [> 4.2370 = 7.0616 < 9.1801] w=0.1127 to align # Constraint # added constraint: constraint((T0296)F231.CB, (T0296)D307.CB) [> 4.4484 = 7.4139 < 9.6381] w=0.1126 to align # Constraint # added constraint: constraint((T0296)V284.CB, (T0296)A301.CB) [> 4.1336 = 6.8893 < 8.9560] w=0.1126 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)A316.CB) [> 3.3708 = 5.6179 < 7.3033] w=0.1126 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)M315.CB) [> 3.8383 = 6.3972 < 8.3163] w=0.1126 to align # Constraint # added constraint: constraint((T0296)E263.CB, (T0296)M315.CB) [> 4.1354 = 6.8924 < 8.9601] w=0.1126 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)F264.CB) [> 4.3502 = 7.2504 < 9.4255] w=0.1126 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)V234.CB) [> 3.8596 = 6.4327 < 8.3625] w=0.1126 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V207.CB) [> 3.7027 = 6.1712 < 8.0225] w=0.1126 to align # Constraint # added constraint: constraint((T0296)V284.CB, (T0296)T299.CB) [> 3.6699 = 6.1164 < 7.9513] w=0.1125 to align # Constraint # added constraint: constraint((T0296)A282.CB, (T0296)T299.CB) [> 4.1456 = 6.9093 < 8.9821] w=0.1125 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)L304.CB) [> 3.2670 = 5.4450 < 7.0784] w=0.1125 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)G321.CA) [> 3.9647 = 6.6079 < 8.5902] w=0.1125 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)N210.CB) [> 3.4550 = 5.7583 < 7.4858] w=0.1123 to align # Constraint # added constraint: constraint((T0296)M195.CB, (T0296)N210.CB) [> 3.2105 = 5.3508 < 6.9561] w=0.1123 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)M195.CB) [> 4.2349 = 7.0582 < 9.1757] w=0.1123 to align # Constraint # added constraint: constraint((T0296)I13.CB, (T0296)S145.CB) [> 2.9886 = 4.9811 < 6.4754] w=0.1122 to align # Constraint # added constraint: constraint((T0296)Q16.CB, (T0296)V143.CB) [> 4.5517 = 7.5861 < 9.8619] w=0.1122 to align # Constraint # added constraint: constraint((T0296)N17.CB, (T0296)V143.CB) [> 3.8328 = 6.3879 < 8.3043] w=0.1122 to align # Constraint # added constraint: constraint((T0296)F18.CB, (T0296)S145.CB) [> 2.3916 = 3.9860 < 5.1819] w=0.1122 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)P134.CB) [> 3.5755 = 5.9592 < 7.7469] w=0.1122 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)E127.CB) [> 3.5212 = 5.8687 < 7.6293] w=0.1122 to align # Constraint # added constraint: constraint((T0296)I37.CB, (T0296)K47.CB) [> 3.2328 = 5.3879 < 7.0043] w=0.1122 to align # Constraint # added constraint: constraint((T0296)I37.CB, (T0296)I48.CB) [> 2.9507 = 4.9178 < 6.3931] w=0.1122 to align # Constraint # added constraint: constraint((T0296)V189.CB, (T0296)V218.CB) [> 3.9741 = 6.6235 < 8.6106] w=0.1122 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)S214.CB) [> 3.0685 = 5.1142 < 6.6484] w=0.1121 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)V213.CB) [> 4.1010 = 6.8351 < 8.8856] w=0.1121 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)G212.CA) [> 3.6302 = 6.0503 < 7.8654] w=0.1121 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)I328.CB) [> 3.4336 = 5.7226 < 7.4394] w=0.1121 to align # Constraint # added constraint: constraint((T0296)V6.CB, (T0296)L55.CB) [> 3.7933 = 6.3221 < 8.2187] w=0.1120 to align # Constraint # added constraint: constraint((T0296)I3.CB, (T0296)K51.CB) [> 3.4552 = 5.7586 < 7.4862] w=0.1120 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)V219.CB) [> 3.9038 = 6.5064 < 8.4583] w=0.1119 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)E190.CB) [> 3.3793 = 5.6321 < 7.3218] w=0.1118 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)G112.CA) [> 4.1874 = 6.9790 < 9.0726] w=0.1118 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)G112.CA) [> 2.9683 = 4.9472 < 6.4313] w=0.1118 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)L271.CB) [> 4.4828 = 7.4713 < 9.7127] w=0.1116 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)F185.CB) [> 4.1021 = 6.8368 < 8.8879] w=0.1115 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)G215.CA) [> 3.9495 = 6.5825 < 8.5573] w=0.1114 to align # Constraint # added constraint: constraint((T0296)M158.CB, (T0296)A186.CB) [> 4.1679 = 6.9465 < 9.0305] w=0.1111 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)I208.CB) [> 4.0649 = 6.7749 < 8.8073] w=0.1111 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)V143.CB) [> 2.7579 = 4.5965 < 5.9754] w=0.1111 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)V330.CB) [> 3.0700 = 5.1166 < 6.6516] w=0.1111 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)P329.CB) [> 4.2641 = 7.1069 < 9.2390] w=0.1111 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)F327.CB) [> 3.6353 = 6.0589 < 7.8766] w=0.1111 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)I328.CB) [> 3.9488 = 6.5814 < 8.5558] w=0.1111 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)E204.CB) [> 4.1410 = 6.9016 < 8.9721] w=0.1110 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)L290.CB) [> 3.6008 = 6.0013 < 7.8017] w=0.1110 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)C317.CB) [> 4.6047 = 7.6745 < 9.9768] w=0.1109 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)M195.CB) [> 3.3725 = 5.6208 < 7.3070] w=0.1109 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)M164.CB) [> 4.3758 = 7.2931 < 9.4810] w=0.1108 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)F110.CB) [> 3.6218 = 6.0364 < 7.8473] w=0.1107 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)A196.CB) [> 3.5851 = 5.9751 < 7.7676] w=0.1107 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)V293.CB) [> 3.8300 = 6.3834 < 8.2984] w=0.1106 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)L271.CB) [> 4.1507 = 6.9178 < 8.9932] w=0.1106 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)G325.CA) [> 3.1881 = 5.3136 < 6.9076] w=0.1105 to align # Constraint # added constraint: constraint((T0296)G150.CA, (T0296)V183.CB) [> 3.9485 = 6.5809 < 8.5552] w=0.1104 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)M336.CB) [> 4.1367 = 6.8944 < 8.9628] w=0.1104 to align # Constraint # added constraint: constraint((T0296)T299.CB, (T0296)M336.CB) [> 3.3548 = 5.5913 < 7.2687] w=0.1104 to align # Constraint # added constraint: constraint((T0296)T299.CB, (T0296)G335.CA) [> 4.3511 = 7.2518 < 9.4273] w=0.1104 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)N210.CB) [> 4.0286 = 6.7144 < 8.7287] w=0.1102 to align # Constraint # added constraint: constraint((T0296)P367.CB, (T0296)A376.CB) [> 4.2303 = 7.0506 < 9.1657] w=0.1101 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)G265.CA) [> 4.2112 = 7.0187 < 9.1243] w=0.1098 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)V267.CB) [> 4.3523 = 7.2538 < 9.4299] w=0.1098 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)S270.CB) [> 3.7891 = 6.3152 < 8.2097] w=0.1098 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)V252.CB) [> 3.7148 = 6.1914 < 8.0488] w=0.1098 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)S280.CB) [> 4.0411 = 6.7351 < 8.7557] w=0.1097 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)P329.CB) [> 3.6971 = 6.1618 < 8.0104] w=0.1096 to align # Constraint # added constraint: constraint((T0296)L223.CB, (T0296)M336.CB) [> 3.5917 = 5.9861 < 7.7820] w=0.1094 to align # Constraint # added constraint: constraint((T0296)A276.CB, (T0296)A300.CB) [> 3.3687 = 5.6145 < 7.2989] w=0.1090 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)G325.CA) [> 3.9709 = 6.6181 < 8.6035] w=0.0973 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)L323.CB) [> 3.4672 = 5.7786 < 7.5122] w=0.0973 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)V320.CB) [> 3.0033 = 5.0055 < 6.5071] w=0.0973 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)V320.CB) [> 3.9740 = 6.6234 < 8.6104] w=0.0973 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)A301.CB) [> 4.1625 = 6.9375 < 9.0188] w=0.0970 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)V267.CB) [> 3.9324 = 6.5541 < 8.5203] w=0.0967 to align # Constraint # added constraint: constraint((T0296)T7.CB, (T0296)V58.CB) [> 3.7805 = 6.3008 < 8.1910] w=0.0962 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)A180.CB) [> 3.9464 = 6.5773 < 8.5505] w=0.0960 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)L323.CB) [> 4.3569 = 7.2615 < 9.4400] w=0.0956 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)A316.CB) [> 3.0793 = 5.1321 < 6.6717] w=0.0951 to align # Constraint # added constraint: constraint((T0296)I80.CB, (T0296)S115.CB) [> 3.5201 = 5.8668 < 7.6268] w=0.0951 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)A222.CB) [> 3.4219 = 5.7032 < 7.4141] w=0.0942 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)V267.CB) [> 4.3635 = 7.2725 < 9.4543] w=0.0939 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)F264.CB) [> 3.4186 = 5.6977 < 7.4070] w=0.0939 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)L305.CB) [> 4.1123 = 6.8539 < 8.9100] w=0.0936 to align # Constraint # added constraint: constraint((T0296)I156.CB, (T0296)M177.CB) [> 3.1558 = 5.2597 < 6.8376] w=0.0936 to align # Constraint # added constraint: constraint((T0296)G84.CA, (T0296)S151.CB) [> 3.6534 = 6.0890 < 7.9157] w=0.0936 to align # Constraint # added constraint: constraint((T0296)I83.CB, (T0296)S151.CB) [> 4.4289 = 7.3815 < 9.5959] w=0.0936 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A198.CB) [> 3.1554 = 5.2590 < 6.8367] w=0.0936 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)V284.CB) [> 4.4090 = 7.3483 < 9.5528] w=0.0936 to align # Constraint # added constraint: constraint((T0296)A235.CB, (T0296)R283.CB) [> 2.7641 = 4.6068 < 5.9889] w=0.0936 to align # Constraint # added constraint: constraint((T0296)A242.CB, (T0296)M288.CB) [> 3.3800 = 5.6334 < 7.3234] w=0.0936 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)M288.CB) [> 4.3956 = 7.3259 < 9.5237] w=0.0936 to align # Constraint # added constraint: constraint((T0296)I80.CB, (T0296)V118.CB) [> 4.0177 = 6.6962 < 8.7051] w=0.0934 to align # Constraint # added constraint: constraint((T0296)M177.CB, (T0296)G203.CA) [> 2.7401 = 4.5669 < 5.9369] w=0.0934 to align # Constraint # added constraint: constraint((T0296)D31.CB, (T0296)S76.CB) [> 2.7032 = 4.5053 < 5.8569] w=0.0933 to align # Constraint # added constraint: constraint((T0296)F231.CB, (T0296)R283.CB) [> 2.8213 = 4.7022 < 6.1129] w=0.0932 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)V267.CB) [> 4.7178 = 7.8629 < 10.2218] w=0.0932 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)V211.CB) [> 4.4129 = 7.3548 < 9.5612] w=0.0930 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)P216.CB) [> 3.8513 = 6.4188 < 8.3444] w=0.0930 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)I266.CB) [> 4.0026 = 6.6710 < 8.6723] w=0.0929 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)D268.CB) [> 3.5943 = 5.9905 < 7.7876] w=0.0929 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)D268.CB) [> 3.4478 = 5.7463 < 7.4702] w=0.0927 to align # Constraint # added constraint: constraint((T0296)S81.CB, (T0296)K120.CB) [> 3.1236 = 5.2060 < 6.7678] w=0.0926 to align # Constraint # added constraint: constraint((T0296)T7.CB, (T0296)E61.CB) [> 4.2780 = 7.1299 < 9.2689] w=0.0925 to align # Constraint # added constraint: constraint((T0296)V277.CB, (T0296)G294.CA) [> 3.4921 = 5.8202 < 7.5662] w=0.0924 to align # Constraint # added constraint: constraint((T0296)C32.CB, (T0296)S76.CB) [> 4.3137 = 7.1895 < 9.3463] w=0.0924 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)V262.CB) [> 3.7885 = 6.3142 < 8.2085] w=0.0922 to align # Constraint # added constraint: constraint((T0296)S28.CB, (T0296)S81.CB) [> 4.0285 = 6.7141 < 8.7283] w=0.0921 to align # Constraint # added constraint: constraint((T0296)D31.CB, (T0296)V77.CB) [> 3.7653 = 6.2754 < 8.1581] w=0.0920 to align # Constraint # added constraint: constraint((T0296)S81.CB, (T0296)L117.CB) [> 4.0352 = 6.7254 < 8.7430] w=0.0920 to align # Constraint # added constraint: constraint((T0296)T274.CB, (T0296)A303.CB) [> 4.3388 = 7.2314 < 9.4008] w=0.0918 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)V77.CB) [> 3.6693 = 6.1156 < 7.9503] w=0.0913 to align # Constraint # added constraint: constraint((T0296)C32.CB, (T0296)N72.CB) [> 3.3280 = 5.5467 < 7.2107] w=0.0912 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)L182.CB) [> 4.1109 = 6.8514 < 8.9069] w=0.0912 to align # Constraint # added constraint: constraint((T0296)I33.CB, (T0296)A85.CB) [> 4.3144 = 7.1907 < 9.3479] w=0.0909 to align # Constraint # added constraint: constraint((T0296)C32.CB, (T0296)G84.CA) [> 4.1953 = 6.9921 < 9.0898] w=0.0909 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)V207.CB) [> 3.6822 = 6.1370 < 7.9781] w=0.0907 to align # Constraint # added constraint: constraint((T0296)I68.CB, (T0296)S145.CB) [> 4.6224 = 7.7040 < 10.0152] w=0.0906 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)S230.CB) [> 2.7025 = 4.5041 < 5.8554] w=0.0906 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)I266.CB) [> 3.7327 = 6.2212 < 8.0875] w=0.0905 to align # Constraint # added constraint: constraint((T0296)S81.CB, (T0296)F114.CB) [> 3.5717 = 5.9529 < 7.7387] w=0.0905 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)F194.CB) [> 3.2794 = 5.4657 < 7.1054] w=0.0904 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)V77.CB) [> 3.7050 = 6.1750 < 8.0275] w=0.0904 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)C317.CB) [> 3.6257 = 6.0428 < 7.8556] w=0.0903 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)C317.CB) [> 3.2390 = 5.3984 < 7.0179] w=0.0903 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)N318.CB) [> 3.3544 = 5.5906 < 7.2678] w=0.0903 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)G321.CA) [> 3.7654 = 6.2757 < 8.1583] w=0.0903 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)G321.CA) [> 3.9784 = 6.6307 < 8.6199] w=0.0903 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)G322.CA) [> 3.6740 = 6.1234 < 7.9604] w=0.0903 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)L323.CB) [> 2.7238 = 4.5396 < 5.9015] w=0.0903 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)G322.CA) [> 3.3528 = 5.5879 < 7.2643] w=0.0903 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)L323.CB) [> 3.3996 = 5.6660 < 7.3659] w=0.0903 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)I208.CB) [> 3.4344 = 5.7239 < 7.4411] w=0.0902 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)G322.CA) [> 3.9384 = 6.5640 < 8.5331] w=0.0901 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)V320.CB) [> 3.1925 = 5.3208 < 6.9171] w=0.0901 to align # Constraint # added constraint: constraint((T0296)V309.CB, (T0296)N318.CB) [> 4.1966 = 6.9943 < 9.0926] w=0.0901 to align # Constraint # added constraint: constraint((T0296)V309.CB, (T0296)V320.CB) [> 3.4401 = 5.7336 < 7.4536] w=0.0901 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V218.CB) [> 3.6567 = 6.0946 < 7.9229] w=0.0901 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)D268.CB) [> 4.6370 = 7.7284 < 10.0469] w=0.0900 to align # Constraint # added constraint: constraint((T0296)M195.CB, (T0296)V213.CB) [> 3.5042 = 5.8404 < 7.5925] w=0.0900 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)I111.CB) [> 4.3492 = 7.2486 < 9.4232] w=0.0900 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)V267.CB) [> 4.2860 = 7.1433 < 9.2863] w=0.0899 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)I111.CB) [> 4.1003 = 6.8338 < 8.8840] w=0.0898 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)I111.CB) [> 3.9833 = 6.6388 < 8.6305] w=0.0898 to align # Constraint # added constraint: constraint((T0296)V6.CB, (T0296)K47.CB) [> 4.2790 = 7.1316 < 9.2711] w=0.0897 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)A326.CB) [> 4.1497 = 6.9162 < 8.9911] w=0.0897 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)S146.CB) [> 3.9861 = 6.6435 < 8.6366] w=0.0897 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)P273.CB) [> 3.6503 = 6.0838 < 7.9089] w=0.0896 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)A198.CB) [> 4.0821 = 6.8035 < 8.8446] w=0.0895 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)V219.CB) [> 4.0261 = 6.7101 < 8.7232] w=0.0895 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)A222.CB) [> 4.2109 = 7.0182 < 9.1236] w=0.0895 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)F264.CB) [> 3.6584 = 6.0973 < 7.9265] w=0.0895 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)F327.CB) [> 2.7162 = 4.5271 < 5.8852] w=0.0895 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)S145.CB) [> 4.0092 = 6.6820 < 8.6867] w=0.0895 to align # Constraint # added constraint: constraint((T0296)I33.CB, (T0296)I83.CB) [> 4.1950 = 6.9917 < 9.0892] w=0.0894 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)V75.CB) [> 4.4331 = 7.3884 < 9.6049] w=0.0894 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)P79.CB) [> 3.4547 = 5.7578 < 7.4852] w=0.0894 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)S132.CB) [> 3.6520 = 6.0867 < 7.9127] w=0.0893 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)C317.CB) [> 4.1154 = 6.8590 < 8.9167] w=0.0892 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)T298.CB) [> 3.7196 = 6.1993 < 8.0591] w=0.0892 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)A256.CB) [> 4.1115 = 6.8524 < 8.9081] w=0.0892 to align # Constraint # added constraint: constraint((T0296)V6.CB, (T0296)V58.CB) [> 4.2943 = 7.1571 < 9.3042] w=0.0892 to align # Constraint # added constraint: constraint((T0296)L30.CB, (T0296)T87.CB) [> 3.5690 = 5.9484 < 7.7329] w=0.0892 to align # Constraint # added constraint: constraint((T0296)P273.CB, (T0296)F327.CB) [> 3.9220 = 6.5366 < 8.4976] w=0.0891 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)F110.CB) [> 3.7750 = 6.2916 < 8.1791] w=0.0891 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)G112.CA) [> 4.5034 = 7.5056 < 9.7573] w=0.0891 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)G215.CA) [> 4.1934 = 6.9889 < 9.0856] w=0.0889 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)I209.CB) [> 3.2673 = 5.4454 < 7.0790] w=0.0889 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)G297.CA) [> 4.3181 = 7.1968 < 9.3558] w=0.0888 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)G297.CA) [> 2.7496 = 4.5826 < 5.9574] w=0.0888 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)A256.CB) [> 3.6177 = 6.0294 < 7.8383] w=0.0887 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)I208.CB) [> 3.7740 = 6.2900 < 8.1770] w=0.0886 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)S214.CB) [> 3.3587 = 5.5978 < 7.2772] w=0.0886 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)L285.CB) [> 3.4801 = 5.8001 < 7.5402] w=0.0886 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)V330.CB) [> 4.5868 = 7.6447 < 9.9381] w=0.0885 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)L361.CB) [> 3.7174 = 6.1956 < 8.0543] w=0.0882 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)A301.CB) [> 3.8587 = 6.4312 < 8.3606] w=0.0881 to align # Constraint # added constraint: constraint((T0296)L117.CB, (T0296)I133.CB) [> 3.9435 = 6.5725 < 8.5443] w=0.0881 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)A316.CB) [> 3.8373 = 6.3955 < 8.3142] w=0.0881 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)A301.CB) [> 2.8196 = 4.6994 < 6.1092] w=0.0880 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)T298.CB) [> 3.8867 = 6.4779 < 8.4212] w=0.0880 to align # Constraint # added constraint: constraint((T0296)G249.CA, (T0296)V267.CB) [> 4.5262 = 7.5437 < 9.8068] w=0.0880 to align # Constraint # added constraint: constraint((T0296)P216.CB, (T0296)L251.CB) [> 3.2796 = 5.4660 < 7.1058] w=0.0880 to align # Constraint # added constraint: constraint((T0296)L285.CB, (T0296)L305.CB) [> 2.6987 = 4.4978 < 5.8471] w=0.0880 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)A86.CB) [> 4.1360 = 6.8933 < 8.9613] w=0.0879 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)I328.CB) [> 3.9716 = 6.6194 < 8.6052] w=0.0878 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)V143.CB) [> 4.1375 = 6.8959 < 8.9646] w=0.0877 to align # Constraint # added constraint: constraint((T0296)T298.CB, (T0296)V330.CB) [> 3.8424 = 6.4040 < 8.3252] w=0.0875 to align # Constraint # added constraint: constraint((T0296)I337.CB, (T0296)I364.CB) [> 4.3788 = 7.2981 < 9.4875] w=0.0875 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)A172.CB) [> 3.5285 = 5.8809 < 7.6452] w=0.0874 to align # Constraint # added constraint: constraint((T0296)M288.CB, (T0296)T299.CB) [> 4.7664 = 7.9440 < 10.3272] w=0.0873 to align # Constraint # added constraint: constraint((T0296)V281.CB, (T0296)T295.CB) [> 3.7404 = 6.2341 < 8.1043] w=0.0873 to align # Constraint # added constraint: constraint((T0296)V118.CB, (T0296)L129.CB) [> 3.2416 = 5.4027 < 7.0236] w=0.0873 to align # Constraint # added constraint: constraint((T0296)V277.CB, (T0296)A301.CB) [> 3.8376 = 6.3960 < 8.3148] w=0.0872 to align # Constraint # added constraint: constraint((T0296)T274.CB, (T0296)A300.CB) [> 2.6568 = 4.4279 < 5.7563] w=0.0871 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)V71.CB) [> 4.4195 = 7.3658 < 9.5755] w=0.0757 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)L271.CB) [> 3.5786 = 5.9643 < 7.7536] w=0.0753 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)A316.CB) [> 2.6220 = 4.3699 < 5.6809] w=0.0742 to align # Constraint # added constraint: constraint((T0296)K244.CB, (T0296)G261.CA) [> 2.9869 = 4.9781 < 6.4715] w=0.0733 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)M315.CB) [> 4.2871 = 7.1451 < 9.2886] w=0.0731 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)L290.CB) [> 4.2476 = 7.0793 < 9.2031] w=0.0730 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)G215.CA) [> 2.6843 = 4.4738 < 5.8159] w=0.0712 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)E382.CB) [> 3.0093 = 5.0155 < 6.5201] w=0.0709 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)I379.CB) [> 3.3205 = 5.5342 < 7.1944] w=0.0709 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)M378.CB) [> 2.8369 = 4.7282 < 6.1466] w=0.0709 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)M378.CB) [> 4.4084 = 7.3473 < 9.5515] w=0.0709 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)V71.CB) [> 3.3882 = 5.6469 < 7.3410] w=0.0706 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)V75.CB) [> 4.4330 = 7.3883 < 9.6047] w=0.0706 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)L182.CB) [> 3.8359 = 6.3931 < 8.3110] w=0.0706 to align # Constraint # added constraint: constraint((T0296)T9.CB, (T0296)I62.CB) [> 3.7620 = 6.2701 < 8.1511] w=0.0706 to align # Constraint # added constraint: constraint((T0296)A235.CB, (T0296)V284.CB) [> 4.0686 = 6.7810 < 8.8153] w=0.0701 to align # Constraint # added constraint: constraint((T0296)D279.CB, (T0296)A303.CB) [> 4.1129 = 6.8549 < 8.9114] w=0.0700 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)L304.CB) [> 4.0491 = 6.7485 < 8.7730] w=0.0700 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)L304.CB) [> 3.2612 = 5.4353 < 7.0659] w=0.0700 to align # Constraint # added constraint: constraint((T0296)V281.CB, (T0296)G294.CA) [> 3.7302 = 6.2170 < 8.0821] w=0.0700 to align # Constraint # added constraint: constraint((T0296)V281.CB, (T0296)V293.CB) [> 4.5715 = 7.6191 < 9.9049] w=0.0700 to align # Constraint # added constraint: constraint((T0296)S280.CB, (T0296)N306.CB) [> 3.2879 = 5.4798 < 7.1238] w=0.0700 to align # Constraint # added constraint: constraint((T0296)S280.CB, (T0296)L305.CB) [> 4.5832 = 7.6386 < 9.9302] w=0.0700 to align # Constraint # added constraint: constraint((T0296)S280.CB, (T0296)L302.CB) [> 2.6122 = 4.3536 < 5.6597] w=0.0700 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)A198.CB) [> 2.8992 = 4.8320 < 6.2816] w=0.0698 to align # Constraint # added constraint: constraint((T0296)L29.CB, (T0296)L82.CB) [> 2.2746 = 3.7910 < 4.9283] w=0.0698 to align # Constraint # added constraint: constraint((T0296)V6.CB, (T0296)I68.CB) [> 3.4986 = 5.8310 < 7.5803] w=0.0693 to align # Constraint # added constraint: constraint((T0296)I3.CB, (T0296)I68.CB) [> 4.1318 = 6.8864 < 8.9523] w=0.0693 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)A256.CB) [> 4.1446 = 6.9077 < 8.9800] w=0.0693 to align # Constraint # added constraint: constraint((T0296)A256.CB, (T0296)G265.CA) [> 3.8797 = 6.4662 < 8.4061] w=0.0686 to align # Constraint # added constraint: constraint((T0296)T9.CB, (T0296)L66.CB) [> 3.3554 = 5.5923 < 7.2700] w=0.0685 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)D206.CB) [> 2.7350 = 4.5583 < 5.9258] w=0.0685 to align # Constraint # added constraint: constraint((T0296)A160.CB, (T0296)V184.CB) [> 4.6583 = 7.7639 < 10.0931] w=0.0684 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)L66.CB) [> 4.4621 = 7.4368 < 9.6679] w=0.0684 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)L290.CB) [> 3.3172 = 5.5286 < 7.1872] w=0.0683 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)V118.CB) [> 4.6405 = 7.7342 < 10.0545] w=0.0683 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)V211.CB) [> 3.9094 = 6.5156 < 8.4703] w=0.0683 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)G217.CA) [> 4.3623 = 7.2706 < 9.4517] w=0.0682 to align # Constraint # added constraint: constraint((T0296)G26.CA, (T0296)G84.CA) [> 3.4046 = 5.6744 < 7.3767] w=0.0682 to align # Constraint # added constraint: constraint((T0296)A40.CB, (T0296)G84.CA) [> 4.4577 = 7.4294 < 9.6583] w=0.0682 to align # Constraint # added constraint: constraint((T0296)I44.CB, (T0296)G84.CA) [> 4.5587 = 7.5978 < 9.8772] w=0.0682 to align # Constraint # added constraint: constraint((T0296)I80.CB, (T0296)A160.CB) [> 4.7802 = 7.9670 < 10.3571] w=0.0682 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)L55.CB) [> 4.1013 = 6.8355 < 8.8861] w=0.0682 to align # Constraint # added constraint: constraint((T0296)L290.CB, (T0296)A301.CB) [> 4.6352 = 7.7254 < 10.0430] w=0.0682 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)G322.CA) [> 3.5738 = 5.9564 < 7.7433] w=0.0682 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)G321.CA) [> 3.7347 = 6.2245 < 8.0919] w=0.0682 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)L305.CB) [> 3.6351 = 6.0586 < 7.8762] w=0.0682 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)A316.CB) [> 2.8013 = 4.6688 < 6.0694] w=0.0682 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)G312.CA) [> 4.1928 = 6.9880 < 9.0844] w=0.0682 to align # Constraint # added constraint: constraint((T0296)E263.CB, (T0296)A316.CB) [> 4.0626 = 6.7710 < 8.8023] w=0.0682 to align # Constraint # added constraint: constraint((T0296)S257.CB, (T0296)A316.CB) [> 3.5504 = 5.9173 < 7.6925] w=0.0682 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)I209.CB) [> 3.5890 = 5.9817 < 7.7762] w=0.0682 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)F110.CB) [> 3.7877 = 6.3128 < 8.2067] w=0.0680 to align # Constraint # added constraint: constraint((T0296)T9.CB, (T0296)G112.CA) [> 3.4584 = 5.7641 < 7.4933] w=0.0680 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)N72.CB) [> 4.4026 = 7.3377 < 9.5391] w=0.0678 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)V184.CB) [> 3.8154 = 6.3590 < 8.2667] w=0.0677 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)A186.CB) [> 4.3346 = 7.2244 < 9.3917] w=0.0677 to align # Constraint # added constraint: constraint((T0296)F194.CB, (T0296)G253.CA) [> 4.4102 = 7.3503 < 9.5554] w=0.0677 to align # Constraint # added constraint: constraint((T0296)F199.CB, (T0296)G289.CA) [> 3.2133 = 5.3555 < 6.9621] w=0.0676 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)E204.CB) [> 4.1723 = 6.9538 < 9.0400] w=0.0676 to align # Constraint # added constraint: constraint((T0296)L223.CB, (T0296)T241.CB) [> 4.5756 = 7.6260 < 9.9138] w=0.0675 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)G289.CA) [> 4.3169 = 7.1947 < 9.3532] w=0.0674 to align # Constraint # added constraint: constraint((T0296)P273.CB, (T0296)T298.CB) [> 2.9270 = 4.8783 < 6.3418] w=0.0673 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)S145.CB) [> 3.6782 = 6.1304 < 7.9694] w=0.0673 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)S270.CB) [> 3.9441 = 6.5735 < 8.5456] w=0.0673 to align # Constraint # added constraint: constraint((T0296)P275.CB, (T0296)P329.CB) [> 3.3810 = 5.6350 < 7.3254] w=0.0673 to align # Constraint # added constraint: constraint((T0296)P275.CB, (T0296)F327.CB) [> 2.7231 = 4.5386 < 5.9001] w=0.0673 to align # Constraint # added constraint: constraint((T0296)P275.CB, (T0296)G325.CA) [> 4.0457 = 6.7428 < 8.7657] w=0.0673 to align # Constraint # added constraint: constraint((T0296)P273.CB, (T0296)V330.CB) [> 2.8267 = 4.7111 < 6.1245] w=0.0673 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)V330.CB) [> 3.8409 = 6.4016 < 8.3220] w=0.0673 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)P329.CB) [> 4.2715 = 7.1192 < 9.2550] w=0.0673 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)I328.CB) [> 4.5147 = 7.5245 < 9.7818] w=0.0673 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)D333.CB) [> 3.6728 = 6.1214 < 7.9578] w=0.0673 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)E332.CB) [> 4.7853 = 7.9755 < 10.3681] w=0.0673 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)M336.CB) [> 4.7495 = 7.9158 < 10.2905] w=0.0673 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)V340.CB) [> 3.7095 = 6.1824 < 8.0372] w=0.0673 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)G215.CA) [> 4.2963 = 7.1606 < 9.3087] w=0.0673 to align # Constraint # added constraint: constraint((T0296)G217.CA, (T0296)A242.CB) [> 3.9783 = 6.6304 < 8.6196] w=0.0672 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)L117.CB) [> 4.2153 = 7.0254 < 9.1330] w=0.0672 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)T78.CB) [> 3.7256 = 6.2093 < 8.0721] w=0.0672 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)A256.CB) [> 2.6534 = 4.4223 < 5.7490] w=0.0672 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)V211.CB) [> 4.4356 = 7.3926 < 9.6104] w=0.0672 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)I208.CB) [> 4.4311 = 7.3852 < 9.6008] w=0.0672 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)E204.CB) [> 4.4580 = 7.4300 < 9.6590] w=0.0672 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)C317.CB) [> 4.0880 = 6.8133 < 8.8573] w=0.0672 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)V340.CB) [> 4.0930 = 6.8217 < 8.8683] w=0.0672 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)V314.CB) [> 3.6326 = 6.0543 < 7.8706] w=0.0672 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)V314.CB) [> 3.3115 = 5.5192 < 7.1749] w=0.0672 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)V314.CB) [> 2.7405 = 4.5675 < 5.9377] w=0.0672 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)G313.CA) [> 4.6181 = 7.6968 < 10.0059] w=0.0672 to align # Constraint # added constraint: constraint((T0296)K220.CB, (T0296)L271.CB) [> 3.0051 = 5.0085 < 6.5110] w=0.0672 to align # Constraint # added constraint: constraint((T0296)K220.CB, (T0296)S270.CB) [> 4.1811 = 6.9686 < 9.0591] w=0.0672 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)L271.CB) [> 4.3087 = 7.1812 < 9.3356] w=0.0672 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)S76.CB) [> 4.2576 = 7.0960 < 9.2247] w=0.0672 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)V143.CB) [> 3.1299 = 5.2165 < 6.7814] w=0.0671 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)S132.CB) [> 3.4026 = 5.6710 < 7.3724] w=0.0671 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)V143.CB) [> 4.5653 = 7.6089 < 9.8915] w=0.0671 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)D333.CB) [> 4.5268 = 7.5446 < 9.8080] w=0.0671 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)D268.CB) [> 4.4803 = 7.4672 < 9.7074] w=0.0671 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)N187.CB) [> 4.3706 = 7.2844 < 9.4697] w=0.0671 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)G297.CA) [> 2.7857 = 4.6429 < 6.0358] w=0.0670 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)G215.CA) [> 3.9251 = 6.5419 < 8.5045] w=0.0669 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)V320.CB) [> 4.6630 = 7.7716 < 10.1031] w=0.0668 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)F264.CB) [> 3.5461 = 5.9101 < 7.6832] w=0.0667 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)P79.CB) [> 3.2614 = 5.4356 < 7.0663] w=0.0667 to align # Constraint # added constraint: constraint((T0296)T9.CB, (T0296)I111.CB) [> 4.1292 = 6.8819 < 8.9465] w=0.0667 to align # Constraint # added constraint: constraint((T0296)N157.CB, (T0296)A222.CB) [> 4.4028 = 7.3380 < 9.5394] w=0.0667 to align # Constraint # added constraint: constraint((T0296)K153.CB, (T0296)A186.CB) [> 2.6070 = 4.3450 < 5.6484] w=0.0667 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)A326.CB) [> 3.3298 = 5.5496 < 7.2145] w=0.0665 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)G360.CA) [> 4.0469 = 6.7448 < 8.7682] w=0.0665 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)Q319.CB) [> 4.4263 = 7.3771 < 9.5902] w=0.0665 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)A222.CB) [> 4.0244 = 6.7074 < 8.7196] w=0.0665 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)E204.CB) [> 2.6872 = 4.4787 < 5.8222] w=0.0664 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)A205.CB) [> 3.1996 = 5.3327 < 6.9325] w=0.0664 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)E204.CB) [> 3.6132 = 6.0220 < 7.8286] w=0.0664 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)A205.CB) [> 3.7172 = 6.1953 < 8.0539] w=0.0664 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)E204.CB) [> 2.3012 = 3.8353 < 4.9859] w=0.0664 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)I209.CB) [> 3.1419 = 5.2364 < 6.8074] w=0.0664 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)N210.CB) [> 1.6469 = 2.7449 < 3.5684] w=0.0664 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)N210.CB) [> 4.5385 = 7.5641 < 9.8334] w=0.0664 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)F327.CB) [> 3.3233 = 5.5389 < 7.2006] w=0.0663 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)M363.CB) [> 4.2996 = 7.1659 < 9.3157] w=0.0663 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)D362.CB) [> 3.3073 = 5.5122 < 7.1659] w=0.0663 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)M363.CB) [> 4.5309 = 7.5514 < 9.8169] w=0.0663 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)D362.CB) [> 3.1734 = 5.2891 < 6.8758] w=0.0663 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)L323.CB) [> 4.4450 = 7.4084 < 9.6309] w=0.0663 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)I379.CB) [> 3.9598 = 6.5996 < 8.5795] w=0.0663 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)D362.CB) [> 4.4551 = 7.4252 < 9.6528] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)G360.CA) [> 4.6537 = 7.7562 < 10.0831] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)V359.CB) [> 2.8479 = 4.7465 < 6.1705] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)G360.CA) [> 4.2051 = 7.0085 < 9.1110] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)V359.CB) [> 3.5856 = 5.9761 < 7.7689] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)S358.CB) [> 4.4358 = 7.3930 < 9.6109] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)C357.CB) [> 2.4032 = 4.0053 < 5.2069] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)G294.CA) [> 2.8237 = 4.7062 < 6.1181] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)I379.CB) [> 4.6835 = 7.8057 < 10.1475] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)G360.CA) [> 3.3533 = 5.5889 < 7.2655] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)V359.CB) [> 4.7432 = 7.9053 < 10.2769] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)S358.CB) [> 3.6223 = 6.0372 < 7.8483] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)C357.CB) [> 3.5036 = 5.8393 < 7.5911] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)S358.CB) [> 4.6213 = 7.7022 < 10.0129] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)C357.CB) [> 2.4974 = 4.1624 < 5.4111] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)I356.CB) [> 4.3342 = 7.2237 < 9.3909] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)A355.CB) [> 3.8379 = 6.3965 < 8.3155] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)L302.CB) [> 4.6994 = 7.8324 < 10.1821] w=0.0662 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)G386.CA) [> 3.9166 = 6.5277 < 8.4860] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)M378.CB) [> 2.6658 = 4.4430 < 5.7759] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)I375.CB) [> 4.4136 = 7.3560 < 9.5628] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)T374.CB) [> 3.6413 = 6.0688 < 7.8895] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)T370.CB) [> 3.7830 = 6.3050 < 8.1965] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)G360.CA) [> 4.2987 = 7.1645 < 9.3139] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)V359.CB) [> 3.7902 = 6.3170 < 8.2121] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)S358.CB) [> 4.0277 = 6.7128 < 8.7267] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)T370.CB) [> 3.4093 = 5.6821 < 7.3868] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)E368.CB) [> 2.8639 = 4.7731 < 6.2051] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)M363.CB) [> 3.2287 = 5.3811 < 6.9955] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)D362.CB) [> 3.8002 = 6.3336 < 8.2337] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)G360.CA) [> 3.2355 = 5.3925 < 7.0102] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)V359.CB) [> 3.0254 = 5.0423 < 6.5550] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)A365.CB) [> 4.4372 = 7.3952 < 9.6138] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)I364.CB) [> 3.8270 = 6.3783 < 8.2918] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)M363.CB) [> 2.7443 = 4.5738 < 5.9460] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)L305.CB) [> 3.3907 = 5.6511 < 7.3465] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)L304.CB) [> 3.2791 = 5.4652 < 7.1047] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)H296.CB) [> 2.4440 = 4.0734 < 5.2954] w=0.0662 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A383.CB) [> 3.5985 = 5.9975 < 7.7968] w=0.0662 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)C357.CB) [> 4.5338 = 7.5563 < 9.8231] w=0.0662 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)I356.CB) [> 3.2940 = 5.4899 < 7.1369] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)C357.CB) [> 4.6309 = 7.7183 < 10.0337] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)I356.CB) [> 4.1528 = 6.9214 < 8.9978] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)A355.CB) [> 2.4284 = 4.0474 < 5.2616] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)L305.CB) [> 3.4985 = 5.8309 < 7.5802] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)L302.CB) [> 3.6427 = 6.0712 < 7.8926] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)H296.CB) [> 3.7619 = 6.2698 < 8.1508] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)G386.CA) [> 3.5345 = 5.8909 < 7.6581] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)I356.CB) [> 3.9214 = 6.5356 < 8.4963] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)A355.CB) [> 4.5770 = 7.6283 < 9.9168] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)V314.CB) [> 4.0374 = 6.7290 < 8.7477] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)L305.CB) [> 3.7105 = 6.1841 < 8.0393] w=0.0662 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)V314.CB) [> 4.3383 = 7.2305 < 9.3996] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)V314.CB) [> 3.8436 = 6.4059 < 8.3277] w=0.0662 to align # Constraint # added constraint: constraint((T0296)E170.CB, (T0296)G312.CA) [> 4.1828 = 6.9714 < 9.0628] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)A355.CB) [> 3.6307 = 6.0512 < 7.8665] w=0.0662 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)I385.CB) [> 4.5798 = 7.6330 < 9.9229] w=0.0662 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)I356.CB) [> 4.6224 = 7.7040 < 10.0152] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A256.CB, (T0296)G386.CA) [> 3.7075 = 6.1792 < 8.0330] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A256.CB, (T0296)I385.CB) [> 2.8609 = 4.7682 < 6.1987] w=0.0662 to align # Constraint # added constraint: constraint((T0296)G360.CA, (T0296)M378.CB) [> 4.6349 = 7.7249 < 10.0424] w=0.0662 to align # Constraint # added constraint: constraint((T0296)G360.CA, (T0296)I375.CB) [> 3.7048 = 6.1747 < 8.0271] w=0.0662 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)D381.CB) [> 4.7007 = 7.8345 < 10.1849] w=0.0662 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)I375.CB) [> 4.5920 = 7.6533 < 9.9493] w=0.0662 to align # Constraint # added constraint: constraint((T0296)C357.CB, (T0296)E382.CB) [> 4.4897 = 7.4829 < 9.7278] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I356.CB, (T0296)G386.CA) [> 3.7016 = 6.1694 < 8.0202] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I356.CB, (T0296)I385.CB) [> 4.1245 = 6.8742 < 8.9364] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I356.CB, (T0296)E382.CB) [> 3.5038 = 5.8397 < 7.5916] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)A355.CB) [> 4.6274 = 7.7123 < 10.0260] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)A355.CB) [> 2.2083 = 3.6805 < 4.7846] w=0.0662 to align # Constraint # added constraint: constraint((T0296)H296.CB, (T0296)A355.CB) [> 4.4448 = 7.4080 < 9.6304] w=0.0662 to align # Constraint # added constraint: constraint((T0296)H296.CB, (T0296)L305.CB) [> 3.4030 = 5.6716 < 7.3731] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V293.CB, (T0296)I364.CB) [> 3.8227 = 6.3712 < 8.2826] w=0.0662 to align # Constraint # added constraint: constraint((T0296)T292.CB, (T0296)V359.CB) [> 3.7463 = 6.2438 < 8.1169] w=0.0662 to align # Constraint # added constraint: constraint((T0296)T292.CB, (T0296)C357.CB) [> 3.0648 = 5.1080 < 6.6404] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A282.CB, (T0296)A365.CB) [> 3.9630 = 6.6049 < 8.5864] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A282.CB, (T0296)I364.CB) [> 3.2557 = 5.4262 < 7.0540] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A282.CB, (T0296)V293.CB) [> 4.4902 = 7.4837 < 9.7288] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)C357.CB) [> 4.2776 = 7.1293 < 9.2681] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)L302.CB) [> 2.7772 = 4.6287 < 6.0174] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)L269.CB) [> 2.0788 = 3.4646 < 4.5040] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)C357.CB) [> 4.7633 = 7.9389 < 10.3205] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)I356.CB) [> 3.2232 = 5.3721 < 6.9837] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)A355.CB) [> 4.3100 = 7.1833 < 9.3383] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)V359.CB) [> 3.7497 = 6.2495 < 8.1243] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)S358.CB) [> 4.4324 = 7.3873 < 9.6035] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)C357.CB) [> 2.9286 = 4.8809 < 6.3452] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)I356.CB) [> 4.2371 = 7.0619 < 9.1804] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)L269.CB) [> 4.2428 = 7.0714 < 9.1928] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)V267.CB) [> 4.0259 = 6.7099 < 8.7228] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)I266.CB) [> 4.4366 = 7.3943 < 9.6125] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)I385.CB) [> 4.0762 = 6.7937 < 8.8317] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)D381.CB) [> 4.1802 = 6.9669 < 9.0570] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)M378.CB) [> 4.2780 = 7.1300 < 9.2690] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)V359.CB) [> 4.6030 = 7.6717 < 9.9732] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)S358.CB) [> 3.3310 = 5.5518 < 7.2173] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)C357.CB) [> 4.4121 = 7.3535 < 9.5596] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)I356.CB) [> 3.9614 = 6.6024 < 8.5831] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)A303.CB) [> 3.9904 = 6.6507 < 8.6459] w=0.0662 to align # Constraint # added constraint: constraint((T0296)P216.CB, (T0296)A303.CB) [> 3.6308 = 6.0513 < 7.8667] w=0.0662 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)A303.CB) [> 3.9655 = 6.6092 < 8.5919] w=0.0662 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)L285.CB) [> 4.4908 = 7.4847 < 9.7301] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)A355.CB) [> 3.9115 = 6.5191 < 8.4749] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)N306.CB) [> 3.4232 = 5.7054 < 7.4170] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)A303.CB) [> 2.3308 = 3.8847 < 5.0500] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)L302.CB) [> 2.1700 = 3.6167 < 4.7017] w=0.0662 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)N306.CB) [> 4.1275 = 6.8792 < 8.9430] w=0.0662 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)A303.CB) [> 4.7026 = 7.8376 < 10.1889] w=0.0662 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)L302.CB) [> 4.3173 = 7.1956 < 9.3543] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)C357.CB) [> 4.3759 = 7.2932 < 9.4811] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)I356.CB) [> 4.6845 = 7.8074 < 10.1497] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)A326.CB) [> 3.6404 = 6.0672 < 7.8874] w=0.0662 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)A355.CB) [> 3.3413 = 5.5688 < 7.2395] w=0.0662 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)G297.CA) [> 3.6604 = 6.1007 < 7.9309] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)G297.CA) [> 3.5224 = 5.8707 < 7.6319] w=0.0662 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)T298.CB) [> 2.3099 = 3.8498 < 5.0048] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)A301.CB) [> 4.5328 = 7.5547 < 9.8211] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)L304.CB) [> 4.1194 = 6.8656 < 8.9253] w=0.0662 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)A301.CB) [> 3.0403 = 5.0672 < 6.5873] w=0.0662 to align # Constraint # added constraint: constraint((T0296)Q250.CB, (T0296)L304.CB) [> 3.5778 = 5.9630 < 7.7519] w=0.0662 to align # Constraint # added constraint: constraint((T0296)G249.CA, (T0296)L304.CB) [> 4.4110 = 7.3517 < 9.5572] w=0.0662 to align # Constraint # added constraint: constraint((T0296)G249.CA, (T0296)A300.CB) [> 4.6232 = 7.7053 < 10.0169] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)L269.CB) [> 3.3658 = 5.6097 < 7.2927] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V267.CB) [> 4.4363 = 7.3939 < 9.6121] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V359.CB, (T0296)I375.CB) [> 2.9101 = 4.8502 < 6.3052] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V359.CB, (T0296)A372.CB) [> 3.5050 = 5.8417 < 7.5943] w=0.0662 to align # Constraint # added constraint: constraint((T0296)C357.CB, (T0296)I379.CB) [> 3.7628 = 6.2714 < 8.1528] w=0.0662 to align # Constraint # added constraint: constraint((T0296)C357.CB, (T0296)M378.CB) [> 4.0931 = 6.8218 < 8.8683] w=0.0662 to align # Constraint # added constraint: constraint((T0296)C357.CB, (T0296)I375.CB) [> 3.1272 = 5.2119 < 6.7755] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L350.CB, (T0296)E382.CB) [> 4.0565 = 6.7608 < 8.7891] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L347.CB, (T0296)E382.CB) [> 2.6183 = 4.3638 < 5.6729] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L347.CB, (T0296)D381.CB) [> 3.8894 = 6.4823 < 8.4270] w=0.0662 to align # Constraint # added constraint: constraint((T0296)S331.CB, (T0296)V340.CB) [> 4.4500 = 7.4167 < 9.6417] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)L350.CB) [> 4.2315 = 7.0526 < 9.1683] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)K349.CB) [> 3.1415 = 5.2358 < 6.8065] w=0.0662 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)N346.CB) [> 2.4938 = 4.1564 < 5.4033] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)M353.CB) [> 3.5840 = 5.9734 < 7.7654] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)L350.CB) [> 2.7271 = 4.5451 < 5.9086] w=0.0662 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)K349.CB) [> 4.2246 = 7.0410 < 9.1533] w=0.0662 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)A86.CB) [> 3.4913 = 5.8188 < 7.5644] w=0.0661 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)S145.CB) [> 3.8185 = 6.3642 < 8.2734] w=0.0661 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)S145.CB) [> 3.5499 = 5.9165 < 7.6915] w=0.0661 to align # Constraint # added constraint: constraint((T0296)L304.CB, (T0296)G322.CA) [> 4.1722 = 6.9536 < 9.0397] w=0.0660 to align # Constraint # added constraint: constraint((T0296)T246.CB, (T0296)L304.CB) [> 3.3439 = 5.5732 < 7.2452] w=0.0660 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)I328.CB) [> 3.6732 = 6.1220 < 7.9586] w=0.0660 to align # Constraint # added constraint: constraint((T0296)I245.CB, (T0296)G297.CA) [> 4.2291 = 7.0485 < 9.1630] w=0.0660 to align # Constraint # added constraint: constraint((T0296)G313.CA, (T0296)S324.CB) [> 3.9269 = 6.5448 < 8.5083] w=0.0660 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)M336.CB) [> 3.1270 = 5.2118 < 6.7753] w=0.0659 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)S331.CB) [> 2.5907 = 4.3179 < 5.6132] w=0.0659 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)E332.CB) [> 3.4801 = 5.8002 < 7.5403] w=0.0659 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)S331.CB) [> 3.9373 = 6.5622 < 8.5309] w=0.0659 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)G335.CA) [> 3.3663 = 5.6105 < 7.2937] w=0.0659 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)V330.CB) [> 4.1217 = 6.8696 < 8.9305] w=0.0659 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)S331.CB) [> 2.7042 = 4.5070 < 5.8591] w=0.0659 to align # Constraint # added constraint: constraint((T0296)L304.CB, (T0296)I337.CB) [> 3.9684 = 6.6140 < 8.5982] w=0.0659 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)E334.CB) [> 4.7209 = 7.8682 < 10.2286] w=0.0659 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)D333.CB) [> 2.6457 = 4.4094 < 5.7323] w=0.0659 to align # Constraint # added constraint: constraint((T0296)A301.CB, (T0296)I337.CB) [> 3.3128 = 5.5213 < 7.1778] w=0.0659 to align # Constraint # added constraint: constraint((T0296)A301.CB, (T0296)E334.CB) [> 1.9729 = 3.2882 < 4.2747] w=0.0659 to align # Constraint # added constraint: constraint((T0296)A301.CB, (T0296)D333.CB) [> 3.4770 = 5.7951 < 7.5336] w=0.0659 to align # Constraint # added constraint: constraint((T0296)V293.CB, (T0296)P329.CB) [> 4.5662 = 7.6103 < 9.8934] w=0.0659 to align # Constraint # added constraint: constraint((T0296)G294.CA, (T0296)P329.CB) [> 3.0306 = 5.0510 < 6.5663] w=0.0659 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)A326.CB) [> 4.5325 = 7.5541 < 9.8203] w=0.0658 to align # Constraint # added constraint: constraint((T0296)I379.CB, (T0296)V395.CB) [> 4.0142 = 6.6903 < 8.6974] w=0.0658 to align # Constraint # added constraint: constraint((T0296)I375.CB, (T0296)I397.CB) [> 4.1808 = 6.9680 < 9.0584] w=0.0658 to align # Constraint # added constraint: constraint((T0296)V314.CB, (T0296)G325.CA) [> 3.2071 = 5.3452 < 6.9487] w=0.0658 to align # Constraint # added constraint: constraint((T0296)V314.CB, (T0296)A326.CB) [> 3.2252 = 5.3753 < 6.9879] w=0.0658 to align # Constraint # added constraint: constraint((T0296)P329.CB, (T0296)V340.CB) [> 3.9724 = 6.6207 < 8.6069] w=0.0658 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)I248.CB) [> 4.4461 = 7.4103 < 9.6333] w=0.0657 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)T393.CB) [> 3.9885 = 6.6474 < 8.6416] w=0.0656 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)A301.CB) [> 3.2281 = 5.3802 < 6.9943] w=0.0656 to align # Constraint # added constraint: constraint((T0296)E332.CB, (T0296)I364.CB) [> 2.1754 = 3.6256 < 4.7133] w=0.0656 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)I379.CB) [> 3.4724 = 5.7873 < 7.5235] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)P399.CB) [> 4.2312 = 7.0520 < 9.1676] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)T393.CB) [> 3.6576 = 6.0960 < 7.9248] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I208.CB, (T0296)T393.CB) [> 3.9595 = 6.5992 < 8.5790] w=0.0656 to align # Constraint # added constraint: constraint((T0296)V108.CB, (T0296)I388.CB) [> 4.1731 = 6.9552 < 9.0418] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)I388.CB) [> 4.4490 = 7.4150 < 9.6395] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)P399.CB) [> 3.1433 = 5.2388 < 6.8104] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)T393.CB) [> 4.5715 = 7.6192 < 9.9049] w=0.0656 to align # Constraint # added constraint: constraint((T0296)N54.CB, (T0296)P399.CB) [> 4.3578 = 7.2629 < 9.4418] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A52.CB, (T0296)P399.CB) [> 2.5966 = 4.3276 < 5.6259] w=0.0656 to align # Constraint # added constraint: constraint((T0296)K51.CB, (T0296)P399.CB) [> 2.0868 = 3.4781 < 4.5215] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I48.CB, (T0296)P399.CB) [> 3.5755 = 5.9592 < 7.7469] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A40.CB, (T0296)A198.CB) [> 3.1088 = 5.1814 < 6.7358] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A40.CB, (T0296)G197.CA) [> 3.8974 = 6.4957 < 8.4444] w=0.0656 to align # Constraint # added constraint: constraint((T0296)D362.CB, (T0296)F409.CB) [> 3.2038 = 5.3397 < 6.9417] w=0.0656 to align # Constraint # added constraint: constraint((T0296)D362.CB, (T0296)E408.CB) [> 4.7362 = 7.8936 < 10.2617] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L361.CB, (T0296)G410.CA) [> 2.6855 = 4.4758 < 5.8186] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L361.CB, (T0296)F409.CB) [> 3.9912 = 6.6520 < 8.6476] w=0.0656 to align # Constraint # added constraint: constraint((T0296)N346.CB, (T0296)G410.CA) [> 3.9212 = 6.5354 < 8.4960] w=0.0656 to align # Constraint # added constraint: constraint((T0296)N346.CB, (T0296)L361.CB) [> 2.8040 = 4.6733 < 6.0753] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L345.CB, (T0296)G410.CA) [> 4.7474 = 7.9123 < 10.2860] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L345.CB, (T0296)D362.CB) [> 3.5935 = 5.9892 < 7.7859] w=0.0656 to align # Constraint # added constraint: constraint((T0296)V340.CB, (T0296)D362.CB) [> 3.8257 = 6.3762 < 8.2890] w=0.0656 to align # Constraint # added constraint: constraint((T0296)M336.CB, (T0296)I364.CB) [> 4.5723 = 7.6206 < 9.9067] w=0.0656 to align # Constraint # added constraint: constraint((T0296)D333.CB, (T0296)P367.CB) [> 4.2859 = 7.1432 < 9.2862] w=0.0656 to align # Constraint # added constraint: constraint((T0296)K310.CB, (T0296)S344.CB) [> 4.5384 = 7.5641 < 9.8333] w=0.0656 to align # Constraint # added constraint: constraint((T0296)T374.CB, (T0296)D405.CB) [> 4.3315 = 7.2192 < 9.3849] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)I407.CB) [> 4.0199 = 6.6999 < 8.7099] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)M406.CB) [> 4.5840 = 7.6400 < 9.9319] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)D405.CB) [> 3.4899 = 5.8165 < 7.5615] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)G404.CA) [> 4.0845 = 6.8075 < 8.8497] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A365.CB, (T0296)I407.CB) [> 4.7902 = 7.9836 < 10.3787] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A365.CB, (T0296)D405.CB) [> 4.4139 = 7.3565 < 9.5635] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I364.CB, (T0296)F409.CB) [> 2.8081 = 4.6802 < 6.0842] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I364.CB, (T0296)E408.CB) [> 4.4440 = 7.4066 < 9.6286] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I364.CB, (T0296)I407.CB) [> 2.9698 = 4.9497 < 6.4346] w=0.0656 to align # Constraint # added constraint: constraint((T0296)I364.CB, (T0296)M406.CB) [> 4.0417 = 6.7362 < 8.7570] w=0.0656 to align # Constraint # added constraint: constraint((T0296)M363.CB, (T0296)F409.CB) [> 4.5802 = 7.6337 < 9.9238] w=0.0656 to align # Constraint # added constraint: constraint((T0296)M363.CB, (T0296)I407.CB) [> 4.6940 = 7.8234 < 10.1704] w=0.0656 to align # Constraint # added constraint: constraint((T0296)D362.CB, (T0296)G410.CA) [> 4.1729 = 6.9549 < 9.0414] w=0.0656 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)M363.CB) [> 4.5958 = 7.6597 < 9.9577] w=0.0656 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)I248.CB) [> 3.4418 = 5.7363 < 7.4572] w=0.0656 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)I248.CB) [> 3.2843 = 5.4738 < 7.1160] w=0.0656 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)D405.CB) [> 4.4098 = 7.3497 < 9.5546] w=0.0656 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)A365.CB) [> 2.3801 = 3.9668 < 5.1569] w=0.0656 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)S344.CB) [> 2.8437 = 4.7394 < 6.1613] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)L345.CB) [> 4.6922 = 7.8204 < 10.1665] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)D362.CB) [> 4.6741 = 7.7901 < 10.1272] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)L345.CB) [> 4.0729 = 6.7882 < 8.8247] w=0.0656 to align # Constraint # added constraint: constraint((T0296)L285.CB, (T0296)Q308.CB) [> 2.1853 = 3.6423 < 4.7349] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A282.CB, (T0296)Q308.CB) [> 2.9856 = 4.9760 < 6.4688] w=0.0656 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)I245.CB) [> 4.3219 = 7.2032 < 9.3642] w=0.0656 to align # Constraint # added constraint: constraint((T0296)E382.CB, (T0296)P399.CB) [> 4.1301 = 6.8835 < 8.9486] w=0.0655 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)L302.CB) [> 4.7648 = 7.9413 < 10.3237] w=0.0655 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)L304.CB) [> 3.3863 = 5.6439 < 7.3370] w=0.0655 to align # Constraint # added constraint: constraint((T0296)T274.CB, (T0296)L304.CB) [> 3.0548 = 5.0914 < 6.6188] w=0.0654 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)F409.CB) [> 2.9982 = 4.9970 < 6.4960] w=0.0653 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)G212.CA) [> 3.1964 = 5.3273 < 6.9255] w=0.0653 to align # Constraint # added constraint: constraint((T0296)S151.CB, (T0296)A377.CB) [> 4.6391 = 7.7319 < 10.0514] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)F409.CB) [> 4.4066 = 7.3444 < 9.5477] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)I407.CB) [> 2.8261 = 4.7101 < 6.1232] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)V387.CB) [> 4.2974 = 7.1623 < 9.3110] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)I379.CB) [> 4.3158 = 7.1930 < 9.3509] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)M378.CB) [> 3.5645 = 5.9409 < 7.7231] w=0.0653 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)F409.CB) [> 3.7745 = 6.2909 < 8.1781] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)A256.CB) [> 4.2540 = 7.0900 < 9.2170] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I68.CB, (T0296)A256.CB) [> 3.5233 = 5.8721 < 7.6337] w=0.0653 to align # Constraint # added constraint: constraint((T0296)L66.CB, (T0296)L305.CB) [> 3.8578 = 6.4297 < 8.3586] w=0.0653 to align # Constraint # added constraint: constraint((T0296)L66.CB, (T0296)L304.CB) [> 2.8813 = 4.8022 < 6.2428] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)S425.CB) [> 3.1865 = 5.3109 < 6.9042] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)A424.CB) [> 4.1566 = 6.9276 < 9.0059] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)G423.CA) [> 2.9643 = 4.9405 < 6.4227] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)N422.CB) [> 4.1880 = 6.9799 < 9.0739] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I366.CB, (T0296)V421.CB) [> 2.5416 = 4.2359 < 5.5067] w=0.0653 to align # Constraint # added constraint: constraint((T0296)G411.CA, (T0296)V421.CB) [> 4.5279 = 7.5466 < 9.8106] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V387.CB, (T0296)I407.CB) [> 4.7657 = 7.9428 < 10.3257] w=0.0653 to align # Constraint # added constraint: constraint((T0296)G386.CA, (T0296)K400.CB) [> 4.7246 = 7.8744 < 10.2367] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I385.CB, (T0296)I407.CB) [> 4.1798 = 6.9663 < 9.0562] w=0.0653 to align # Constraint # added constraint: constraint((T0296)A383.CB, (T0296)G401.CA) [> 4.0906 = 6.8176 < 8.8629] w=0.0653 to align # Constraint # added constraint: constraint((T0296)A383.CB, (T0296)K400.CB) [> 4.3998 = 7.3331 < 9.5330] w=0.0653 to align # Constraint # added constraint: constraint((T0296)D381.CB, (T0296)I407.CB) [> 3.7704 = 6.2840 < 8.1692] w=0.0653 to align # Constraint # added constraint: constraint((T0296)D369.CB, (T0296)N422.CB) [> 3.2340 = 5.3900 < 7.0070] w=0.0653 to align # Constraint # added constraint: constraint((T0296)D369.CB, (T0296)V421.CB) [> 4.0219 = 6.7032 < 8.7142] w=0.0653 to align # Constraint # added constraint: constraint((T0296)E368.CB, (T0296)G423.CA) [> 3.2740 = 5.4567 < 7.0938] w=0.0653 to align # Constraint # added constraint: constraint((T0296)P367.CB, (T0296)G423.CA) [> 4.0512 = 6.7520 < 8.7776] w=0.0653 to align # Constraint # added constraint: constraint((T0296)L223.CB, (T0296)L347.CB) [> 4.2182 = 7.0304 < 9.1395] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)L350.CB) [> 3.7824 = 6.3041 < 8.1953] w=0.0653 to align # Constraint # added constraint: constraint((T0296)P216.CB, (T0296)E351.CB) [> 2.5670 = 4.2783 < 5.5618] w=0.0653 to align # Constraint # added constraint: constraint((T0296)V233.CB, (T0296)L412.CB) [> 4.7030 = 7.8383 < 10.1898] w=0.0653 to align # Constraint # added constraint: constraint((T0296)I3.CB, (T0296)V58.CB) [> 4.2456 = 7.0760 < 9.1988] w=0.0537 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)I70.CB) [> 4.1381 = 6.8969 < 8.9660] w=0.0519 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)A198.CB) [> 4.5106 = 7.5177 < 9.7730] w=0.0516 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)I266.CB) [> 3.9336 = 6.5560 < 8.5228] w=0.0492 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)G265.CA) [> 3.1049 = 5.1748 < 6.7273] w=0.0492 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)V213.CB) [> 3.8405 = 6.4009 < 8.3211] w=0.0492 to align # Constraint # added constraint: constraint((T0296)I328.CB, (T0296)S358.CB) [> 4.0670 = 6.7784 < 8.8119] w=0.0488 to align # Constraint # added constraint: constraint((T0296)M195.CB, (T0296)I208.CB) [> 3.3066 = 5.5110 < 7.1642] w=0.0476 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)A301.CB) [> 4.2129 = 7.0215 < 9.1279] w=0.0471 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)L304.CB) [> 4.1309 = 6.8848 < 8.9502] w=0.0471 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)L305.CB) [> 3.1700 = 5.2832 < 6.8682] w=0.0471 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)L182.CB) [> 4.5384 = 7.5640 < 9.8332] w=0.0470 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)L269.CB) [> 3.1655 = 5.2758 < 6.8585] w=0.0470 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)L305.CB) [> 2.5269 = 4.2115 < 5.4749] w=0.0468 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)A198.CB) [> 4.0523 = 6.7538 < 8.7799] w=0.0467 to align # Constraint # added constraint: constraint((T0296)M177.CB, (T0296)G201.CA) [> 2.7407 = 4.5679 < 5.9383] w=0.0467 to align # Constraint # added constraint: constraint((T0296)F194.CB, (T0296)V211.CB) [> 4.7098 = 7.8498 < 10.2047] w=0.0467 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)I209.CB) [> 4.5337 = 7.5562 < 9.8230] w=0.0467 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)F264.CB) [> 4.5918 = 7.6530 < 9.9489] w=0.0467 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)A256.CB) [> 4.1059 = 6.8431 < 8.8960] w=0.0467 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)A256.CB) [> 3.0302 = 5.0503 < 6.5654] w=0.0467 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)H296.CB) [> 2.4455 = 4.0757 < 5.2985] w=0.0466 to align # Constraint # added constraint: constraint((T0296)K310.CB, (T0296)G343.CA) [> 3.9286 = 6.5477 < 8.5120] w=0.0466 to align # Constraint # added constraint: constraint((T0296)I3.CB, (T0296)I62.CB) [> 3.4102 = 5.6837 < 7.3888] w=0.0466 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)G313.CA) [> 2.4880 = 4.1466 < 5.3906] w=0.0465 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)G312.CA) [> 4.4850 = 7.4750 < 9.7175] w=0.0465 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)L305.CB) [> 4.6200 = 7.6999 < 10.0099] w=0.0465 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)I68.CB) [> 2.9563 = 4.9271 < 6.4053] w=0.0462 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)L66.CB) [> 4.4901 = 7.4835 < 9.7286] w=0.0462 to align # Constraint # added constraint: constraint((T0296)Q5.CB, (T0296)T24.CB) [> 4.7487 = 7.9145 < 10.2889] w=0.0462 to align # Constraint # added constraint: constraint((T0296)I156.CB, (T0296)V267.CB) [> 4.5936 = 7.6560 < 9.9528] w=0.0462 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)V267.CB) [> 4.0471 = 6.7451 < 8.7686] w=0.0462 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)L271.CB) [> 3.2297 = 5.3828 < 6.9977] w=0.0461 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)N210.CB) [> 4.0604 = 6.7673 < 8.7975] w=0.0456 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)I208.CB) [> 4.3741 = 7.2901 < 9.4771] w=0.0456 to align # Constraint # added constraint: constraint((T0296)F194.CB, (T0296)T241.CB) [> 3.9152 = 6.5254 < 8.4830] w=0.0455 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)A205.CB) [> 2.7141 = 4.5236 < 5.8807] w=0.0455 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)A205.CB) [> 3.8924 = 6.4874 < 8.4336] w=0.0455 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)I209.CB) [> 4.2129 = 7.0215 < 9.1279] w=0.0455 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)N210.CB) [> 2.7415 = 4.5693 < 5.9400] w=0.0455 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)V267.CB) [> 4.2551 = 7.0918 < 9.2194] w=0.0455 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)E204.CB) [> 2.9585 = 4.9308 < 6.4100] w=0.0455 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)I208.CB) [> 4.4186 = 7.3643 < 9.5735] w=0.0455 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)N210.CB) [> 3.7002 = 6.1671 < 8.0172] w=0.0455 to align # Constraint # added constraint: constraint((T0296)N72.CB, (T0296)I208.CB) [> 4.4528 = 7.4213 < 9.6477] w=0.0455 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)S146.CB) [> 3.8025 = 6.3376 < 8.2388] w=0.0455 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)E204.CB) [> 4.1742 = 6.9570 < 9.0441] w=0.0455 to align # Constraint # added constraint: constraint((T0296)P79.CB, (T0296)S146.CB) [> 4.1562 = 6.9270 < 9.0050] w=0.0455 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)F264.CB) [> 4.5122 = 7.5204 < 9.7765] w=0.0455 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)N318.CB) [> 4.7070 = 7.8450 < 10.1985] w=0.0455 to align # Constraint # added constraint: constraint((T0296)P275.CB, (T0296)V293.CB) [> 3.3021 = 5.5036 < 7.1546] w=0.0455 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V211.CB) [> 4.2801 = 7.1335 < 9.2735] w=0.0455 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)I209.CB) [> 4.7182 = 7.8637 < 10.2228] w=0.0455 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)A180.CB) [> 3.9352 = 6.5587 < 8.5264] w=0.0454 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)A186.CB) [> 3.4630 = 5.7716 < 7.5031] w=0.0454 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)V219.CB) [> 4.0821 = 6.8034 < 8.8445] w=0.0454 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)V207.CB) [> 3.6916 = 6.1527 < 7.9985] w=0.0454 to align # Constraint # added constraint: constraint((T0296)F243.CB, (T0296)A256.CB) [> 4.3464 = 7.2441 < 9.4173] w=0.0453 to align # Constraint # added constraint: constraint((T0296)E8.CB, (T0296)A186.CB) [> 3.1817 = 5.3028 < 6.8937] w=0.0453 to align # Constraint # added constraint: constraint((T0296)M12.CB, (T0296)V184.CB) [> 3.7846 = 6.3076 < 8.1999] w=0.0453 to align # Constraint # added constraint: constraint((T0296)M12.CB, (T0296)A186.CB) [> 3.2568 = 5.4280 < 7.0564] w=0.0453 to align # Constraint # added constraint: constraint((T0296)Q5.CB, (T0296)C144.CB) [> 2.0893 = 3.4822 < 4.5268] w=0.0453 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)A186.CB) [> 3.9299 = 6.5499 < 8.5149] w=0.0453 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)N187.CB) [> 2.7592 = 4.5988 < 5.9784] w=0.0453 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)A188.CB) [> 3.2651 = 5.4418 < 7.0743] w=0.0453 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)A188.CB) [> 2.5870 = 4.3116 < 5.6051] w=0.0453 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)L117.CB) [> 3.3384 = 5.5640 < 7.2332] w=0.0453 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)L117.CB) [> 4.0359 = 6.7264 < 8.7444] w=0.0453 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)E190.CB) [> 4.1646 = 6.9409 < 9.0232] w=0.0453 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)V207.CB) [> 2.6779 = 4.4632 < 5.8022] w=0.0453 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)V330.CB) [> 3.8482 = 6.4137 < 8.3378] w=0.0449 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)A272.CB) [> 4.4450 = 7.4084 < 9.6309] w=0.0449 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)L271.CB) [> 3.8043 = 6.3404 < 8.2426] w=0.0449 to align # Constraint # added constraint: constraint((T0296)L66.CB, (T0296)Q341.CB) [> 3.2399 = 5.3999 < 7.0198] w=0.0449 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)I266.CB) [> 3.5502 = 5.9170 < 7.6921] w=0.0449 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)L269.CB) [> 4.3557 = 7.2596 < 9.4374] w=0.0449 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)D268.CB) [> 4.7869 = 7.9781 < 10.3716] w=0.0449 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)L269.CB) [> 2.8591 = 4.7651 < 6.1946] w=0.0449 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)S270.CB) [> 4.7135 = 7.8558 < 10.2126] w=0.0449 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)L271.CB) [> 4.1178 = 6.8630 < 8.9219] w=0.0449 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)L269.CB) [> 4.4914 = 7.4856 < 9.7313] w=0.0449 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)L271.CB) [> 4.4600 = 7.4333 < 9.6633] w=0.0449 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)S270.CB) [> 3.4323 = 5.7204 < 7.4366] w=0.0449 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)L271.CB) [> 3.7736 = 6.2893 < 8.1761] w=0.0449 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)A272.CB) [> 3.5897 = 5.9829 < 7.7778] w=0.0449 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)F327.CB) [> 4.5642 = 7.6069 < 9.8890] w=0.0449 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)V161.CB) [> 4.2689 = 7.1149 < 9.2493] w=0.0449 to align # Constraint # added constraint: constraint((T0296)A256.CB, (T0296)V267.CB) [> 3.9528 = 6.5880 < 8.5644] w=0.0449 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)S324.CB) [> 3.3868 = 5.6446 < 7.3380] w=0.0449 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)D268.CB) [> 4.4403 = 7.4004 < 9.6206] w=0.0448 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)A180.CB) [> 4.1660 = 6.9434 < 9.0264] w=0.0448 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)N318.CB) [> 3.8403 = 6.4006 < 8.3208] w=0.0448 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)Q319.CB) [> 3.2562 = 5.4269 < 7.0550] w=0.0448 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)Q319.CB) [> 4.6298 = 7.7163 < 10.0311] w=0.0448 to align # Constraint # added constraint: constraint((T0296)V320.CB, (T0296)V330.CB) [> 3.7899 = 6.3166 < 8.2116] w=0.0448 to align # Constraint # added constraint: constraint((T0296)T295.CB, (T0296)E332.CB) [> 4.6950 = 7.8250 < 10.1725] w=0.0448 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)L302.CB) [> 4.5284 = 7.5473 < 9.8115] w=0.0448 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)F110.CB) [> 4.0261 = 6.7102 < 8.7233] w=0.0446 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)A326.CB) [> 3.4480 = 5.7466 < 7.4706] w=0.0446 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)M363.CB) [> 3.5411 = 5.9019 < 7.6724] w=0.0445 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)I366.CB) [> 4.3365 = 7.2274 < 9.3956] w=0.0445 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)A365.CB) [> 4.5124 = 7.5206 < 9.7767] w=0.0445 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)A365.CB) [> 3.1209 = 5.2015 < 6.7620] w=0.0445 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)I364.CB) [> 4.0025 = 6.6708 < 8.6720] w=0.0445 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)M363.CB) [> 3.0379 = 5.0631 < 6.5820] w=0.0445 to align # Constraint # added constraint: constraint((T0296)R21.CB, (T0296)I364.CB) [> 3.5161 = 5.8601 < 7.6181] w=0.0445 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)V359.CB) [> 4.0403 = 6.7339 < 8.7541] w=0.0445 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)N318.CB) [> 3.0960 = 5.1599 < 6.7079] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)V359.CB) [> 2.9232 = 4.8719 < 6.3335] w=0.0445 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)L361.CB) [> 4.2025 = 7.0042 < 9.1055] w=0.0445 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)V359.CB) [> 2.3478 = 3.9130 < 5.0870] w=0.0445 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)M353.CB) [> 3.8117 = 6.3528 < 8.2587] w=0.0445 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)G325.CA) [> 4.2667 = 7.1111 < 9.2445] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A300.CB, (T0296)A352.CB) [> 4.7970 = 7.9950 < 10.3936] w=0.0445 to align # Constraint # added constraint: constraint((T0296)T295.CB, (T0296)K349.CB) [> 3.1647 = 5.2744 < 6.8568] w=0.0445 to align # Constraint # added constraint: constraint((T0296)L350.CB, (T0296)L361.CB) [> 4.7341 = 7.8902 < 10.2572] w=0.0445 to align # Constraint # added constraint: constraint((T0296)G343.CA, (T0296)T374.CB) [> 3.7176 = 6.1960 < 8.0548] w=0.0445 to align # Constraint # added constraint: constraint((T0296)G343.CA, (T0296)E373.CB) [> 4.2769 = 7.1282 < 9.2666] w=0.0445 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)A365.CB) [> 3.9756 = 6.6259 < 8.6137] w=0.0445 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)M363.CB) [> 4.2185 = 7.0308 < 9.1401] w=0.0445 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)M353.CB) [> 3.4175 = 5.6959 < 7.4046] w=0.0445 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)L350.CB) [> 4.5499 = 7.5831 < 9.8580] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)A365.CB) [> 4.2771 = 7.1284 < 9.2669] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)M363.CB) [> 3.0418 = 5.0696 < 6.5905] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)D362.CB) [> 4.3488 = 7.2480 < 9.4223] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)L361.CB) [> 4.2400 = 7.0666 < 9.1866] w=0.0445 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)L361.CB) [> 3.1766 = 5.2944 < 6.8827] w=0.0445 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)L305.CB) [> 4.1847 = 6.9744 < 9.0668] w=0.0445 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)L304.CB) [> 4.5040 = 7.5066 < 9.7586] w=0.0445 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)L305.CB) [> 4.4945 = 7.4908 < 9.7381] w=0.0445 to align # Constraint # added constraint: constraint((T0296)S214.CB, (T0296)A301.CB) [> 3.8647 = 6.4412 < 8.3735] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)A301.CB) [> 3.0301 = 5.0501 < 6.5651] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)A272.CB) [> 3.8567 = 6.4278 < 8.3561] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)L271.CB) [> 3.4739 = 5.7898 < 7.5268] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)S270.CB) [> 3.5103 = 5.8505 < 7.6056] w=0.0445 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)S270.CB) [> 4.6093 = 7.6822 < 9.9868] w=0.0445 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)E204.CB) [> 2.8058 = 4.6763 < 6.0792] w=0.0445 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)S270.CB) [> 4.0871 = 6.8119 < 8.8555] w=0.0445 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)M363.CB) [> 4.2133 = 7.0222 < 9.1289] w=0.0445 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)D362.CB) [> 4.1936 = 6.9893 < 9.0861] w=0.0445 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)V267.CB) [> 3.9072 = 6.5120 < 8.4656] w=0.0445 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)L269.CB) [> 3.9615 = 6.6025 < 8.5832] w=0.0445 to align # Constraint # added constraint: constraint((T0296)P193.CB, (T0296)I248.CB) [> 3.7195 = 6.1992 < 8.0590] w=0.0444 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)V118.CB) [> 4.2708 = 7.1180 < 9.2534] w=0.0443 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)V219.CB) [> 3.3659 = 5.6098 < 7.2927] w=0.0443 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)V219.CB) [> 4.2078 = 7.0130 < 9.1170] w=0.0443 to align # Constraint # added constraint: constraint((T0296)M25.CB, (T0296)L117.CB) [> 3.1841 = 5.3069 < 6.8990] w=0.0443 to align # Constraint # added constraint: constraint((T0296)V118.CB, (T0296)A198.CB) [> 2.5266 = 4.2110 < 5.4743] w=0.0443 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)V219.CB) [> 3.9148 = 6.5247 < 8.4821] w=0.0443 to align # Constraint # added constraint: constraint((T0296)V118.CB, (T0296)A188.CB) [> 4.6768 = 7.7948 < 10.1332] w=0.0443 to align # Constraint # added constraint: constraint((T0296)V118.CB, (T0296)V184.CB) [> 4.1500 = 6.9166 < 8.9916] w=0.0443 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)E204.CB) [> 4.7757 = 7.9595 < 10.3473] w=0.0443 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)K181.CB) [> 4.2210 = 7.0350 < 9.1455] w=0.0443 to align # Constraint # added constraint: constraint((T0296)G322.CA, (T0296)E332.CB) [> 3.7608 = 6.2680 < 8.1483] w=0.0443 to align # Constraint # added constraint: constraint((T0296)I245.CB, (T0296)I266.CB) [> 4.6075 = 7.6792 < 9.9829] w=0.0442 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)V143.CB) [> 4.0003 = 6.6672 < 8.6673] w=0.0442 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)V143.CB) [> 4.1518 = 6.9197 < 8.9957] w=0.0442 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)S146.CB) [> 3.8916 = 6.4859 < 8.4317] w=0.0442 to align # Constraint # added constraint: constraint((T0296)A196.CB, (T0296)I248.CB) [> 4.1971 = 6.9951 < 9.0936] w=0.0441 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)I208.CB) [> 4.7489 = 7.9148 < 10.2892] w=0.0441 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)S270.CB) [> 4.6424 = 7.7373 < 10.0585] w=0.0441 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)E286.CB) [> 2.6324 = 4.3873 < 5.7035] w=0.0441 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)M363.CB) [> 4.7087 = 7.8479 < 10.2022] w=0.0441 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)A365.CB) [> 3.3679 = 5.6132 < 7.2972] w=0.0441 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)A326.CB) [> 4.7328 = 7.8880 < 10.2544] w=0.0441 to align # Constraint # added constraint: constraint((T0296)P216.CB, (T0296)P329.CB) [> 3.8607 = 6.4346 < 8.3650] w=0.0441 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)S214.CB) [> 3.0825 = 5.1375 < 6.6787] w=0.0441 to align # Constraint # added constraint: constraint((T0296)G217.CA, (T0296)P329.CB) [> 3.6253 = 6.0421 < 7.8548] w=0.0441 to align # Constraint # added constraint: constraint((T0296)G217.CA, (T0296)S331.CB) [> 4.2702 = 7.1170 < 9.2521] w=0.0441 to align # Constraint # added constraint: constraint((T0296)V218.CB, (T0296)P329.CB) [> 3.8494 = 6.4157 < 8.3404] w=0.0441 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)S331.CB) [> 3.5289 = 5.8815 < 7.6459] w=0.0441 to align # Constraint # added constraint: constraint((T0296)F264.CB, (T0296)S324.CB) [> 3.6247 = 6.0412 < 7.8535] w=0.0441 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)G325.CA) [> 3.0257 = 5.0428 < 6.5557] w=0.0441 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)A326.CB) [> 4.0239 = 6.7065 < 8.7185] w=0.0441 to align # Constraint # added constraint: constraint((T0296)I266.CB, (T0296)F327.CB) [> 4.4528 = 7.4214 < 9.6478] w=0.0441 to align # Constraint # added constraint: constraint((T0296)A301.CB, (T0296)A326.CB) [> 3.1105 = 5.1841 < 6.7394] w=0.0441 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)G322.CA) [> 4.2459 = 7.0764 < 9.1994] w=0.0441 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)G343.CA) [> 4.3946 = 7.3244 < 9.5217] w=0.0441 to align # Constraint # added constraint: constraint((T0296)G322.CA, (T0296)E351.CB) [> 4.2396 = 7.0659 < 9.1857] w=0.0441 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)M353.CB) [> 4.6444 = 7.7406 < 10.0628] w=0.0441 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)I356.CB) [> 4.3960 = 7.3267 < 9.5247] w=0.0441 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)I356.CB) [> 3.3153 = 5.5255 < 7.1832] w=0.0441 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)S358.CB) [> 3.8428 = 6.4046 < 8.3260] w=0.0441 to align # Constraint # added constraint: constraint((T0296)F243.CB, (T0296)A303.CB) [> 4.3783 = 7.2971 < 9.4862] w=0.0441 to align # Constraint # added constraint: constraint((T0296)F243.CB, (T0296)M336.CB) [> 4.3800 = 7.3000 < 9.4900] w=0.0441 to align # Constraint # added constraint: constraint((T0296)F243.CB, (T0296)A339.CB) [> 4.5818 = 7.6364 < 9.9273] w=0.0441 to align # Constraint # added constraint: constraint((T0296)I245.CB, (T0296)L271.CB) [> 4.6216 = 7.7026 < 10.0134] w=0.0441 to align # Constraint # added constraint: constraint((T0296)I245.CB, (T0296)A300.CB) [> 3.0895 = 5.1491 < 6.6939] w=0.0441 to align # Constraint # added constraint: constraint((T0296)T246.CB, (T0296)A300.CB) [> 2.9265 = 4.8775 < 6.3408] w=0.0441 to align # Constraint # added constraint: constraint((T0296)T246.CB, (T0296)A303.CB) [> 2.6516 = 4.4194 < 5.7453] w=0.0441 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)A188.CB) [> 4.7859 = 7.9765 < 10.3695] w=0.0439 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)V330.CB) [> 4.6528 = 7.7547 < 10.0811] w=0.0439 to align # Constraint # added constraint: constraint((T0296)C317.CB, (T0296)E332.CB) [> 2.9350 = 4.8917 < 6.3592] w=0.0439 to align # Constraint # added constraint: constraint((T0296)C317.CB, (T0296)S331.CB) [> 3.4614 = 5.7690 < 7.4997] w=0.0439 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)F185.CB) [> 3.5667 = 5.9445 < 7.7278] w=0.0439 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)A186.CB) [> 3.1382 = 5.2304 < 6.7995] w=0.0438 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)A256.CB) [> 4.4677 = 7.4461 < 9.6799] w=0.0438 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)T246.CB) [> 3.5556 = 5.9261 < 7.7039] w=0.0438 to align # Constraint # added constraint: constraint((T0296)P134.CB, (T0296)I245.CB) [> 3.1346 = 5.2243 < 6.7916] w=0.0438 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)L304.CB) [> 4.4303 = 7.3838 < 9.5989] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)A301.CB) [> 3.0786 = 5.1310 < 6.6703] w=0.0438 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A326.CB) [> 4.5601 = 7.6002 < 9.8802] w=0.0438 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)R396.CB) [> 4.3435 = 7.2391 < 9.4108] w=0.0438 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)A326.CB) [> 4.6833 = 7.8055 < 10.1471] w=0.0438 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)R396.CB) [> 2.9654 = 4.9424 < 6.4251] w=0.0438 to align # Constraint # added constraint: constraint((T0296)I20.CB, (T0296)A394.CB) [> 3.8252 = 6.3753 < 8.2878] w=0.0438 to align # Constraint # added constraint: constraint((T0296)G112.CA, (T0296)D268.CB) [> 4.0722 = 6.7870 < 8.8230] w=0.0438 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)R396.CB) [> 4.0773 = 6.7956 < 8.8342] w=0.0438 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)V395.CB) [> 2.8080 = 4.6800 < 6.0840] w=0.0438 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)A394.CB) [> 4.0951 = 6.8253 < 8.8728] w=0.0438 to align # Constraint # added constraint: constraint((T0296)F327.CB, (T0296)T392.CB) [> 3.9776 = 6.6293 < 8.6181] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)R396.CB) [> 4.3195 = 7.1992 < 9.3589] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)V395.CB) [> 4.5039 = 7.5065 < 9.7585] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)A394.CB) [> 2.6163 = 4.3606 < 5.6688] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)T393.CB) [> 3.3260 = 5.5433 < 7.2063] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A326.CB, (T0296)T392.CB) [> 4.2696 = 7.1160 < 9.2508] w=0.0438 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)A394.CB) [> 4.6721 = 7.7868 < 10.1228] w=0.0438 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)T393.CB) [> 3.5205 = 5.8676 < 7.6278] w=0.0438 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)T392.CB) [> 2.9915 = 4.9858 < 6.4815] w=0.0438 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)K391.CB) [> 4.1066 = 6.8443 < 8.8975] w=0.0438 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)T393.CB) [> 3.3215 = 5.5359 < 7.1966] w=0.0438 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)T392.CB) [> 4.6893 = 7.8155 < 10.1601] w=0.0438 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)K391.CB) [> 3.2255 = 5.3758 < 6.9885] w=0.0438 to align # Constraint # added constraint: constraint((T0296)N318.CB, (T0296)M390.CB) [> 4.1248 = 6.8747 < 8.9372] w=0.0438 to align # Constraint # added constraint: constraint((T0296)L304.CB, (T0296)Q319.CB) [> 4.0838 = 6.8064 < 8.8483] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A352.CB, (T0296)A376.CB) [> 3.3623 = 5.6038 < 7.2850] w=0.0438 to align # Constraint # added constraint: constraint((T0296)S331.CB, (T0296)I397.CB) [> 3.5782 = 5.9636 < 7.7527] w=0.0438 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)I397.CB) [> 3.9175 = 6.5292 < 8.4880] w=0.0438 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)R396.CB) [> 4.6918 = 7.8197 < 10.1657] w=0.0438 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)V395.CB) [> 4.1206 = 6.8676 < 8.9279] w=0.0438 to align # Constraint # added constraint: constraint((T0296)P329.CB, (T0296)R396.CB) [> 4.1695 = 6.9492 < 9.0340] w=0.0438 to align # Constraint # added constraint: constraint((T0296)I328.CB, (T0296)R396.CB) [> 3.4336 = 5.7226 < 7.4394] w=0.0438 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)F327.CB) [> 3.2874 = 5.4790 < 7.1227] w=0.0438 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)A326.CB) [> 4.2451 = 7.0752 < 9.1977] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)M390.CB) [> 4.3919 = 7.3199 < 9.5158] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)I388.CB) [> 4.3722 = 7.2869 < 9.4730] w=0.0438 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)I385.CB) [> 4.1664 = 6.9440 < 9.0272] w=0.0438 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)T392.CB) [> 3.8789 = 6.4648 < 8.4043] w=0.0438 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)M390.CB) [> 3.4860 = 5.8100 < 7.5530] w=0.0438 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)I385.CB) [> 2.7745 = 4.6241 < 6.0113] w=0.0438 to align # Constraint # added constraint: constraint((T0296)T295.CB, (T0296)A380.CB) [> 4.1154 = 6.8590 < 8.9167] w=0.0438 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)A383.CB) [> 3.7704 = 6.2841 < 8.1693] w=0.0437 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)A383.CB) [> 4.3095 = 7.1824 < 9.3371] w=0.0437 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)I385.CB) [> 4.7332 = 7.8886 < 10.2552] w=0.0437 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)F185.CB) [> 3.9245 = 6.5409 < 8.5031] w=0.0437 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)V330.CB) [> 3.8903 = 6.4838 < 8.4290] w=0.0437 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)M363.CB) [> 3.4992 = 5.8320 < 7.5816] w=0.0437 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)D362.CB) [> 3.8329 = 6.3882 < 8.3047] w=0.0437 to align # Constraint # added constraint: constraint((T0296)M12.CB, (T0296)S145.CB) [> 4.5567 = 7.5945 < 9.8728] w=0.0436 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)S270.CB) [> 3.4504 = 5.7506 < 7.4758] w=0.0436 to align # Constraint # added constraint: constraint((T0296)G212.CA, (T0296)S270.CB) [> 3.4387 = 5.7312 < 7.4505] w=0.0436 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)A303.CB) [> 4.7714 = 7.9524 < 10.3381] w=0.0436 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)L269.CB) [> 3.1445 = 5.2408 < 6.8131] w=0.0436 to align # Constraint # added constraint: constraint((T0296)A383.CB, (T0296)P399.CB) [> 3.1455 = 5.2425 < 6.8152] w=0.0436 to align # Constraint # added constraint: constraint((T0296)L82.CB, (T0296)G215.CA) [> 3.8553 = 6.4255 < 8.3531] w=0.0435 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)G411.CA) [> 4.5109 = 7.5181 < 9.7736] w=0.0435 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)G410.CA) [> 3.4297 = 5.7161 < 7.4310] w=0.0435 to align # Constraint # added constraint: constraint((T0296)G197.CA, (T0296)L412.CB) [> 4.7025 = 7.8374 < 10.1887] w=0.0435 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)L413.CB) [> 3.8467 = 6.4111 < 8.3344] w=0.0435 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)L412.CB) [> 3.6537 = 6.0895 < 7.9163] w=0.0435 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)L251.CB) [> 4.0749 = 6.7915 < 8.8289] w=0.0435 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)V267.CB) [> 4.0974 = 6.8290 < 8.8777] w=0.0294 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)V267.CB) [> 3.8137 = 6.3561 < 8.2630] w=0.0294 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)S324.CB) [> 3.4149 = 5.6915 < 7.3990] w=0.0291 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)F264.CB) [> 4.4187 = 7.3645 < 9.5738] w=0.0251 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)G265.CA) [> 3.8574 = 6.4289 < 8.3576] w=0.0251 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)I266.CB) [> 2.9442 = 4.9069 < 6.3790] w=0.0251 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)V184.CB) [> 3.6908 = 6.1513 < 7.9967] w=0.0247 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)L305.CB) [> 4.1636 = 6.9394 < 9.0212] w=0.0235 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)N306.CB) [> 4.4595 = 7.4325 < 9.6622] w=0.0235 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)V267.CB) [> 3.8868 = 6.4780 < 8.4214] w=0.0234 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)V267.CB) [> 4.2359 = 7.0598 < 9.1778] w=0.0231 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)I266.CB) [> 3.3686 = 5.6143 < 7.2986] w=0.0231 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)V219.CB) [> 3.6500 = 6.0833 < 7.9083] w=0.0231 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)A198.CB) [> 4.7704 = 7.9507 < 10.3359] w=0.0231 to align # Constraint # added constraint: constraint((T0296)L55.CB, (T0296)S76.CB) [> 3.6862 = 6.1437 < 7.9867] w=0.0231 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)D268.CB) [> 4.6468 = 7.7447 < 10.0681] w=0.0231 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)I266.CB) [> 3.6257 = 6.0428 < 7.8556] w=0.0231 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)G265.CA) [> 4.1356 = 6.8927 < 8.9604] w=0.0231 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)V219.CB) [> 4.3396 = 7.2326 < 9.4024] w=0.0231 to align # Constraint # added constraint: constraint((T0296)E204.CB, (T0296)R247.CB) [> 2.9655 = 4.9426 < 6.4253] w=0.0231 to align # Constraint # added constraint: constraint((T0296)P79.CB, (T0296)I130.CB) [> 4.5428 = 7.5713 < 9.8427] w=0.0228 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)L305.CB) [> 3.6084 = 6.0141 < 7.8183] w=0.0227 to align # Constraint # added constraint: constraint((T0296)G215.CA, (T0296)A256.CB) [> 3.4844 = 5.8073 < 7.5495] w=0.0227 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)F243.CB) [> 2.5362 = 4.2270 < 5.4950] w=0.0227 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)S214.CB) [> 4.1956 = 6.9927 < 9.0905] w=0.0227 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)R247.CB) [> 3.7721 = 6.2868 < 8.1728] w=0.0227 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)I245.CB) [> 4.5078 = 7.5129 < 9.7668] w=0.0227 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)I245.CB) [> 3.9681 = 6.6135 < 8.5975] w=0.0227 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)L66.CB) [> 4.6697 = 7.7829 < 10.1177] w=0.0224 to align # Constraint # added constraint: constraint((T0296)I245.CB, (T0296)A326.CB) [> 3.6252 = 6.0420 < 7.8546] w=0.0224 to align # Constraint # added constraint: constraint((T0296)A256.CB, (T0296)L269.CB) [> 4.4420 = 7.4033 < 9.6243] w=0.0224 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)A256.CB) [> 4.6172 = 7.6954 < 10.0040] w=0.0224 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)V207.CB) [> 3.8388 = 6.3980 < 8.3173] w=0.0224 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)N210.CB) [> 3.8134 = 6.3557 < 8.2624] w=0.0224 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)A186.CB) [> 4.4620 = 7.4366 < 9.6676] w=0.0224 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)F185.CB) [> 4.6220 = 7.7033 < 10.0143] w=0.0224 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)A326.CB) [> 3.6136 = 6.0227 < 7.8295] w=0.0224 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)G325.CA) [> 3.6497 = 6.0828 < 7.9077] w=0.0224 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)G325.CA) [> 4.1306 = 6.8844 < 8.9497] w=0.0222 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)F327.CB) [> 4.5071 = 7.5117 < 9.7653] w=0.0222 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)F327.CB) [> 4.6325 = 7.7207 < 10.0370] w=0.0222 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)V75.CB) [> 4.6026 = 7.6709 < 9.9722] w=0.0222 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)S76.CB) [> 3.1201 = 5.2002 < 6.7602] w=0.0222 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)G325.CA) [> 3.4345 = 5.7241 < 7.4414] w=0.0222 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)A326.CB) [> 3.9841 = 6.6402 < 8.6323] w=0.0222 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)F327.CB) [> 3.1534 = 5.2557 < 6.8324] w=0.0222 to align # Constraint # added constraint: constraint((T0296)L271.CB, (T0296)G325.CA) [> 3.6237 = 6.0395 < 7.8514] w=0.0222 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A272.CB) [> 4.4514 = 7.4190 < 9.6447] w=0.0222 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)V219.CB) [> 4.2390 = 7.0649 < 9.1844] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)V219.CB) [> 4.4398 = 7.3998 < 9.6197] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)V387.CB) [> 3.9783 = 6.6305 < 8.6197] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)V387.CB) [> 4.4570 = 7.4284 < 9.6569] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)G386.CA) [> 4.2622 = 7.1038 < 9.2349] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)A383.CB) [> 4.5341 = 7.5568 < 9.8239] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)V183.CB) [> 3.0798 = 5.1330 < 6.6730] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V77.CB, (T0296)V143.CB) [> 3.9818 = 6.6364 < 8.6273] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)V183.CB) [> 4.4507 = 7.4178 < 9.6432] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)L182.CB) [> 3.3965 = 5.6609 < 7.3592] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S76.CB, (T0296)K181.CB) [> 4.5260 = 7.5434 < 9.8064] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)V183.CB) [> 4.2285 = 7.0474 < 9.1616] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)L182.CB) [> 4.6257 = 7.7095 < 10.0223] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V75.CB, (T0296)K181.CB) [> 2.7154 = 4.5257 < 5.8833] w=0.0221 to align # Constraint # added constraint: constraint((T0296)N210.CB, (T0296)T354.CB) [> 4.5239 = 7.5398 < 9.8018] w=0.0221 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)T354.CB) [> 4.1707 = 6.9512 < 9.0365] w=0.0221 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)A326.CB) [> 3.3810 = 5.6350 < 7.3255] w=0.0221 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)E368.CB) [> 4.7954 = 7.9923 < 10.3900] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)T354.CB) [> 4.2326 = 7.0542 < 9.1705] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)A326.CB) [> 4.2639 = 7.1065 < 9.2385] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)T354.CB) [> 3.1531 = 5.2551 < 6.8317] w=0.0221 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)T354.CB) [> 4.5045 = 7.5074 < 9.7597] w=0.0221 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)G325.CA) [> 3.9077 = 6.5129 < 8.4668] w=0.0221 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)T354.CB) [> 4.6606 = 7.7677 < 10.0980] w=0.0221 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)A326.CB) [> 4.2669 = 7.1115 < 9.2449] w=0.0221 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)G325.CA) [> 3.2554 = 5.4257 < 7.0534] w=0.0221 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)G325.CA) [> 4.1224 = 6.8706 < 8.9318] w=0.0221 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A256.CB) [> 3.5652 = 5.9420 < 7.7246] w=0.0221 to align # Constraint # added constraint: constraint((T0296)A205.CB, (T0296)V330.CB) [> 3.1014 = 5.1690 < 6.7197] w=0.0221 to align # Constraint # added constraint: constraint((T0296)T354.CB, (T0296)K391.CB) [> 4.7226 = 7.8711 < 10.2324] w=0.0221 to align # Constraint # added constraint: constraint((T0296)M353.CB, (T0296)T392.CB) [> 4.4908 = 7.4847 < 9.7301] w=0.0221 to align # Constraint # added constraint: constraint((T0296)A352.CB, (T0296)T392.CB) [> 3.5603 = 5.9338 < 7.7139] w=0.0221 to align # Constraint # added constraint: constraint((T0296)A352.CB, (T0296)K391.CB) [> 4.7137 = 7.8561 < 10.2130] w=0.0221 to align # Constraint # added constraint: constraint((T0296)A352.CB, (T0296)M390.CB) [> 3.5810 = 5.9683 < 7.7588] w=0.0221 to align # Constraint # added constraint: constraint((T0296)E348.CB, (T0296)V387.CB) [> 3.0656 = 5.1094 < 6.6422] w=0.0221 to align # Constraint # added constraint: constraint((T0296)L347.CB, (T0296)I388.CB) [> 3.9934 = 6.6556 < 8.6523] w=0.0221 to align # Constraint # added constraint: constraint((T0296)L347.CB, (T0296)V387.CB) [> 1.7577 = 2.9294 < 3.8083] w=0.0221 to align # Constraint # added constraint: constraint((T0296)A372.CB, (T0296)I397.CB) [> 4.0628 = 6.7714 < 8.8028] w=0.0221 to align # Constraint # added constraint: constraint((T0296)G360.CA, (T0296)I397.CB) [> 3.2596 = 5.4327 < 7.0624] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V359.CB, (T0296)I397.CB) [> 2.8398 = 4.7330 < 6.1530] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V359.CB, (T0296)R396.CB) [> 4.3134 = 7.1890 < 9.3456] w=0.0221 to align # Constraint # added constraint: constraint((T0296)V359.CB, (T0296)V395.CB) [> 4.3705 = 7.2842 < 9.4695] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)I397.CB) [> 4.5292 = 7.5487 < 9.8133] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)R396.CB) [> 2.7054 = 4.5089 < 5.8616] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S358.CB, (T0296)V395.CB) [> 4.6961 = 7.8268 < 10.1748] w=0.0221 to align # Constraint # added constraint: constraint((T0296)C357.CB, (T0296)R396.CB) [> 4.1969 = 6.9948 < 9.0932] w=0.0221 to align # Constraint # added constraint: constraint((T0296)C357.CB, (T0296)V395.CB) [> 3.0525 = 5.0875 < 6.6137] w=0.0221 to align # Constraint # added constraint: constraint((T0296)C357.CB, (T0296)A394.CB) [> 4.4132 = 7.3554 < 9.5620] w=0.0221 to align # Constraint # added constraint: constraint((T0296)I356.CB, (T0296)R396.CB) [> 3.7959 = 6.3264 < 8.2243] w=0.0221 to align # Constraint # added constraint: constraint((T0296)I356.CB, (T0296)V395.CB) [> 4.3059 = 7.1765 < 9.3295] w=0.0221 to align # Constraint # added constraint: constraint((T0296)I356.CB, (T0296)A394.CB) [> 2.7204 = 4.5339 < 5.8941] w=0.0221 to align # Constraint # added constraint: constraint((T0296)I356.CB, (T0296)T393.CB) [> 4.6608 = 7.7680 < 10.0985] w=0.0221 to align # Constraint # added constraint: constraint((T0296)A355.CB, (T0296)A394.CB) [> 4.4335 = 7.3891 < 9.6058] w=0.0221 to align # Constraint # added constraint: constraint((T0296)T354.CB, (T0296)A394.CB) [> 4.7819 = 7.9699 < 10.3609] w=0.0221 to align # Constraint # added constraint: constraint((T0296)Q319.CB, (T0296)M353.CB) [> 4.0986 = 6.8309 < 8.8802] w=0.0221 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)Q319.CB) [> 4.6606 = 7.7676 < 10.0979] w=0.0221 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)F327.CB) [> 2.5186 = 4.1977 < 5.4570] w=0.0221 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)V359.CB) [> 4.1495 = 6.9158 < 8.9906] w=0.0221 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)C357.CB) [> 4.3045 = 7.1741 < 9.3263] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)V359.CB) [> 3.8043 = 6.3405 < 8.2427] w=0.0221 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)S358.CB) [> 4.1866 = 6.9777 < 9.0710] w=0.0221 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)T393.CB) [> 4.4603 = 7.4339 < 9.6640] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)A394.CB) [> 4.3574 = 7.2623 < 9.4410] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)R396.CB) [> 3.2901 = 5.4834 < 7.1284] w=0.0219 to align # Constraint # added constraint: constraint((T0296)D232.CB, (T0296)S344.CB) [> 4.6297 = 7.7162 < 10.0311] w=0.0219 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)I398.CB) [> 3.4179 = 5.6966 < 7.4055] w=0.0219 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)I398.CB) [> 4.4033 = 7.3389 < 9.5405] w=0.0219 to align # Constraint # added constraint: constraint((T0296)N187.CB, (T0296)R396.CB) [> 4.6212 = 7.7020 < 10.0127] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L304.CB, (T0296)I385.CB) [> 3.9221 = 6.5368 < 8.4978] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L302.CB, (T0296)V395.CB) [> 4.4183 = 7.3638 < 9.5729] w=0.0219 to align # Constraint # added constraint: constraint((T0296)D369.CB, (T0296)G386.CA) [> 3.6088 = 6.0146 < 7.8190] w=0.0219 to align # Constraint # added constraint: constraint((T0296)E368.CB, (T0296)A384.CB) [> 4.2318 = 7.0529 < 9.1688] w=0.0219 to align # Constraint # added constraint: constraint((T0296)P367.CB, (T0296)A384.CB) [> 2.8888 = 4.8147 < 6.2591] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G321.CA, (T0296)N389.CB) [> 2.8745 = 4.7909 < 6.2282] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G321.CA, (T0296)G386.CA) [> 4.2613 = 7.1022 < 9.2328] w=0.0219 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)N389.CB) [> 4.4406 = 7.4010 < 9.6213] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)T392.CB) [> 3.9262 = 6.5436 < 8.5067] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L305.CB, (T0296)I388.CB) [> 3.5070 = 5.8449 < 7.5984] w=0.0219 to align # Constraint # added constraint: constraint((T0296)R247.CB, (T0296)A384.CB) [> 3.3288 = 5.5480 < 7.2124] w=0.0219 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)I398.CB) [> 3.6521 = 6.0869 < 7.9130] w=0.0219 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)I397.CB) [> 3.0100 = 5.0167 < 6.5217] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)I398.CB) [> 3.6197 = 6.0328 < 7.8426] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)I397.CB) [> 4.1787 = 6.9645 < 9.0538] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)R396.CB) [> 1.5733 = 2.6222 < 3.4089] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L269.CB, (T0296)V395.CB) [> 3.7702 = 6.2836 < 8.1687] w=0.0219 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)R396.CB) [> 4.2241 = 7.0401 < 9.1521] w=0.0219 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)T392.CB) [> 3.9665 = 6.6108 < 8.5941] w=0.0219 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)L305.CB) [> 4.2626 = 7.1043 < 9.2356] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)R396.CB) [> 3.3689 = 5.6148 < 7.2993] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)A394.CB) [> 2.6953 = 4.4922 < 5.8399] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V267.CB, (T0296)T393.CB) [> 3.6733 = 6.1222 < 7.9589] w=0.0219 to align # Constraint # added constraint: constraint((T0296)A256.CB, (T0296)I266.CB) [> 3.0501 = 5.0836 < 6.6086] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)T393.CB) [> 2.4150 = 4.0249 < 5.2324] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G265.CA, (T0296)A394.CB) [> 4.2278 = 7.0463 < 9.1602] w=0.0219 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)A376.CB) [> 4.4558 = 7.4263 < 9.6542] w=0.0219 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)K400.CB) [> 3.5949 = 5.9915 < 7.7890] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V207.CB, (T0296)K400.CB) [> 4.1569 = 6.9282 < 9.0067] w=0.0219 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)A380.CB) [> 4.2408 = 7.0681 < 9.1885] w=0.0219 to align # Constraint # added constraint: constraint((T0296)I209.CB, (T0296)K400.CB) [> 3.9851 = 6.6419 < 8.6344] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V207.CB) [> 4.2209 = 7.0348 < 9.1452] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)V330.CB) [> 4.7229 = 7.8714 < 10.2329] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)A376.CB) [> 4.0049 = 6.6748 < 8.6773] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V213.CB, (T0296)S324.CB) [> 4.7419 = 7.9032 < 10.2741] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)A380.CB) [> 3.5317 = 5.8862 < 7.6521] w=0.0219 to align # Constraint # added constraint: constraint((T0296)I70.CB, (T0296)A384.CB) [> 4.3095 = 7.1824 < 9.3371] w=0.0219 to align # Constraint # added constraint: constraint((T0296)S145.CB, (T0296)A380.CB) [> 4.3198 = 7.1997 < 9.3596] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V143.CB, (T0296)A384.CB) [> 3.7704 = 6.2841 < 8.1693] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G411.CA, (T0296)A424.CB) [> 3.3811 = 5.6352 < 7.3258] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G410.CA, (T0296)A424.CB) [> 2.9644 = 4.9407 < 6.4229] w=0.0219 to align # Constraint # added constraint: constraint((T0296)P367.CB, (T0296)A377.CB) [> 4.6960 = 7.8267 < 10.1747] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L361.CB, (T0296)G411.CA) [> 4.2083 = 7.0139 < 9.1180] w=0.0219 to align # Constraint # added constraint: constraint((T0296)L345.CB, (T0296)G411.CA) [> 4.3969 = 7.3281 < 9.5265] w=0.0219 to align # Constraint # added constraint: constraint((T0296)S324.CB, (T0296)A365.CB) [> 3.5312 = 5.8854 < 7.6510] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)A365.CB) [> 4.0224 = 6.7040 < 8.7152] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)P367.CB) [> 4.6688 = 7.7813 < 10.1157] w=0.0219 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)F409.CB) [> 4.0328 = 6.7213 < 8.7377] w=0.0219 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)A301.CB) [> 3.0608 = 5.1013 < 6.6317] w=0.0219 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)V219.CB) [> 2.7122 = 4.5203 < 5.8764] w=0.0218 to align # Constraint # added constraint: constraint((T0296)V161.CB, (T0296)G215.CA) [> 3.1840 = 5.3066 < 6.8986] w=0.0218 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)S146.CB) [> 2.3223 = 3.8705 < 5.0316] w=0.0218 to align # Constraint # added constraint: constraint((T0296)T24.CB, (T0296)S145.CB) [> 4.1376 = 6.8959 < 8.9647] w=0.0218 to align # Constraint # added constraint: constraint((T0296)I23.CB, (T0296)S145.CB) [> 2.9448 = 4.9079 < 6.3803] w=0.0218 to align # Constraint # added constraint: constraint((T0296)L66.CB, (T0296)A272.CB) [> 4.7610 = 7.9351 < 10.3156] w=0.0218 to align # Constraint # added constraint: constraint((T0296)I80.CB, (T0296)K402.CB) [> 4.7789 = 7.9648 < 10.3543] w=0.0218 to align # Constraint # added constraint: constraint((T0296)L82.CB, (T0296)A380.CB) [> 2.8894 = 4.8157 < 6.2604] w=0.0218 to align # Constraint # added constraint: constraint((T0296)A272.CB, (T0296)L304.CB) [> 3.4759 = 5.7932 < 7.5311] w=0.0218 to align # Constraint # added constraint: constraint((T0296)D191.CB, (T0296)L412.CB) [> 3.6398 = 6.0662 < 7.8861] w=0.0218 to align # Constraint # added constraint: constraint((T0296)D191.CB, (T0296)L413.CB) [> 3.8509 = 6.4181 < 8.3436] w=0.0218 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)G411.CA) [> 4.5423 = 7.5705 < 9.8416] w=0.0218 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)F409.CB) [> 2.6988 = 4.4981 < 5.8475] w=0.0218 to align # Constraint # added constraint: constraint((T0296)I111.CB, (T0296)G265.CA) [> 4.6427 = 7.7379 < 10.0593] w=0.0071 to align # Constraint # added constraint: constraint((T0296)T22.CB, (T0296)S324.CB) [> 4.3213 = 7.2021 < 9.3628] w=0.0071 to align # Constraint # added constraint: constraint((T0296)D268.CB, (T0296)S324.CB) [> 3.4633 = 5.7721 < 7.5037] w=0.0071 to align # Constraint # added constraint: constraint((T0296)L182.CB, (T0296)L269.CB) [> 3.8082 = 6.3471 < 8.2512] w=0.0047 to align # Constraint # added constraint: constraint((T0296)V183.CB, (T0296)L269.CB) [> 2.6344 = 4.3907 < 5.7080] w=0.0047 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)L271.CB) [> 4.2050 = 7.0083 < 9.1109] w=0.0047 to align # Constraint # added constraint: constraint((T0296)V184.CB, (T0296)A272.CB) [> 4.1613 = 6.9354 < 9.0161] w=0.0047 to align # Constraint # added constraint: constraint((T0296)F185.CB, (T0296)L271.CB) [> 3.0488 = 5.0814 < 6.6058] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A186.CB, (T0296)A272.CB) [> 2.2934 = 3.8223 < 4.9690] w=0.0047 to align # Constraint # added constraint: constraint((T0296)K181.CB, (T0296)V267.CB) [> 4.1332 = 6.8887 < 8.9553] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A180.CB, (T0296)V267.CB) [> 2.4521 = 4.0869 < 5.3130] w=0.0047 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)G265.CA) [> 3.7617 = 6.2695 < 8.1504] w=0.0047 to align # Constraint # added constraint: constraint((T0296)S146.CB, (T0296)F264.CB) [> 4.3141 = 7.1902 < 9.3473] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A198.CB, (T0296)A272.CB) [> 3.1948 = 5.3247 < 6.9222] w=0.0047 to align # Constraint # added constraint: constraint((T0296)F110.CB, (T0296)S146.CB) [> 4.5973 = 7.6622 < 9.9609] w=0.0047 to align # Constraint # added constraint: constraint((T0296)V71.CB, (T0296)A180.CB) [> 3.2075 = 5.3459 < 6.9496] w=0.0047 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)L361.CB) [> 4.2980 = 7.1633 < 9.3123] w=0.0047 to align # Constraint # added constraint: constraint((T0296)V330.CB, (T0296)C357.CB) [> 4.2905 = 7.1509 < 9.2962] w=0.0047 to align # Constraint # added constraint: constraint((T0296)G325.CA, (T0296)S358.CB) [> 4.5621 = 7.6035 < 9.8846] w=0.0047 to align # Constraint # added constraint: constraint((T0296)N306.CB, (T0296)I385.CB) [> 3.2061 = 5.3435 < 6.9466] w=0.0047 to align # Constraint # added constraint: constraint((T0296)F409.CB, (T0296)M419.CB) [> 3.5690 = 5.9483 < 7.7328] w=0.0047 to align # Constraint # added constraint: constraint((T0296)F409.CB, (T0296)V418.CB) [> 3.5280 = 5.8800 < 7.6440] w=0.0047 to align # Constraint # added constraint: constraint((T0296)E408.CB, (T0296)V418.CB) [> 4.5733 = 7.6222 < 9.9089] w=0.0047 to align # Constraint # added constraint: constraint((T0296)I397.CB, (T0296)I407.CB) [> 3.8320 = 6.3866 < 8.3026] w=0.0047 to align # Constraint # added constraint: constraint((T0296)V395.CB, (T0296)M419.CB) [> 4.0140 = 6.6900 < 8.6970] w=0.0047 to align # Constraint # added constraint: constraint((T0296)T393.CB, (T0296)V421.CB) [> 3.9145 = 6.5242 < 8.4815] w=0.0047 to align # Constraint # added constraint: constraint((T0296)T393.CB, (T0296)K420.CB) [> 4.3750 = 7.2916 < 9.4791] w=0.0047 to align # Constraint # added constraint: constraint((T0296)T393.CB, (T0296)M419.CB) [> 3.3209 = 5.5348 < 7.1952] w=0.0047 to align # Constraint # added constraint: constraint((T0296)I385.CB, (T0296)R396.CB) [> 4.2402 = 7.0670 < 9.1871] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A384.CB, (T0296)R396.CB) [> 3.4375 = 5.7291 < 7.4479] w=0.0047 to align # Constraint # added constraint: constraint((T0296)D381.CB, (T0296)I398.CB) [> 4.4531 = 7.4218 < 9.6483] w=0.0047 to align # Constraint # added constraint: constraint((T0296)S270.CB, (T0296)I356.CB) [> 3.8056 = 6.3426 < 8.2454] w=0.0047 to align # Constraint # added constraint: constraint((T0296)L304.CB, (T0296)I398.CB) [> 4.0079 = 6.6798 < 8.6838] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)I398.CB) [> 2.1270 = 3.5451 < 4.6086] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A303.CB, (T0296)R396.CB) [> 4.0692 = 6.7820 < 8.8166] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A301.CB, (T0296)I398.CB) [> 4.7720 = 7.9534 < 10.3394] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A300.CB, (T0296)I398.CB) [> 2.5490 = 4.2483 < 5.5228] w=0.0047 to align # Constraint # added constraint: constraint((T0296)A188.CB, (T0296)A272.CB) [> 4.1194 = 6.8657 < 8.9254] w=0.0024 to align # Constraint # added constraint: constraint((T0296)V211.CB, (T0296)A272.CB) [> 3.1747 = 5.2911 < 6.8784] w=0.0024 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)L302.CB) [> 4.7384 = 7.8974 < 10.2666] w=0.0024 to align # Constraint # added constraint: constraint((T0296)V219.CB, (T0296)L304.CB) [> 2.8343 = 4.7238 < 6.1410] w=0.0024 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)V213.CB) [> 3.2148 = 5.3581 < 6.9655] w=0.0024 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)S214.CB) [> 4.5445 = 7.5743 < 9.8465] w=0.0024 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)S270.CB) [> 4.7233 = 7.8722 < 10.2339] w=0.0024 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)L271.CB) [> 3.2840 = 5.4734 < 7.1154] w=0.0024 to align # Constraint # added constraint: constraint((T0296)E190.CB, (T0296)A272.CB) [> 2.2912 = 3.8186 < 4.9642] w=0.0024 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0296/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0296/decoys/ # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # Found a chain break before 438 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # Found a chain break before 438 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # Found a chain break before 438 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # Found a chain break before 438 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # Found a chain break before 426 # copying to AlignedFragments data structure # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 407 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 436 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 409 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 385 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 443 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 430 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 383 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 420 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 441 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 333 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 444 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 444 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 437 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CPHmodels_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CPHmodels_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)A64.C and (T0296)E65.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.CA only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.CA only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.CB only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.CB only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.CB only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)E65.CG only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.CG only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.CG only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.CG only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)E65.CD only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)E65.CD only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.CD only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.CD only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.CD only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)E65.OE1 only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)E65.OE1 only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)E65.OE1 only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.OE1 only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.OE1 only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.OE1 only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)E65.OE2 only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)E65.OE2 only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)E65.OE2 only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)E65.OE2 only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.OE2 only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.OE2 only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.OE2 only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.O only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)E65.C only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.CG only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.CD1 only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.CD2 only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.O only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L66.C only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)G67.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)G67.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)G67.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)G67.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)G67.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)G67.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)G67.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)G67.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)G67.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)G67.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)G67.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)G67.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)G67.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)G67.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)G67.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)G67.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)G67.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)G67.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)G67.N and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)G67.CA only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)G67.O only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)G67.C only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.CG1 only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.CG2 only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.CD1 only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.O only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I68.C only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P69.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P69.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P69.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P69.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P69.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P69.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P69.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P69.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P69.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P69.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P69.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P69.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P69.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P69.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P69.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P69.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P69.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P69.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P69.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P69.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P69.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P69.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P69.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P69.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P69.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P69.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P69.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P69.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P69.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P69.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P69.CG only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P69.CD only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P69.O only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.CG1 only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.CG2 only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.CD1 only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.O only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I70.C only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V71.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V71.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V71.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V71.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V71.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V71.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V71.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V71.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V71.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V71.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V71.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V71.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V71.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V71.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V71.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V71.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V71.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V71.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V71.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V71.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V71.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V71.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V71.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V71.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V71.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V71.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V71.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V71.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V71.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V71.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V71.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V71.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V71.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V71.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V71.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V71.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V71.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V71.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V71.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V71.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V71.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V71.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V71.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V71.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V71.CG1 only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V71.CG2 only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V71.O only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V71.C only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)N72.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.CA only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.CG only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.ND2 only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.OD1 only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.O only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)N72.C only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.CA only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.CG only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.CD only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.CE only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.NZ only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.O only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)K73.C only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.CA only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.CG only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.CD only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.NE only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.CZ only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.NH1 only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.NH2 only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.O only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)R74.C only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V75.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V75.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V75.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V75.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V75.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V75.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V75.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V75.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V75.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V75.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V75.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V75.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V75.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V75.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V75.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V75.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V75.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V75.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V75.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V75.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V75.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V75.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V75.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V75.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V75.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V75.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V75.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V75.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V75.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V75.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V75.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V75.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V75.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V75.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V75.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V75.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V75.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V75.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V75.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V75.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V75.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V75.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V75.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V75.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V75.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V75.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V75.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V75.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V75.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V75.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V75.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V75.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V75.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V75.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V75.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V75.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V75.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V75.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V75.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V75.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V75.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V75.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V75.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V75.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V75.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V75.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V75.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V75.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V75.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V75.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V75.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V75.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V75.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V75.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V75.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V75.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V75.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V75.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V75.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V75.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V75.CA only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V75.CG1 only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V75.CG2 only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V75.O only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V75.C only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S76.N only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S76.N only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S76.N only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S76.N only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S76.N only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S76.N only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S76.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S76.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S76.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S76.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S76.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S76.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S76.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S76.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S76.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S76.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S76.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S76.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S76.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S76.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S76.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S76.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S76.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S76.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S76.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S76.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S76.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S76.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S76.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S76.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S76.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S76.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S76.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S76.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S76.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S76.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S76.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S76.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S76.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S76.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S76.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S76.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S76.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S76.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S76.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S76.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S76.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S76.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S76.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S76.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S76.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S76.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S76.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S76.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S76.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S76.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S76.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S76.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S76.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S76.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S76.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S76.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S76.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S76.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S76.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S76.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S76.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S76.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S76.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S76.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S76.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S76.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S76.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S76.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S76.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S76.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S76.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S76.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S76.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S76.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S76.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S76.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S76.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S76.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S76.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S76.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S76.N only 0.000 apart, marking (T0296)S76.N as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S76.CA only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S76.OG only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S76.O only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S76.C only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.C and (T0296)V77.N only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)V77.N only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)V77.N only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)V77.N only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)V77.N only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)V77.N only 0.000 apart, marking (T0296)S76.N as missing WARNING: atoms too close: (T0296)V75.C and (T0296)V77.N only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V77.N only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V77.N only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V77.N only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V77.N only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V77.N only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V77.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V77.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V77.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V77.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V77.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V77.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V77.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V77.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V77.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V77.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V77.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V77.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V77.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V77.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V77.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V77.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V77.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V77.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V77.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V77.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V77.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V77.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V77.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V77.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V77.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V77.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V77.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V77.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V77.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V77.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V77.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V77.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V77.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V77.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V77.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V77.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V77.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V77.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V77.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V77.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V77.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V77.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V77.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V77.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V77.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V77.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V77.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V77.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V77.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V77.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V77.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V77.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V77.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V77.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V77.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V77.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V77.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V77.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V77.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V77.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V77.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V77.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V77.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V77.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V77.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V77.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V77.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V77.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V77.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V77.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V77.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V77.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V77.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V77.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V77.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V77.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V77.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V77.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V77.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V77.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V77.N only 0.000 apart, marking (T0296)V77.N as missing WARNING: atoms too close: (T0296)V77.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)S76.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)S76.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V75.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V77.CA only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V77.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)S76.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)S76.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)S76.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V75.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V77.CG1 only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V77.CG2 only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)S76.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)S76.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)S76.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V75.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V77.O only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)S76.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)S76.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)V77.C only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.C and (T0296)T78.N only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)T78.N only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)T78.N only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)T78.N only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)T78.N only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)T78.N only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)T78.N only 0.000 apart, marking (T0296)V77.N as missing WARNING: atoms too close: (T0296)S76.C and (T0296)T78.N only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)T78.N only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)T78.N only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)T78.N only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)T78.N only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)T78.N only 0.000 apart, marking (T0296)S76.N as missing WARNING: atoms too close: (T0296)V75.C and (T0296)T78.N only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)T78.N only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)T78.N only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)T78.N only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)T78.N only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)T78.N only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)T78.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)R74.C and (T0296)T78.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)T78.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)T78.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)T78.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)T78.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)T78.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)T78.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)T78.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)T78.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)T78.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)T78.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)T78.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)T78.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)T78.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)T78.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)T78.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)T78.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)T78.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)T78.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)T78.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)T78.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)T78.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)T78.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)T78.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)T78.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)T78.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)T78.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)T78.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)T78.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)T78.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)T78.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)T78.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)T78.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)T78.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)T78.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)T78.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)T78.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)T78.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)T78.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)T78.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)T78.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)T78.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)T78.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)T78.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)T78.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)T78.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)T78.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)T78.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)T78.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)T78.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)T78.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)T78.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)T78.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)T78.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)T78.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)T78.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)T78.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)T78.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)T78.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)T78.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)T78.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)T78.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)T78.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)T78.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)T78.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)T78.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)T78.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)T78.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)T78.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)T78.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)T78.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)T78.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)T78.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)T78.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)T78.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)T78.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)T78.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)T78.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)T78.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)T78.N only 0.000 apart, marking (T0296)T78.N as missing WARNING: atoms too close: (T0296)T78.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V77.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V77.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)S76.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)S76.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V75.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V75.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)T78.CA only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)T78.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V77.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V77.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V77.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)S76.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)S76.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)S76.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V75.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V75.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)T78.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V77.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V77.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)T78.CG2 only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V77.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V77.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)T78.OG1 only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V77.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V77.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V77.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)S76.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)S76.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)S76.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V75.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)T78.O only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V77.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V77.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)S76.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)S76.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)T78.C only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.C and (T0296)P79.N only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)P79.N only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)P79.N only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)P79.N only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)P79.N only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)P79.N only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)P79.N only 0.000 apart, marking (T0296)T78.N as missing WARNING: atoms too close: (T0296)V77.C and (T0296)P79.N only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)P79.N only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)P79.N only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)P79.N only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)P79.N only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)P79.N only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)P79.N only 0.000 apart, marking (T0296)V77.N as missing WARNING: atoms too close: (T0296)S76.C and (T0296)P79.N only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)P79.N only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)P79.N only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)P79.N only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)P79.N only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)P79.N only 0.000 apart, marking (T0296)S76.N as missing WARNING: atoms too close: (T0296)V75.C and (T0296)P79.N only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)P79.N only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)P79.N only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)P79.N only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)P79.N only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)P79.N only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)P79.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)R74.C and (T0296)P79.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)P79.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)P79.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)P79.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)P79.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)P79.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)P79.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)P79.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)P79.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)P79.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)P79.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)P79.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)P79.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)P79.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)P79.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)P79.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)P79.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)P79.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)P79.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)P79.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)P79.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)P79.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)P79.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)P79.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)P79.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)P79.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)P79.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)P79.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)P79.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)P79.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)P79.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)P79.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)P79.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)P79.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)P79.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)P79.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)P79.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)P79.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)P79.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)P79.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)P79.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)P79.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)P79.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)P79.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P79.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P79.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P79.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P79.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P79.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P79.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P79.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P79.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P79.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P79.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P79.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P79.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P79.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P79.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P79.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P79.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P79.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P79.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P79.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P79.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P79.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P79.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P79.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P79.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P79.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P79.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P79.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P79.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P79.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P79.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P79.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P79.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P79.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P79.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P79.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P79.N only 0.000 apart, marking (T0296)P79.N as missing WARNING: atoms too close: (T0296)P79.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)T78.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)T78.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V77.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V77.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)S76.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)S76.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V75.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V75.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P79.CA only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P79.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)T78.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)T78.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)T78.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V77.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V77.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V77.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)S76.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)S76.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)S76.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V75.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V75.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P79.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)T78.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)T78.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)T78.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V77.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V77.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V77.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)S76.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)S76.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)S76.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V75.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V75.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V75.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)R74.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)K73.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)N72.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V71.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V71.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)V71.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I70.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P69.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P79.CG only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P79.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)T78.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)T78.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)T78.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V77.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V77.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V77.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)S76.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)S76.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)S76.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V75.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V75.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V75.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)R74.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)K73.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)N72.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V71.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V71.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)V71.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I70.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P69.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P79.CD only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)T78.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)T78.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)T78.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V77.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V77.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V77.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)S76.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)S76.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)S76.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V75.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P79.O only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)T78.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)T78.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V77.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V77.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)S76.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)S76.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)P79.C only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.N only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.N only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.N only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.N only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.N only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.N only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.N only 0.000 apart, marking (T0296)P79.N as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.N only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.N only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.N only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.N only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.N only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.N only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.N only 0.000 apart, marking (T0296)T78.N as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.N only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.N only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.N only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.N only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.N only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.N only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.N only 0.000 apart, marking (T0296)V77.N as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.N only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.N only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.N only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.N only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.N only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.N only 0.000 apart, marking (T0296)S76.N as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.N only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.N only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.N only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.N only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.N only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.N only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.N only 0.000 apart, marking (T0296)I80.N as missing WARNING: atoms too close: (T0296)I80.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.CA only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I80.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I80.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.CG1 only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I80.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.CG2 only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I80.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.CD1 only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.O only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P79.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P79.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P79.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)T78.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)T78.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V77.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V77.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)S76.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)S76.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)I80.C only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.C and (T0296)S81.N only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.O and (T0296)S81.N only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)S81.N only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)S81.N only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)S81.N only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)S81.N only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)S81.N only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I80.N and (T0296)S81.N only 0.000 apart, marking (T0296)I80.N as missing WARNING: atoms too close: (T0296)P79.C and (T0296)S81.N only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.O and (T0296)S81.N only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)S81.N only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)S81.N only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)S81.N only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)S81.N only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P79.N and (T0296)S81.N only 0.000 apart, marking (T0296)P79.N as missing WARNING: atoms too close: (T0296)T78.C and (T0296)S81.N only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)S81.N only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)S81.N only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)S81.N only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)S81.N only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)S81.N only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)S81.N only 0.000 apart, marking (T0296)T78.N as missing WARNING: atoms too close: (T0296)V77.C and (T0296)S81.N only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)S81.N only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)S81.N only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)S81.N only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)S81.N only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)S81.N only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)S81.N only 0.000 apart, marking (T0296)V77.N as missing WARNING: atoms too close: (T0296)S76.C and (T0296)S81.N only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)S81.N only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S81.N only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S81.N only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S81.N only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S81.N only 0.000 apart, marking (T0296)S76.N as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S81.N only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S81.N only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S81.N only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S81.N only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S81.N only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S81.N only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S81.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S81.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S81.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S81.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S81.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S81.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S81.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S81.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S81.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S81.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S81.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S81.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S81.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S81.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S81.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S81.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S81.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S81.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S81.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S81.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S81.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S81.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S81.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S81.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S81.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S81.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S81.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S81.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S81.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S81.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S81.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S81.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S81.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S81.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S81.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S81.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S81.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S81.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S81.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S81.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S81.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S81.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S81.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S81.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S81.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S81.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S81.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S81.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S81.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S81.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S81.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S81.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S81.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S81.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S81.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S81.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S81.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S81.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S81.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S81.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S81.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S81.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S81.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S81.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S81.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S81.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S81.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S81.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S81.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S81.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S81.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S81.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S81.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S81.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S81.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S81.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S81.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S81.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S81.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S81.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S81.N only 0.000 apart, marking (T0296)S81.N as missing WARNING: atoms too close: (T0296)S81.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I80.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P79.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P79.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P79.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)T78.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)T78.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V77.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V77.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S76.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S76.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S81.CA only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S81.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I80.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P79.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P79.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P79.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)T78.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)T78.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)T78.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V77.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V77.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V77.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S76.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S76.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S81.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I80.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P79.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P79.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P79.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)T78.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)T78.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)T78.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V77.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V77.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V77.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S76.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S76.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S81.OG only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S81.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I80.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P79.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P79.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P79.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)T78.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)T78.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)T78.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V77.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V77.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V77.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S76.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S76.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S81.O only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S81.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S81.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I80.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P79.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P79.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P79.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)T78.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)T78.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V77.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V77.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S76.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S76.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)S81.C only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.N only 0.000 apart, marking (T0296)S81.C as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.N only 0.000 apart, marking (T0296)S81.O as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.N only 0.000 apart, marking (T0296)S81.OG as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.N only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.N only 0.000 apart, marking (T0296)S81.CA as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.N only 0.000 apart, marking (T0296)S81.N as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.N only 0.000 apart, marking (T0296)I80.C as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.N only 0.000 apart, marking (T0296)I80.O as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.N only 0.000 apart, marking (T0296)I80.CD1 as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.N only 0.000 apart, marking (T0296)I80.CG2 as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.N only 0.000 apart, marking (T0296)I80.CG1 as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.N only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.N only 0.000 apart, marking (T0296)I80.CA as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.N only 0.000 apart, marking (T0296)I80.N as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.N only 0.000 apart, marking (T0296)P79.C as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.N only 0.000 apart, marking (T0296)P79.O as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.N only 0.000 apart, marking (T0296)P79.CD as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.N only 0.000 apart, marking (T0296)P79.CG as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.N only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.N only 0.000 apart, marking (T0296)P79.CA as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.N only 0.000 apart, marking (T0296)P79.N as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.N only 0.000 apart, marking (T0296)T78.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.N only 0.000 apart, marking (T0296)T78.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.N only 0.000 apart, marking (T0296)T78.OG1 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.N only 0.000 apart, marking (T0296)T78.CG2 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.N only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.N only 0.000 apart, marking (T0296)T78.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.N only 0.000 apart, marking (T0296)T78.N as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.N only 0.000 apart, marking (T0296)V77.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.N only 0.000 apart, marking (T0296)V77.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.N only 0.000 apart, marking (T0296)V77.CG2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.N only 0.000 apart, marking (T0296)V77.CG1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.N only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.N only 0.000 apart, marking (T0296)V77.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.N only 0.000 apart, marking (T0296)V77.N as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.N only 0.000 apart, marking (T0296)S76.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.N only 0.000 apart, marking (T0296)S76.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.N only 0.000 apart, marking (T0296)S76.OG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.N only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.N only 0.000 apart, marking (T0296)S76.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.N only 0.000 apart, marking (T0296)S76.N as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.N only 0.000 apart, marking (T0296)V75.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.N only 0.000 apart, marking (T0296)V75.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.N only 0.000 apart, marking (T0296)V75.CG2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.N only 0.000 apart, marking (T0296)V75.CG1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.N only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.N only 0.000 apart, marking (T0296)V75.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.N only 0.000 apart, marking (T0296)V75.N as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.N only 0.000 apart, marking (T0296)R74.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.N only 0.000 apart, marking (T0296)R74.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.N only 0.000 apart, marking (T0296)R74.NH2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.N only 0.000 apart, marking (T0296)R74.NH1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.N only 0.000 apart, marking (T0296)R74.CZ as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.N only 0.000 apart, marking (T0296)R74.NE as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.N only 0.000 apart, marking (T0296)R74.CD as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.N only 0.000 apart, marking (T0296)R74.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.N only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.N only 0.000 apart, marking (T0296)R74.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.N only 0.000 apart, marking (T0296)R74.N as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.N only 0.000 apart, marking (T0296)K73.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.N only 0.000 apart, marking (T0296)K73.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.N only 0.000 apart, marking (T0296)K73.NZ as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.N only 0.000 apart, marking (T0296)K73.CE as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.N only 0.000 apart, marking (T0296)K73.CD as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.N only 0.000 apart, marking (T0296)K73.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.N only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.N only 0.000 apart, marking (T0296)K73.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.N only 0.000 apart, marking (T0296)K73.N as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.N only 0.000 apart, marking (T0296)N72.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.N only 0.000 apart, marking (T0296)N72.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.N only 0.000 apart, marking (T0296)N72.OD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.N only 0.000 apart, marking (T0296)N72.ND2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.N only 0.000 apart, marking (T0296)N72.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.N only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.N only 0.000 apart, marking (T0296)N72.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.N only 0.000 apart, marking (T0296)N72.N as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.N only 0.000 apart, marking (T0296)V71.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.N only 0.000 apart, marking (T0296)V71.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.N only 0.000 apart, marking (T0296)V71.CG2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.N only 0.000 apart, marking (T0296)V71.CG1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.N only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.N only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.N only 0.000 apart, marking (T0296)V71.N as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.N only 0.000 apart, marking (T0296)I70.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.N only 0.000 apart, marking (T0296)I70.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.N only 0.000 apart, marking (T0296)I70.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.N only 0.000 apart, marking (T0296)I70.CG2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.N only 0.000 apart, marking (T0296)I70.CG1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.N only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.N only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.N only 0.000 apart, marking (T0296)I70.N as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.N only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.N only 0.000 apart, marking (T0296)P69.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.N only 0.000 apart, marking (T0296)P69.CD as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.N only 0.000 apart, marking (T0296)P69.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.N only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.N only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.N only 0.000 apart, marking (T0296)I68.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.N only 0.000 apart, marking (T0296)I68.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.N only 0.000 apart, marking (T0296)I68.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.N only 0.000 apart, marking (T0296)I68.CG2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.N only 0.000 apart, marking (T0296)I68.CG1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.N only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.N only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.N only 0.000 apart, marking (T0296)I68.N as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.N only 0.000 apart, marking (T0296)G67.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.N only 0.000 apart, marking (T0296)G67.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.N only 0.000 apart, marking (T0296)G67.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.N only 0.000 apart, marking (T0296)G67.N as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.N only 0.000 apart, marking (T0296)L66.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.N only 0.000 apart, marking (T0296)L66.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.N only 0.000 apart, marking (T0296)L66.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.N only 0.000 apart, marking (T0296)L66.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.N only 0.000 apart, marking (T0296)L66.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.N only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.N only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.N only 0.000 apart, marking (T0296)L66.N as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.N only 0.000 apart, marking (T0296)E65.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.N only 0.000 apart, marking (T0296)E65.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.N only 0.000 apart, marking (T0296)E65.OE2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.N only 0.000 apart, marking (T0296)E65.OE1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.N only 0.000 apart, marking (T0296)E65.CD as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.N only 0.000 apart, marking (T0296)E65.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.N only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.N only 0.000 apart, marking (T0296)E65.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.N only 0.000 apart, marking (T0296)E65.N as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.N only 0.000 apart, marking (T0296)L82.N as missing WARNING: atoms too close: (T0296)L82.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.CA only 0.000 apart, marking (T0296)L82.CA as missing WARNING: atoms too close: (T0296)L82.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L82.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)L82.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L82.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L82.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.CG only 0.000 apart, marking (T0296)L82.CG as missing WARNING: atoms too close: (T0296)L82.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L82.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L82.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L82.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.CD1 only 0.000 apart, marking (T0296)L82.CD1 as missing WARNING: atoms too close: (T0296)L82.CD1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L82.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L82.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L82.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L82.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.CD2 only 0.000 apart, marking (T0296)L82.CD2 as missing WARNING: atoms too close: (T0296)L82.CD2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L82.CD1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L82.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L82.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L82.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L82.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.O only 0.000 apart, marking (T0296)L82.O as missing WARNING: atoms too close: (T0296)L82.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L82.CD2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L82.CD1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L82.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L82.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L82.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L82.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S81.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S81.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S81.OG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S81.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S81.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.CD1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.CG2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.CG1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I80.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P79.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P79.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P79.CD and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P79.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P79.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P79.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)T78.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)T78.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)T78.OG1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)T78.CG2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)T78.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)T78.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V77.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V77.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V77.CG2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V77.CG1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V77.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V77.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S76.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S76.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S76.OG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S76.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)S76.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V75.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V75.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V75.CG2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V75.CG1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V75.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V75.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.NH2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.NH1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.CZ and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.NE and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.CD and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)R74.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.NZ and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.CE and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.CD and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)K73.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.OD1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.ND2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)N72.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V71.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V71.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V71.CG2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V71.CG1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V71.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)V71.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.CD1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.CG2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.CG1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I70.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P69.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P69.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P69.CD and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P69.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P69.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)P69.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.CD1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.CG2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.CG1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)I68.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)G67.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)G67.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)G67.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)G67.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.CD2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.CD1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)L66.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.O and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.OE2 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.OE1 and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.CD and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.CG and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.CB and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)E65.N and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing WARNING: atoms too close: (T0296)A64.C and (T0296)L82.C only 0.000 apart, marking (T0296)L82.C as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # Found a chain break before 438 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 437 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 385 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 409 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 407 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 410 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 374 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 Skipped atom 543, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 545, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 547, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 549, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 551, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 553, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 555, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 686, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1083, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1235, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1237, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1239, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1241, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1243, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1245, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1247, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1249, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1251, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1253, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1255, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1257, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1259, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1261, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1263, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1265, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1267, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1405, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1407, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1409, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1411, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz Skipped atom 1413, because occupancy 1.000 <= existing 1.000 in servers/FORTE1_AL1.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 Skipped atom 543, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 545, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 547, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 549, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 551, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 553, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 555, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 686, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1083, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1235, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1237, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1239, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1241, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1243, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1245, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1247, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1249, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1251, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1253, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1255, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1257, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1259, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1261, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1263, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1265, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1267, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1405, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1407, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1409, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1411, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz Skipped atom 1413, because occupancy 1.000 <= existing 1.000 in servers/FORTE2_AL1.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 283 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS2.pdb.gz looking for model 1 # Found a chain break before 378 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS2 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS3.pdb.gz looking for model 1 # Found a chain break before 432 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS3 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS4.pdb.gz looking for model 1 # Found a chain break before 401 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS4 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS5.pdb.gz looking for model 1 # Found a chain break before 378 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS5 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # Found a chain break before 79 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # Found a chain break before 392 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 Skipped atom 78, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 80, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 82, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 84, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 90, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 92, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 94, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 96, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 110, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 112, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 114, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 116, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 130, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 132, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 134, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 136, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 230, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 232, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 234, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 236, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 422, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 424, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 426, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 428, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 658, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 660, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 662, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 664, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 674, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 676, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 678, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 680, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 690, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 692, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 694, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 696, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 754, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 756, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 758, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz Skipped atom 760, because occupancy 1.000 <= existing 1.000 in servers/FUGUE_AL4.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # Found a chain break before 436 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # Found a chain break before 440 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # Found a chain break before 439 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # Found a chain break before 436 # copying to AlignedFragments data structure # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # Found a chain break before 361 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 190 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS4 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # Found a chain break before 417 # copying to AlignedFragments data structure # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 417 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 WARNING: atom 1 has residue number 150 < previous residue 426 in servers/HHpred3_TS1.pdb.gz WARNING: atom 1 has residue number 1 < previous residue 247 in servers/HHpred3_TS1.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # Found a chain break before 426 # copying to AlignedFragments data structure # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 444 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 393 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 429 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 439 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 439 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 440 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 437 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # Found a chain break before 418 # copying to AlignedFragments data structure # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS1.pdb.gz looking for model 1 # Found a chain break before 387 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS1 # ReadConformPDB reading from PDB file servers/POMYSL_TS2.pdb.gz looking for model 1 # Found a chain break before 428 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS2 # ReadConformPDB reading from PDB file servers/POMYSL_TS3.pdb.gz looking for model 1 # Found a chain break before 428 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS3 # ReadConformPDB reading from PDB file servers/POMYSL_TS4.pdb.gz looking for model 1 # Found a chain break before 444 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS4 # ReadConformPDB reading from PDB file servers/POMYSL_TS5.pdb.gz looking for model 1 # Found a chain break before 378 # copying to AlignedFragments data structure # naming current conformation POMYSL_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # Found a chain break before 424 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # Found a chain break before 417 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 398 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 323 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 365 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 290 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 429 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 443 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 440 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 440 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 443 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 432 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 363 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 288 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 397 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 334 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 439 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 280 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 330 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 329 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)D2.CA and (T0296)D2.CB only 0.000 apart, marking (T0296)D2.CB as missing WARNING: atoms too close: (T0296)T9.CA and (T0296)T9.CB only 0.000 apart, marking (T0296)T9.CB as missing WARNING: atoms too close: (T0296)A11.CA and (T0296)A11.CB only 0.000 apart, marking (T0296)A11.CB as missing WARNING: atoms too close: (T0296)N17.CA and (T0296)N17.CB only 0.000 apart, marking (T0296)N17.CB as missing WARNING: atoms too close: (T0296)T22.CA and (T0296)T22.CB only 0.000 apart, marking (T0296)T22.CB as missing WARNING: atoms too close: (T0296)M25.CA and (T0296)M25.CB only 0.000 apart, marking (T0296)M25.CB as missing WARNING: atoms too close: (T0296)T50.CA and (T0296)T50.CB only 0.000 apart, marking (T0296)T50.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I83.CA and (T0296)I83.CB only 0.000 apart, marking (T0296)I83.CB as missing WARNING: atoms too close: (T0296)K101.CA and (T0296)K101.CB only 0.000 apart, marking (T0296)K101.CB as missing WARNING: atoms too close: (T0296)A102.CA and (T0296)A102.CB only 0.000 apart, marking (T0296)A102.CB as missing WARNING: atoms too close: (T0296)F110.CA and (T0296)F110.CB only 0.000 apart, marking (T0296)F110.CB as missing WARNING: atoms too close: (T0296)F114.CA and (T0296)F114.CB only 0.000 apart, marking (T0296)F114.CB as missing WARNING: atoms too close: (T0296)Q119.CA and (T0296)Q119.CB only 0.000 apart, marking (T0296)Q119.CB as missing WARNING: atoms too close: (T0296)Y122.CA and (T0296)Y122.CB only 0.000 apart, marking (T0296)Y122.CB as missing WARNING: atoms too close: (T0296)N131.CA and (T0296)N131.CB only 0.000 apart, marking (T0296)N131.CB as missing WARNING: atoms too close: (T0296)V143.CA and (T0296)V143.CB only 0.000 apart, marking (T0296)V143.CB as missing WARNING: atoms too close: (T0296)V183.CA and (T0296)V183.CB only 0.000 apart, marking (T0296)V183.CB as missing WARNING: atoms too close: (T0296)A188.CA and (T0296)A188.CB only 0.000 apart, marking (T0296)A188.CB as missing WARNING: atoms too close: (T0296)E190.CA and (T0296)E190.CB only 0.000 apart, marking (T0296)E190.CB as missing WARNING: atoms too close: (T0296)F194.CA and (T0296)F194.CB only 0.000 apart, marking (T0296)F194.CB as missing WARNING: atoms too close: (T0296)M195.CA and (T0296)M195.CB only 0.000 apart, marking (T0296)M195.CB as missing WARNING: atoms too close: (T0296)F199.CA and (T0296)F199.CB only 0.000 apart, marking (T0296)F199.CB as missing WARNING: atoms too close: (T0296)I209.CA and (T0296)I209.CB only 0.000 apart, marking (T0296)I209.CB as missing WARNING: atoms too close: (T0296)N210.CA and (T0296)N210.CB only 0.000 apart, marking (T0296)N210.CB as missing WARNING: atoms too close: (T0296)V211.CA and (T0296)V211.CB only 0.000 apart, marking (T0296)V211.CB as missing WARNING: atoms too close: (T0296)V213.CA and (T0296)V213.CB only 0.000 apart, marking (T0296)V213.CB as missing WARNING: atoms too close: (T0296)E236.CA and (T0296)E236.CB only 0.000 apart, marking (T0296)E236.CB as missing WARNING: atoms too close: (T0296)K240.CA and (T0296)K240.CB only 0.000 apart, marking (T0296)K240.CB as missing WARNING: atoms too close: (T0296)L251.CA and (T0296)L251.CB only 0.000 apart, marking (T0296)L251.CB as missing WARNING: atoms too close: (T0296)M255.CA and (T0296)M255.CB only 0.000 apart, marking (T0296)M255.CB as missing WARNING: atoms too close: (T0296)A256.CA and (T0296)A256.CB only 0.000 apart, marking (T0296)A256.CB as missing WARNING: atoms too close: (T0296)S270.CA and (T0296)S270.CB only 0.000 apart, marking (T0296)S270.CB as missing WARNING: atoms too close: (T0296)L271.CA and (T0296)L271.CB only 0.000 apart, marking (T0296)L271.CB as missing WARNING: atoms too close: (T0296)A272.CA and (T0296)A272.CB only 0.000 apart, marking (T0296)A272.CB as missing WARNING: atoms too close: (T0296)P273.CA and (T0296)P273.CB only 0.000 apart, marking (T0296)P273.CB as missing WARNING: atoms too close: (T0296)R283.CA and (T0296)R283.CB only 0.000 apart, marking (T0296)R283.CB as missing WARNING: atoms too close: (T0296)L290.CA and (T0296)L290.CB only 0.000 apart, marking (T0296)L290.CB as missing WARNING: atoms too close: (T0296)E291.CA and (T0296)E291.CB only 0.000 apart, marking (T0296)E291.CB as missing WARNING: atoms too close: (T0296)D307.CA and (T0296)D307.CB only 0.000 apart, marking (T0296)D307.CB as missing WARNING: atoms too close: (T0296)N318.CA and (T0296)N318.CB only 0.000 apart, marking (T0296)N318.CB as missing WARNING: atoms too close: (T0296)L323.CA and (T0296)L323.CB only 0.000 apart, marking (T0296)L323.CB as missing WARNING: atoms too close: (T0296)E332.CA and (T0296)E332.CB only 0.000 apart, marking (T0296)E332.CB as missing WARNING: atoms too close: (T0296)I337.CA and (T0296)I337.CB only 0.000 apart, marking (T0296)I337.CB as missing WARNING: atoms too close: (T0296)A339.CA and (T0296)A339.CB only 0.000 apart, marking (T0296)A339.CB as missing WARNING: atoms too close: (T0296)V340.CA and (T0296)V340.CB only 0.000 apart, marking (T0296)V340.CB as missing WARNING: atoms too close: (T0296)Q341.CA and (T0296)Q341.CB only 0.000 apart, marking (T0296)Q341.CB as missing WARNING: atoms too close: (T0296)E351.CA and (T0296)E351.CB only 0.000 apart, marking (T0296)E351.CB as missing WARNING: atoms too close: (T0296)T354.CA and (T0296)T354.CB only 0.000 apart, marking (T0296)T354.CB as missing WARNING: atoms too close: (T0296)C357.CA and (T0296)C357.CB only 0.000 apart, marking (T0296)C357.CB as missing WARNING: atoms too close: (T0296)T370.CA and (T0296)T370.CB only 0.000 apart, marking (T0296)T370.CB as missing WARNING: atoms too close: (T0296)P371.CA and (T0296)P371.CB only 0.000 apart, marking (T0296)P371.CB as missing WARNING: atoms too close: (T0296)E373.CA and (T0296)E373.CB only 0.000 apart, marking (T0296)E373.CB as missing WARNING: atoms too close: (T0296)A384.CA and (T0296)A384.CB only 0.000 apart, marking (T0296)A384.CB as missing WARNING: atoms too close: (T0296)V387.CA and (T0296)V387.CB only 0.000 apart, marking (T0296)V387.CB as missing WARNING: atoms too close: (T0296)R396.CA and (T0296)R396.CB only 0.000 apart, marking (T0296)R396.CB as missing WARNING: atoms too close: (T0296)L412.CA and (T0296)L412.CB only 0.000 apart, marking (T0296)L412.CB as missing WARNING: atoms too close: (T0296)A416.CA and (T0296)A416.CB only 0.000 apart, marking (T0296)A416.CB as missing WARNING: atoms too close: (T0296)V418.CA and (T0296)V418.CB only 0.000 apart, marking (T0296)V418.CB as missing WARNING: atoms too close: (T0296)A424.CA and (T0296)A424.CB only 0.000 apart, marking (T0296)A424.CB as missing WARNING: atoms too close: (T0296)S426.CA and (T0296)S426.CB only 0.000 apart, marking (T0296)S426.CB as missing WARNING: atoms too close: (T0296)I440.CA and (T0296)I440.CB only 0.000 apart, marking (T0296)I440.CB as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)M1.CA and (T0296)M1.CB only 0.000 apart, marking (T0296)M1.CB as missing WARNING: atoms too close: (T0296)D2.CA and (T0296)D2.CB only 0.000 apart, marking (T0296)D2.CB as missing WARNING: atoms too close: (T0296)I3.CA and (T0296)I3.CB only 0.000 apart, marking (T0296)I3.CB as missing WARNING: atoms too close: (T0296)R4.CA and (T0296)R4.CB only 0.000 apart, marking (T0296)R4.CB as missing WARNING: atoms too close: (T0296)Q5.CA and (T0296)Q5.CB only 0.000 apart, marking (T0296)Q5.CB as missing WARNING: atoms too close: (T0296)V6.CA and (T0296)V6.CB only 0.000 apart, marking (T0296)V6.CB as missing WARNING: atoms too close: (T0296)T7.CA and (T0296)T7.CB only 0.000 apart, marking (T0296)T7.CB as missing WARNING: atoms too close: (T0296)E8.CA and (T0296)E8.CB only 0.000 apart, marking (T0296)E8.CB as missing WARNING: atoms too close: (T0296)T9.CA and (T0296)T9.CB only 0.000 apart, marking (T0296)T9.CB as missing WARNING: atoms too close: (T0296)I10.CA and (T0296)I10.CB only 0.000 apart, marking (T0296)I10.CB as missing WARNING: atoms too close: (T0296)A11.CA and (T0296)A11.CB only 0.000 apart, marking (T0296)A11.CB as missing WARNING: atoms too close: (T0296)M12.CA and (T0296)M12.CB only 0.000 apart, marking (T0296)M12.CB as missing WARNING: atoms too close: (T0296)I13.CA and (T0296)I13.CB only 0.000 apart, marking (T0296)I13.CB as missing WARNING: atoms too close: (T0296)E14.CA and (T0296)E14.CB only 0.000 apart, marking (T0296)E14.CB as missing WARNING: atoms too close: (T0296)E15.CA and (T0296)E15.CB only 0.000 apart, marking (T0296)E15.CB as missing WARNING: atoms too close: (T0296)Q16.CA and (T0296)Q16.CB only 0.000 apart, marking (T0296)Q16.CB as missing WARNING: atoms too close: (T0296)N17.CA and (T0296)N17.CB only 0.000 apart, marking (T0296)N17.CB as missing WARNING: atoms too close: (T0296)F18.CA and (T0296)F18.CB only 0.000 apart, marking (T0296)F18.CB as missing WARNING: atoms too close: (T0296)D19.CA and (T0296)D19.CB only 0.000 apart, marking (T0296)D19.CB as missing WARNING: atoms too close: (T0296)I20.CA and (T0296)I20.CB only 0.000 apart, marking (T0296)I20.CB as missing WARNING: atoms too close: (T0296)T22.CA and (T0296)T22.CB only 0.000 apart, marking (T0296)T22.CB as missing WARNING: atoms too close: (T0296)I23.CA and (T0296)I23.CB only 0.000 apart, marking (T0296)I23.CB as missing WARNING: atoms too close: (T0296)T24.CA and (T0296)T24.CB only 0.000 apart, marking (T0296)T24.CB as missing WARNING: atoms too close: (T0296)I27.CA and (T0296)I27.CB only 0.000 apart, marking (T0296)I27.CB as missing WARNING: atoms too close: (T0296)S28.CA and (T0296)S28.CB only 0.000 apart, marking (T0296)S28.CB as missing WARNING: atoms too close: (T0296)L29.CA and (T0296)L29.CB only 0.000 apart, marking (T0296)L29.CB as missing WARNING: atoms too close: (T0296)L30.CA and (T0296)L30.CB only 0.000 apart, marking (T0296)L30.CB as missing WARNING: atoms too close: (T0296)D31.CA and (T0296)D31.CB only 0.000 apart, marking (T0296)D31.CB as missing WARNING: atoms too close: (T0296)C32.CA and (T0296)C32.CB only 0.000 apart, marking (T0296)C32.CB as missing WARNING: atoms too close: (T0296)D34.CA and (T0296)D34.CB only 0.000 apart, marking (T0296)D34.CB as missing WARNING: atoms too close: (T0296)P35.CA and (T0296)P35.CB only 0.000 apart, marking (T0296)P35.CB as missing WARNING: atoms too close: (T0296)D36.CA and (T0296)D36.CB only 0.000 apart, marking (T0296)D36.CB as missing WARNING: atoms too close: (T0296)I37.CA and (T0296)I37.CB only 0.000 apart, marking (T0296)I37.CB as missing WARNING: atoms too close: (T0296)N38.CA and (T0296)N38.CB only 0.000 apart, marking (T0296)N38.CB as missing WARNING: atoms too close: (T0296)R39.CA and (T0296)R39.CB only 0.000 apart, marking (T0296)R39.CB as missing WARNING: atoms too close: (T0296)A41.CA and (T0296)A41.CB only 0.000 apart, marking (T0296)A41.CB as missing WARNING: atoms too close: (T0296)E42.CA and (T0296)E42.CB only 0.000 apart, marking (T0296)E42.CB as missing WARNING: atoms too close: (T0296)K43.CA and (T0296)K43.CB only 0.000 apart, marking (T0296)K43.CB as missing WARNING: atoms too close: (T0296)I44.CA and (T0296)I44.CB only 0.000 apart, marking (T0296)I44.CB as missing WARNING: atoms too close: (T0296)Y45.CA and (T0296)Y45.CB only 0.000 apart, marking (T0296)Y45.CB as missing WARNING: atoms too close: (T0296)Q46.CA and (T0296)Q46.CB only 0.000 apart, marking (T0296)Q46.CB as missing WARNING: atoms too close: (T0296)K47.CA and (T0296)K47.CB only 0.000 apart, marking (T0296)K47.CB as missing WARNING: atoms too close: (T0296)I48.CA and (T0296)I48.CB only 0.000 apart, marking (T0296)I48.CB as missing WARNING: atoms too close: (T0296)T49.CA and (T0296)T49.CB only 0.000 apart, marking (T0296)T49.CB as missing WARNING: atoms too close: (T0296)T50.CA and (T0296)T50.CB only 0.000 apart, marking (T0296)T50.CB as missing WARNING: atoms too close: (T0296)K51.CA and (T0296)K51.CB only 0.000 apart, marking (T0296)K51.CB as missing WARNING: atoms too close: (T0296)A52.CA and (T0296)A52.CB only 0.000 apart, marking (T0296)A52.CB as missing WARNING: atoms too close: (T0296)A53.CA and (T0296)A53.CB only 0.000 apart, marking (T0296)A53.CB as missing WARNING: atoms too close: (T0296)V56.CA and (T0296)V56.CB only 0.000 apart, marking (T0296)V56.CB as missing WARNING: atoms too close: (T0296)A57.CA and (T0296)A57.CB only 0.000 apart, marking (T0296)A57.CB as missing WARNING: atoms too close: (T0296)V58.CA and (T0296)V58.CB only 0.000 apart, marking (T0296)V58.CB as missing WARNING: atoms too close: (T0296)E61.CA and (T0296)E61.CB only 0.000 apart, marking (T0296)E61.CB as missing WARNING: atoms too close: (T0296)A63.CA and (T0296)A63.CB only 0.000 apart, marking (T0296)A63.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.CB only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)I68.CA and (T0296)I68.CB only 0.000 apart, marking (T0296)I68.CB as missing WARNING: atoms too close: (T0296)P69.CA and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)I70.CA and (T0296)I70.CB only 0.000 apart, marking (T0296)I70.CB as missing WARNING: atoms too close: (T0296)V71.CA and (T0296)V71.CB only 0.000 apart, marking (T0296)V71.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)K73.CA and (T0296)K73.CB only 0.000 apart, marking (T0296)K73.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)S76.CA and (T0296)S76.CB only 0.000 apart, marking (T0296)S76.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)T78.CA and (T0296)T78.CB only 0.000 apart, marking (T0296)T78.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)I80.CA and (T0296)I80.CB only 0.000 apart, marking (T0296)I80.CB as missing WARNING: atoms too close: (T0296)S81.CA and (T0296)S81.CB only 0.000 apart, marking (T0296)S81.CB as missing WARNING: atoms too close: (T0296)L82.CA and (T0296)L82.CB only 0.000 apart, marking (T0296)L82.CB as missing WARNING: atoms too close: (T0296)I83.CA and (T0296)I83.CB only 0.000 apart, marking (T0296)I83.CB as missing WARNING: atoms too close: (T0296)A85.CA and (T0296)A85.CB only 0.000 apart, marking (T0296)A85.CB as missing WARNING: atoms too close: (T0296)A86.CA and (T0296)A86.CB only 0.000 apart, marking (T0296)A86.CB as missing WARNING: atoms too close: (T0296)T87.CA and (T0296)T87.CB only 0.000 apart, marking (T0296)T87.CB as missing WARNING: atoms too close: (T0296)D88.CA and (T0296)D88.CB only 0.000 apart, marking (T0296)D88.CB as missing WARNING: atoms too close: (T0296)A89.CA and (T0296)A89.CB only 0.000 apart, marking (T0296)A89.CB as missing WARNING: atoms too close: (T0296)T90.CA and (T0296)T90.CB only 0.000 apart, marking (T0296)T90.CB as missing WARNING: atoms too close: (T0296)Y92.CA and (T0296)Y92.CB only 0.000 apart, marking (T0296)Y92.CB as missing WARNING: atoms too close: (T0296)V93.CA and (T0296)V93.CB only 0.000 apart, marking (T0296)V93.CB as missing WARNING: atoms too close: (T0296)V94.CA and (T0296)V94.CB only 0.000 apart, marking (T0296)V94.CB as missing WARNING: atoms too close: (T0296)L95.CA and (T0296)L95.CB only 0.000 apart, marking (T0296)L95.CB as missing WARNING: atoms too close: (T0296)A96.CA and (T0296)A96.CB only 0.000 apart, marking (T0296)A96.CB as missing WARNING: atoms too close: (T0296)A98.CA and (T0296)A98.CB only 0.000 apart, marking (T0296)A98.CB as missing WARNING: atoms too close: (T0296)L99.CA and (T0296)L99.CB only 0.000 apart, marking (T0296)L99.CB as missing WARNING: atoms too close: (T0296)D100.CA and (T0296)D100.CB only 0.000 apart, marking (T0296)D100.CB as missing WARNING: atoms too close: (T0296)K101.CA and (T0296)K101.CB only 0.000 apart, marking (T0296)K101.CB as missing WARNING: atoms too close: (T0296)A102.CA and (T0296)A102.CB only 0.000 apart, marking (T0296)A102.CB as missing WARNING: atoms too close: (T0296)A103.CA and (T0296)A103.CB only 0.000 apart, marking (T0296)A103.CB as missing WARNING: atoms too close: (T0296)K104.CA and (T0296)K104.CB only 0.000 apart, marking (T0296)K104.CB as missing WARNING: atoms too close: (T0296)E105.CA and (T0296)E105.CB only 0.000 apart, marking (T0296)E105.CB as missing WARNING: atoms too close: (T0296)I106.CA and (T0296)I106.CB only 0.000 apart, marking (T0296)I106.CB as missing WARNING: atoms too close: (T0296)V108.CA and (T0296)V108.CB only 0.000 apart, marking (T0296)V108.CB as missing WARNING: atoms too close: (T0296)F110.CA and (T0296)F110.CB only 0.000 apart, marking (T0296)F110.CB as missing WARNING: atoms too close: (T0296)I111.CA and (T0296)I111.CB only 0.000 apart, marking (T0296)I111.CB as missing WARNING: atoms too close: (T0296)F114.CA and (T0296)F114.CB only 0.000 apart, marking (T0296)F114.CB as missing WARNING: atoms too close: (T0296)S115.CA and (T0296)S115.CB only 0.000 apart, marking (T0296)S115.CB as missing WARNING: atoms too close: (T0296)A116.CA and (T0296)A116.CB only 0.000 apart, marking (T0296)A116.CB as missing WARNING: atoms too close: (T0296)L117.CA and (T0296)L117.CB only 0.000 apart, marking (T0296)L117.CB as missing WARNING: atoms too close: (T0296)V118.CA and (T0296)V118.CB only 0.000 apart, marking (T0296)V118.CB as missing WARNING: atoms too close: (T0296)Q119.CA and (T0296)Q119.CB only 0.000 apart, marking (T0296)Q119.CB as missing WARNING: atoms too close: (T0296)K120.CA and (T0296)K120.CB only 0.000 apart, marking (T0296)K120.CB as missing WARNING: atoms too close: (T0296)Y122.CA and (T0296)Y122.CB only 0.000 apart, marking (T0296)Y122.CB as missing WARNING: atoms too close: (T0296)Q123.CA and (T0296)Q123.CB only 0.000 apart, marking (T0296)Q123.CB as missing WARNING: atoms too close: (T0296)K124.CA and (T0296)K124.CB only 0.000 apart, marking (T0296)K124.CB as missing WARNING: atoms too close: (T0296)D126.CA and (T0296)D126.CB only 0.000 apart, marking (T0296)D126.CB as missing WARNING: atoms too close: (T0296)E127.CA and (T0296)E127.CB only 0.000 apart, marking (T0296)E127.CB as missing WARNING: atoms too close: (T0296)I128.CA and (T0296)I128.CB only 0.000 apart, marking (T0296)I128.CB as missing WARNING: atoms too close: (T0296)L129.CA and (T0296)L129.CB only 0.000 apart, marking (T0296)L129.CB as missing WARNING: atoms too close: (T0296)I130.CA and (T0296)I130.CB only 0.000 apart, marking (T0296)I130.CB as missing WARNING: atoms too close: (T0296)N131.CA and (T0296)N131.CB only 0.000 apart, marking (T0296)N131.CB as missing WARNING: atoms too close: (T0296)S132.CA and (T0296)S132.CB only 0.000 apart, marking (T0296)S132.CB as missing WARNING: atoms too close: (T0296)I133.CA and (T0296)I133.CB only 0.000 apart, marking (T0296)I133.CB as missing WARNING: atoms too close: (T0296)P134.CA and (T0296)P134.CB only 0.000 apart, marking (T0296)P134.CB as missing WARNING: atoms too close: (T0296)R135.CA and (T0296)R135.CB only 0.000 apart, marking (T0296)R135.CB as missing WARNING: atoms too close: (T0296)A136.CA and (T0296)A136.CB only 0.000 apart, marking (T0296)A136.CB as missing WARNING: atoms too close: (T0296)A138.CA and (T0296)A138.CB only 0.000 apart, marking (T0296)A138.CB as missing WARNING: atoms too close: (T0296)T140.CA and (T0296)T140.CB only 0.000 apart, marking (T0296)T140.CB as missing WARNING: atoms too close: (T0296)D141.CA and (T0296)D141.CB only 0.000 apart, marking (T0296)D141.CB as missing WARNING: atoms too close: (T0296)K142.CA and (T0296)K142.CB only 0.000 apart, marking (T0296)K142.CB as missing WARNING: atoms too close: (T0296)V143.CA and (T0296)V143.CB only 0.000 apart, marking (T0296)V143.CB as missing WARNING: atoms too close: (T0296)C144.CA and (T0296)C144.CB only 0.000 apart, marking (T0296)C144.CB as missing WARNING: atoms too close: (T0296)S145.CA and (T0296)S145.CB only 0.000 apart, marking (T0296)S145.CB as missing WARNING: atoms too close: (T0296)S146.CA and (T0296)S146.CB only 0.000 apart, marking (T0296)S146.CB as missing WARNING: atoms too close: (T0296)V147.CA and (T0296)V147.CB only 0.000 apart, marking (T0296)V147.CB as missing WARNING: atoms too close: (T0296)N148.CA and (T0296)N148.CB only 0.000 apart, marking (T0296)N148.CB as missing WARNING: atoms too close: (T0296)S151.CA and (T0296)S151.CB only 0.000 apart, marking (T0296)S151.CB as missing WARNING: atoms too close: (T0296)T152.CA and (T0296)T152.CB only 0.000 apart, marking (T0296)T152.CB as missing WARNING: atoms too close: (T0296)K153.CA and (T0296)K153.CB only 0.000 apart, marking (T0296)K153.CB as missing WARNING: atoms too close: (T0296)S154.CA and (T0296)S154.CB only 0.000 apart, marking (T0296)S154.CB as missing WARNING: atoms too close: (T0296)I156.CA and (T0296)I156.CB only 0.000 apart, marking (T0296)I156.CB as missing WARNING: atoms too close: (T0296)N157.CA and (T0296)N157.CB only 0.000 apart, marking (T0296)N157.CB as missing WARNING: atoms too close: (T0296)M158.CA and (T0296)M158.CB only 0.000 apart, marking (T0296)M158.CB as missing WARNING: atoms too close: (T0296)T159.CA and (T0296)T159.CB only 0.000 apart, marking (T0296)T159.CB as missing WARNING: atoms too close: (T0296)A160.CA and (T0296)A160.CB only 0.000 apart, marking (T0296)A160.CB as missing WARNING: atoms too close: (T0296)V161.CA and (T0296)V161.CB only 0.000 apart, marking (T0296)V161.CB as missing WARNING: atoms too close: (T0296)A162.CA and (T0296)A162.CB only 0.000 apart, marking (T0296)A162.CB as missing WARNING: atoms too close: (T0296)D163.CA and (T0296)D163.CB only 0.000 apart, marking (T0296)D163.CB as missing WARNING: atoms too close: (T0296)M164.CA and (T0296)M164.CB only 0.000 apart, marking (T0296)M164.CB as missing WARNING: atoms too close: (T0296)R166.CA and (T0296)R166.CB only 0.000 apart, marking (T0296)R166.CB as missing WARNING: atoms too close: (T0296)I167.CA and (T0296)I167.CB only 0.000 apart, marking (T0296)I167.CB as missing WARNING: atoms too close: (T0296)I168.CA and (T0296)I168.CB only 0.000 apart, marking (T0296)I168.CB as missing WARNING: atoms too close: (T0296)K169.CA and (T0296)K169.CB only 0.000 apart, marking (T0296)K169.CB as missing WARNING: atoms too close: (T0296)E170.CA and (T0296)E170.CB only 0.000 apart, marking (T0296)E170.CB as missing WARNING: atoms too close: (T0296)T171.CA and (T0296)T171.CB only 0.000 apart, marking (T0296)T171.CB as missing WARNING: atoms too close: (T0296)A172.CA and (T0296)A172.CB only 0.000 apart, marking (T0296)A172.CB as missing WARNING: atoms too close: (T0296)N173.CA and (T0296)N173.CB only 0.000 apart, marking (T0296)N173.CB as missing WARNING: atoms too close: (T0296)L174.CA and (T0296)L174.CB only 0.000 apart, marking (T0296)L174.CB as missing WARNING: atoms too close: (T0296)S175.CA and (T0296)S175.CB only 0.000 apart, marking (T0296)S175.CB as missing WARNING: atoms too close: (T0296)D176.CA and (T0296)D176.CB only 0.000 apart, marking (T0296)D176.CB as missing WARNING: atoms too close: (T0296)M177.CA and (T0296)M177.CB only 0.000 apart, marking (T0296)M177.CB as missing WARNING: atoms too close: (T0296)V179.CA and (T0296)V179.CB only 0.000 apart, marking (T0296)V179.CB as missing WARNING: atoms too close: (T0296)L182.CA and (T0296)L182.CB only 0.000 apart, marking (T0296)L182.CB as missing WARNING: atoms too close: (T0296)V183.CA and (T0296)V183.CB only 0.000 apart, marking (T0296)V183.CB as missing WARNING: atoms too close: (T0296)V184.CA and (T0296)V184.CB only 0.000 apart, marking (T0296)V184.CB as missing WARNING: atoms too close: (T0296)F185.CA and (T0296)F185.CB only 0.000 apart, marking (T0296)F185.CB as missing WARNING: atoms too close: (T0296)A186.CA and (T0296)A186.CB only 0.000 apart, marking (T0296)A186.CB as missing WARNING: atoms too close: (T0296)A188.CA and (T0296)A188.CB only 0.000 apart, marking (T0296)A188.CB as missing WARNING: atoms too close: (T0296)V189.CA and (T0296)V189.CB only 0.000 apart, marking (T0296)V189.CB as missing WARNING: atoms too close: (T0296)E190.CA and (T0296)E190.CB only 0.000 apart, marking (T0296)E190.CB as missing WARNING: atoms too close: (T0296)D191.CA and (T0296)D191.CB only 0.000 apart, marking (T0296)D191.CB as missing WARNING: atoms too close: (T0296)P193.CA and (T0296)P193.CB only 0.000 apart, marking (T0296)P193.CB as missing WARNING: atoms too close: (T0296)F194.CA and (T0296)F194.CB only 0.000 apart, marking (T0296)F194.CB as missing WARNING: atoms too close: (T0296)M195.CA and (T0296)M195.CB only 0.000 apart, marking (T0296)M195.CB as missing WARNING: atoms too close: (T0296)A196.CA and (T0296)A196.CB only 0.000 apart, marking (T0296)A196.CB as missing WARNING: atoms too close: (T0296)F199.CA and (T0296)F199.CB only 0.000 apart, marking (T0296)F199.CB as missing WARNING: atoms too close: (T0296)H200.CA and (T0296)H200.CB only 0.000 apart, marking (T0296)H200.CB as missing WARNING: atoms too close: (T0296)V202.CA and (T0296)V202.CB only 0.000 apart, marking (T0296)V202.CB as missing WARNING: atoms too close: (T0296)E204.CA and (T0296)E204.CB only 0.000 apart, marking (T0296)E204.CB as missing WARNING: atoms too close: (T0296)A205.CA and (T0296)A205.CB only 0.000 apart, marking (T0296)A205.CB as missing WARNING: atoms too close: (T0296)D206.CA and (T0296)D206.CB only 0.000 apart, marking (T0296)D206.CB as missing WARNING: atoms too close: (T0296)V207.CA and (T0296)V207.CB only 0.000 apart, marking (T0296)V207.CB as missing WARNING: atoms too close: (T0296)I208.CA and (T0296)I208.CB only 0.000 apart, marking (T0296)I208.CB as missing WARNING: atoms too close: (T0296)I209.CA and (T0296)I209.CB only 0.000 apart, marking (T0296)I209.CB as missing WARNING: atoms too close: (T0296)N210.CA and (T0296)N210.CB only 0.000 apart, marking (T0296)N210.CB as missing WARNING: atoms too close: (T0296)V211.CA and (T0296)V211.CB only 0.000 apart, marking (T0296)V211.CB as missing WARNING: atoms too close: (T0296)V213.CA and (T0296)V213.CB only 0.000 apart, marking (T0296)V213.CB as missing WARNING: atoms too close: (T0296)S214.CA and (T0296)S214.CB only 0.000 apart, marking (T0296)S214.CB as missing WARNING: atoms too close: (T0296)P216.CA and (T0296)P216.CB only 0.000 apart, marking (T0296)P216.CB as missing WARNING: atoms too close: (T0296)V218.CA and (T0296)V218.CB only 0.000 apart, marking (T0296)V218.CB as missing WARNING: atoms too close: (T0296)V219.CA and (T0296)V219.CB only 0.000 apart, marking (T0296)V219.CB as missing WARNING: atoms too close: (T0296)K220.CA and (T0296)K220.CB only 0.000 apart, marking (T0296)K220.CB as missing WARNING: atoms too close: (T0296)R221.CA and (T0296)R221.CB only 0.000 apart, marking (T0296)R221.CB as missing WARNING: atoms too close: (T0296)A222.CA and (T0296)A222.CB only 0.000 apart, marking (T0296)A222.CB as missing WARNING: atoms too close: (T0296)L223.CA and (T0296)L223.CB only 0.000 apart, marking (T0296)L223.CB as missing WARNING: atoms too close: (T0296)E224.CA and (T0296)E224.CB only 0.000 apart, marking (T0296)E224.CB as missing WARNING: atoms too close: (T0296)K225.CA and (T0296)K225.CB only 0.000 apart, marking (T0296)K225.CB as missing WARNING: atoms too close: (T0296)V226.CA and (T0296)V226.CB only 0.000 apart, marking (T0296)V226.CB as missing WARNING: atoms too close: (T0296)Q229.CA and (T0296)Q229.CB only 0.000 apart, marking (T0296)Q229.CB as missing WARNING: atoms too close: (T0296)F231.CA and (T0296)F231.CB only 0.000 apart, marking (T0296)F231.CB as missing WARNING: atoms too close: (T0296)D232.CA and (T0296)D232.CB only 0.000 apart, marking (T0296)D232.CB as missing WARNING: atoms too close: (T0296)A235.CA and (T0296)A235.CB only 0.000 apart, marking (T0296)A235.CB as missing WARNING: atoms too close: (T0296)E236.CA and (T0296)E236.CB only 0.000 apart, marking (T0296)E236.CB as missing WARNING: atoms too close: (T0296)T237.CA and (T0296)T237.CB only 0.000 apart, marking (T0296)T237.CB as missing WARNING: atoms too close: (T0296)V238.CA and (T0296)V238.CB only 0.000 apart, marking (T0296)V238.CB as missing WARNING: atoms too close: (T0296)K239.CA and (T0296)K239.CB only 0.000 apart, marking (T0296)K239.CB as missing WARNING: atoms too close: (T0296)K240.CA and (T0296)K240.CB only 0.000 apart, marking (T0296)K240.CB as missing WARNING: atoms too close: (T0296)T241.CA and (T0296)T241.CB only 0.000 apart, marking (T0296)T241.CB as missing WARNING: atoms too close: (T0296)A242.CA and (T0296)A242.CB only 0.000 apart, marking (T0296)A242.CB as missing WARNING: atoms too close: (T0296)F243.CA and (T0296)F243.CB only 0.000 apart, marking (T0296)F243.CB as missing WARNING: atoms too close: (T0296)K244.CA and (T0296)K244.CB only 0.000 apart, marking (T0296)K244.CB as missing WARNING: atoms too close: (T0296)I245.CA and (T0296)I245.CB only 0.000 apart, marking (T0296)I245.CB as missing WARNING: atoms too close: (T0296)T246.CA and (T0296)T246.CB only 0.000 apart, marking (T0296)T246.CB as missing WARNING: atoms too close: (T0296)R247.CA and (T0296)R247.CB only 0.000 apart, marking (T0296)R247.CB as missing WARNING: atoms too close: (T0296)I248.CA and (T0296)I248.CB only 0.000 apart, marking (T0296)I248.CB as missing WARNING: atoms too close: (T0296)Q250.CA and (T0296)Q250.CB only 0.000 apart, marking (T0296)Q250.CB as missing WARNING: atoms too close: (T0296)L251.CA and (T0296)L251.CB only 0.000 apart, marking (T0296)L251.CB as missing WARNING: atoms too close: (T0296)V252.CA and (T0296)V252.CB only 0.000 apart, marking (T0296)V252.CB as missing WARNING: atoms too close: (T0296)Q254.CA and (T0296)Q254.CB only 0.000 apart, marking (T0296)Q254.CB as missing WARNING: atoms too close: (T0296)M255.CA and (T0296)M255.CB only 0.000 apart, marking (T0296)M255.CB as missing WARNING: atoms too close: (T0296)A256.CA and (T0296)A256.CB only 0.000 apart, marking (T0296)A256.CB as missing WARNING: atoms too close: (T0296)S257.CA and (T0296)S257.CB only 0.000 apart, marking (T0296)S257.CB as missing WARNING: atoms too close: (T0296)E258.CA and (T0296)E258.CB only 0.000 apart, marking (T0296)E258.CB as missing WARNING: atoms too close: (T0296)R259.CA and (T0296)R259.CB only 0.000 apart, marking (T0296)R259.CB as missing WARNING: atoms too close: (T0296)L260.CA and (T0296)L260.CB only 0.000 apart, marking (T0296)L260.CB as missing WARNING: atoms too close: (T0296)V262.CA and (T0296)V262.CB only 0.000 apart, marking (T0296)V262.CB as missing WARNING: atoms too close: (T0296)E263.CA and (T0296)E263.CB only 0.000 apart, marking (T0296)E263.CB as missing WARNING: atoms too close: (T0296)F264.CA and (T0296)F264.CB only 0.000 apart, marking (T0296)F264.CB as missing WARNING: atoms too close: (T0296)I266.CA and (T0296)I266.CB only 0.000 apart, marking (T0296)I266.CB as missing WARNING: atoms too close: (T0296)V267.CA and (T0296)V267.CB only 0.000 apart, marking (T0296)V267.CB as missing WARNING: atoms too close: (T0296)D268.CA and (T0296)D268.CB only 0.000 apart, marking (T0296)D268.CB as missing WARNING: atoms too close: (T0296)L269.CA and (T0296)L269.CB only 0.000 apart, marking (T0296)L269.CB as missing WARNING: atoms too close: (T0296)S270.CA and (T0296)S270.CB only 0.000 apart, marking (T0296)S270.CB as missing WARNING: atoms too close: (T0296)L271.CA and (T0296)L271.CB only 0.000 apart, marking (T0296)L271.CB as missing WARNING: atoms too close: (T0296)A272.CA and (T0296)A272.CB only 0.000 apart, marking (T0296)A272.CB as missing WARNING: atoms too close: (T0296)P273.CA and (T0296)P273.CB only 0.000 apart, marking (T0296)P273.CB as missing WARNING: atoms too close: (T0296)T274.CA and (T0296)T274.CB only 0.000 apart, marking (T0296)T274.CB as missing WARNING: atoms too close: (T0296)P275.CA and (T0296)P275.CB only 0.000 apart, marking (T0296)P275.CB as missing WARNING: atoms too close: (T0296)A276.CA and (T0296)A276.CB only 0.000 apart, marking (T0296)A276.CB as missing WARNING: atoms too close: (T0296)V277.CA and (T0296)V277.CB only 0.000 apart, marking (T0296)V277.CB as missing WARNING: atoms too close: (T0296)D279.CA and (T0296)D279.CB only 0.000 apart, marking (T0296)D279.CB as missing WARNING: atoms too close: (T0296)S280.CA and (T0296)S280.CB only 0.000 apart, marking (T0296)S280.CB as missing WARNING: atoms too close: (T0296)V281.CA and (T0296)V281.CB only 0.000 apart, marking (T0296)V281.CB as missing WARNING: atoms too close: (T0296)A282.CA and (T0296)A282.CB only 0.000 apart, marking (T0296)A282.CB as missing WARNING: atoms too close: (T0296)R283.CA and (T0296)R283.CB only 0.000 apart, marking (T0296)R283.CB as missing WARNING: atoms too close: (T0296)V284.CA and (T0296)V284.CB only 0.000 apart, marking (T0296)V284.CB as missing WARNING: atoms too close: (T0296)L285.CA and (T0296)L285.CB only 0.000 apart, marking (T0296)L285.CB as missing WARNING: atoms too close: (T0296)E286.CA and (T0296)E286.CB only 0.000 apart, marking (T0296)E286.CB as missing WARNING: atoms too close: (T0296)E287.CA and (T0296)E287.CB only 0.000 apart, marking (T0296)E287.CB as missing WARNING: atoms too close: (T0296)L290.CA and (T0296)L290.CB only 0.000 apart, marking (T0296)L290.CB as missing WARNING: atoms too close: (T0296)E291.CA and (T0296)E291.CB only 0.000 apart, marking (T0296)E291.CB as missing WARNING: atoms too close: (T0296)T292.CA and (T0296)T292.CB only 0.000 apart, marking (T0296)T292.CB as missing WARNING: atoms too close: (T0296)V293.CA and (T0296)V293.CB only 0.000 apart, marking (T0296)V293.CB as missing WARNING: atoms too close: (T0296)T295.CA and (T0296)T295.CB only 0.000 apart, marking (T0296)T295.CB as missing WARNING: atoms too close: (T0296)T298.CA and (T0296)T298.CB only 0.000 apart, marking (T0296)T298.CB as missing WARNING: atoms too close: (T0296)T299.CA and (T0296)T299.CB only 0.000 apart, marking (T0296)T299.CB as missing WARNING: atoms too close: (T0296)A300.CA and (T0296)A300.CB only 0.000 apart, marking (T0296)A300.CB as missing WARNING: atoms too close: (T0296)A301.CA and (T0296)A301.CB only 0.000 apart, marking (T0296)A301.CB as missing WARNING: atoms too close: (T0296)L305.CA and (T0296)L305.CB only 0.000 apart, marking (T0296)L305.CB as missing WARNING: atoms too close: (T0296)N306.CA and (T0296)N306.CB only 0.000 apart, marking (T0296)N306.CB as missing WARNING: atoms too close: (T0296)D307.CA and (T0296)D307.CB only 0.000 apart, marking (T0296)D307.CB as missing WARNING: atoms too close: (T0296)Q308.CA and (T0296)Q308.CB only 0.000 apart, marking (T0296)Q308.CB as missing WARNING: atoms too close: (T0296)V309.CA and (T0296)V309.CB only 0.000 apart, marking (T0296)V309.CB as missing WARNING: atoms too close: (T0296)K310.CA and (T0296)K310.CB only 0.000 apart, marking (T0296)K310.CB as missing WARNING: atoms too close: (T0296)K311.CA and (T0296)K311.CB only 0.000 apart, marking (T0296)K311.CB as missing WARNING: atoms too close: (T0296)V314.CA and (T0296)V314.CB only 0.000 apart, marking (T0296)V314.CB as missing WARNING: atoms too close: (T0296)M315.CA and (T0296)M315.CB only 0.000 apart, marking (T0296)M315.CB as missing WARNING: atoms too close: (T0296)A316.CA and (T0296)A316.CB only 0.000 apart, marking (T0296)A316.CB as missing WARNING: atoms too close: (T0296)C317.CA and (T0296)C317.CB only 0.000 apart, marking (T0296)C317.CB as missing WARNING: atoms too close: (T0296)N318.CA and (T0296)N318.CB only 0.000 apart, marking (T0296)N318.CB as missing WARNING: atoms too close: (T0296)Q319.CA and (T0296)Q319.CB only 0.000 apart, marking (T0296)Q319.CB as missing WARNING: atoms too close: (T0296)V320.CA and (T0296)V320.CB only 0.000 apart, marking (T0296)V320.CB as missing WARNING: atoms too close: (T0296)L323.CA and (T0296)L323.CB only 0.000 apart, marking (T0296)L323.CB as missing WARNING: atoms too close: (T0296)S324.CA and (T0296)S324.CB only 0.000 apart, marking (T0296)S324.CB as missing WARNING: atoms too close: (T0296)A326.CA and (T0296)A326.CB only 0.000 apart, marking (T0296)A326.CB as missing WARNING: atoms too close: (T0296)F327.CA and (T0296)F327.CB only 0.000 apart, marking (T0296)F327.CB as missing WARNING: atoms too close: (T0296)I328.CA and (T0296)I328.CB only 0.000 apart, marking (T0296)I328.CB as missing WARNING: atoms too close: (T0296)P329.CA and (T0296)P329.CB only 0.000 apart, marking (T0296)P329.CB as missing WARNING: atoms too close: (T0296)V330.CA and (T0296)V330.CB only 0.000 apart, marking (T0296)V330.CB as missing WARNING: atoms too close: (T0296)S331.CA and (T0296)S331.CB only 0.000 apart, marking (T0296)S331.CB as missing WARNING: atoms too close: (T0296)D333.CA and (T0296)D333.CB only 0.000 apart, marking (T0296)D333.CB as missing WARNING: atoms too close: (T0296)E334.CA and (T0296)E334.CB only 0.000 apart, marking (T0296)E334.CB as missing WARNING: atoms too close: (T0296)M336.CA and (T0296)M336.CB only 0.000 apart, marking (T0296)M336.CB as missing WARNING: atoms too close: (T0296)I337.CA and (T0296)I337.CB only 0.000 apart, marking (T0296)I337.CB as missing WARNING: atoms too close: (T0296)A338.CA and (T0296)A338.CB only 0.000 apart, marking (T0296)A338.CB as missing WARNING: atoms too close: (T0296)A339.CA and (T0296)A339.CB only 0.000 apart, marking (T0296)A339.CB as missing WARNING: atoms too close: (T0296)V340.CA and (T0296)V340.CB only 0.000 apart, marking (T0296)V340.CB as missing WARNING: atoms too close: (T0296)Q341.CA and (T0296)Q341.CB only 0.000 apart, marking (T0296)Q341.CB as missing WARNING: atoms too close: (T0296)N342.CA and (T0296)N342.CB only 0.000 apart, marking (T0296)N342.CB as missing WARNING: atoms too close: (T0296)S344.CA and (T0296)S344.CB only 0.000 apart, marking (T0296)S344.CB as missing WARNING: atoms too close: (T0296)L345.CA and (T0296)L345.CB only 0.000 apart, marking (T0296)L345.CB as missing WARNING: atoms too close: (T0296)N346.CA and (T0296)N346.CB only 0.000 apart, marking (T0296)N346.CB as missing WARNING: atoms too close: (T0296)L347.CA and (T0296)L347.CB only 0.000 apart, marking (T0296)L347.CB as missing WARNING: atoms too close: (T0296)E348.CA and (T0296)E348.CB only 0.000 apart, marking (T0296)E348.CB as missing WARNING: atoms too close: (T0296)K349.CA and (T0296)K349.CB only 0.000 apart, marking (T0296)K349.CB as missing WARNING: atoms too close: (T0296)L350.CA and (T0296)L350.CB only 0.000 apart, marking (T0296)L350.CB as missing WARNING: atoms too close: (T0296)E351.CA and (T0296)E351.CB only 0.000 apart, marking (T0296)E351.CB as missing WARNING: atoms too close: (T0296)A352.CA and (T0296)A352.CB only 0.000 apart, marking (T0296)A352.CB as missing WARNING: atoms too close: (T0296)M353.CA and (T0296)M353.CB only 0.000 apart, marking (T0296)M353.CB as missing WARNING: atoms too close: (T0296)T354.CA and (T0296)T354.CB only 0.000 apart, marking (T0296)T354.CB as missing WARNING: atoms too close: (T0296)A355.CA and (T0296)A355.CB only 0.000 apart, marking (T0296)A355.CB as missing WARNING: atoms too close: (T0296)I356.CA and (T0296)I356.CB only 0.000 apart, marking (T0296)I356.CB as missing WARNING: atoms too close: (T0296)C357.CA and (T0296)C357.CB only 0.000 apart, marking (T0296)C357.CB as missing WARNING: atoms too close: (T0296)S358.CA and (T0296)S358.CB only 0.000 apart, marking (T0296)S358.CB as missing WARNING: atoms too close: (T0296)V359.CA and (T0296)V359.CB only 0.000 apart, marking (T0296)V359.CB as missing WARNING: atoms too close: (T0296)M363.CA and (T0296)M363.CB only 0.000 apart, marking (T0296)M363.CB as missing WARNING: atoms too close: (T0296)I364.CA and (T0296)I364.CB only 0.000 apart, marking (T0296)I364.CB as missing WARNING: atoms too close: (T0296)A365.CA and (T0296)A365.CB only 0.000 apart, marking (T0296)A365.CB as missing WARNING: atoms too close: (T0296)I366.CA and (T0296)I366.CB only 0.000 apart, marking (T0296)I366.CB as missing WARNING: atoms too close: (T0296)P367.CA and (T0296)P367.CB only 0.000 apart, marking (T0296)P367.CB as missing WARNING: atoms too close: (T0296)E368.CA and (T0296)E368.CB only 0.000 apart, marking (T0296)E368.CB as missing WARNING: atoms too close: (T0296)D369.CA and (T0296)D369.CB only 0.000 apart, marking (T0296)D369.CB as missing WARNING: atoms too close: (T0296)T370.CA and (T0296)T370.CB only 0.000 apart, marking (T0296)T370.CB as missing WARNING: atoms too close: (T0296)P371.CA and (T0296)P371.CB only 0.000 apart, marking (T0296)P371.CB as missing WARNING: atoms too close: (T0296)A372.CA and (T0296)A372.CB only 0.000 apart, marking (T0296)A372.CB as missing WARNING: atoms too close: (T0296)E373.CA and (T0296)E373.CB only 0.000 apart, marking (T0296)E373.CB as missing WARNING: atoms too close: (T0296)T374.CA and (T0296)T374.CB only 0.000 apart, marking (T0296)T374.CB as missing WARNING: atoms too close: (T0296)I375.CA and (T0296)I375.CB only 0.000 apart, marking (T0296)I375.CB as missing WARNING: atoms too close: (T0296)A376.CA and (T0296)A376.CB only 0.000 apart, marking (T0296)A376.CB as missing WARNING: atoms too close: (T0296)A377.CA and (T0296)A377.CB only 0.000 apart, marking (T0296)A377.CB as missing WARNING: atoms too close: (T0296)M378.CA and (T0296)M378.CB only 0.000 apart, marking (T0296)M378.CB as missing WARNING: atoms too close: (T0296)I379.CA and (T0296)I379.CB only 0.000 apart, marking (T0296)I379.CB as missing WARNING: atoms too close: (T0296)A380.CA and (T0296)A380.CB only 0.000 apart, marking (T0296)A380.CB as missing WARNING: atoms too close: (T0296)D381.CA and (T0296)D381.CB only 0.000 apart, marking (T0296)D381.CB as missing WARNING: atoms too close: (T0296)E382.CA and (T0296)E382.CB only 0.000 apart, marking (T0296)E382.CB as missing WARNING: atoms too close: (T0296)A383.CA and (T0296)A383.CB only 0.000 apart, marking (T0296)A383.CB as missing WARNING: atoms too close: (T0296)A384.CA and (T0296)A384.CB only 0.000 apart, marking (T0296)A384.CB as missing WARNING: atoms too close: (T0296)V387.CA and (T0296)V387.CB only 0.000 apart, marking (T0296)V387.CB as missing WARNING: atoms too close: (T0296)I388.CA and (T0296)I388.CB only 0.000 apart, marking (T0296)I388.CB as missing WARNING: atoms too close: (T0296)N389.CA and (T0296)N389.CB only 0.000 apart, marking (T0296)N389.CB as missing WARNING: atoms too close: (T0296)M390.CA and (T0296)M390.CB only 0.000 apart, marking (T0296)M390.CB as missing WARNING: atoms too close: (T0296)K391.CA and (T0296)K391.CB only 0.000 apart, marking (T0296)K391.CB as missing WARNING: atoms too close: (T0296)T392.CA and (T0296)T392.CB only 0.000 apart, marking (T0296)T392.CB as missing WARNING: atoms too close: (T0296)A394.CA and (T0296)A394.CB only 0.000 apart, marking (T0296)A394.CB as missing WARNING: atoms too close: (T0296)V395.CA and (T0296)V395.CB only 0.000 apart, marking (T0296)V395.CB as missing WARNING: atoms too close: (T0296)I397.CA and (T0296)I397.CB only 0.000 apart, marking (T0296)I397.CB as missing WARNING: atoms too close: (T0296)I398.CA and (T0296)I398.CB only 0.000 apart, marking (T0296)I398.CB as missing WARNING: atoms too close: (T0296)P399.CA and (T0296)P399.CB only 0.000 apart, marking (T0296)P399.CB as missing WARNING: atoms too close: (T0296)K400.CA and (T0296)K400.CB only 0.000 apart, marking (T0296)K400.CB as missing WARNING: atoms too close: (T0296)K402.CA and (T0296)K402.CB only 0.000 apart, marking (T0296)K402.CB as missing WARNING: atoms too close: (T0296)E403.CA and (T0296)E403.CB only 0.000 apart, marking (T0296)E403.CB as missing WARNING: atoms too close: (T0296)D405.CA and (T0296)D405.CB only 0.000 apart, marking (T0296)D405.CB as missing WARNING: atoms too close: (T0296)M406.CA and (T0296)M406.CB only 0.000 apart, marking (T0296)M406.CB as missing WARNING: atoms too close: (T0296)I407.CA and (T0296)I407.CB only 0.000 apart, marking (T0296)I407.CB as missing WARNING: atoms too close: (T0296)E408.CA and (T0296)E408.CB only 0.000 apart, marking (T0296)E408.CB as missing WARNING: atoms too close: (T0296)L412.CA and (T0296)L412.CB only 0.000 apart, marking (T0296)L412.CB as missing WARNING: atoms too close: (T0296)T415.CA and (T0296)T415.CB only 0.000 apart, marking (T0296)T415.CB as missing WARNING: atoms too close: (T0296)A416.CA and (T0296)A416.CB only 0.000 apart, marking (T0296)A416.CB as missing WARNING: atoms too close: (T0296)P417.CA and (T0296)P417.CB only 0.000 apart, marking (T0296)P417.CB as missing WARNING: atoms too close: (T0296)M419.CA and (T0296)M419.CB only 0.000 apart, marking (T0296)M419.CB as missing WARNING: atoms too close: (T0296)K420.CA and (T0296)K420.CB only 0.000 apart, marking (T0296)K420.CB as missing WARNING: atoms too close: (T0296)V421.CA and (T0296)V421.CB only 0.000 apart, marking (T0296)V421.CB as missing WARNING: atoms too close: (T0296)N422.CA and (T0296)N422.CB only 0.000 apart, marking (T0296)N422.CB as missing WARNING: atoms too close: (T0296)A424.CA and (T0296)A424.CB only 0.000 apart, marking (T0296)A424.CB as missing WARNING: atoms too close: (T0296)S425.CA and (T0296)S425.CB only 0.000 apart, marking (T0296)S425.CB as missing WARNING: atoms too close: (T0296)S426.CA and (T0296)S426.CB only 0.000 apart, marking (T0296)S426.CB as missing WARNING: atoms too close: (T0296)V427.CA and (T0296)V427.CB only 0.000 apart, marking (T0296)V427.CB as missing WARNING: atoms too close: (T0296)D428.CA and (T0296)D428.CB only 0.000 apart, marking (T0296)D428.CB as missing WARNING: atoms too close: (T0296)F429.CA and (T0296)F429.CB only 0.000 apart, marking (T0296)F429.CB as missing WARNING: atoms too close: (T0296)I430.CA and (T0296)I430.CB only 0.000 apart, marking (T0296)I430.CB as missing WARNING: atoms too close: (T0296)S431.CA and (T0296)S431.CB only 0.000 apart, marking (T0296)S431.CB as missing WARNING: atoms too close: (T0296)R432.CA and (T0296)R432.CB only 0.000 apart, marking (T0296)R432.CB as missing WARNING: atoms too close: (T0296)Q435.CA and (T0296)Q435.CB only 0.000 apart, marking (T0296)Q435.CB as missing WARNING: atoms too close: (T0296)I436.CA and (T0296)I436.CB only 0.000 apart, marking (T0296)I436.CB as missing WARNING: atoms too close: (T0296)P437.CA and (T0296)P437.CB only 0.000 apart, marking (T0296)P437.CB as missing WARNING: atoms too close: (T0296)A438.CA and (T0296)A438.CB only 0.000 apart, marking (T0296)A438.CB as missing WARNING: atoms too close: (T0296)P439.CA and (T0296)P439.CB only 0.000 apart, marking (T0296)P439.CB as missing WARNING: atoms too close: (T0296)I440.CA and (T0296)I440.CB only 0.000 apart, marking (T0296)I440.CB as missing WARNING: atoms too close: (T0296)H441.CA and (T0296)H441.CB only 0.000 apart, marking (T0296)H441.CB as missing WARNING: atoms too close: (T0296)S442.CA and (T0296)S442.CB only 0.000 apart, marking (T0296)S442.CB as missing WARNING: atoms too close: (T0296)F443.CA and (T0296)F443.CB only 0.000 apart, marking (T0296)F443.CB as missing WARNING: atoms too close: (T0296)K444.CA and (T0296)K444.CB only 0.000 apart, marking (T0296)K444.CB as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)M1.CA and (T0296)M1.CB only 0.000 apart, marking (T0296)M1.CB as missing WARNING: atoms too close: (T0296)I3.CA and (T0296)I3.CB only 0.000 apart, marking (T0296)I3.CB as missing WARNING: atoms too close: (T0296)Q5.CA and (T0296)Q5.CB only 0.000 apart, marking (T0296)Q5.CB as missing WARNING: atoms too close: (T0296)I10.CA and (T0296)I10.CB only 0.000 apart, marking (T0296)I10.CB as missing WARNING: atoms too close: (T0296)A11.CA and (T0296)A11.CB only 0.000 apart, marking (T0296)A11.CB as missing WARNING: atoms too close: (T0296)M12.CA and (T0296)M12.CB only 0.000 apart, marking (T0296)M12.CB as missing WARNING: atoms too close: (T0296)I13.CA and (T0296)I13.CB only 0.000 apart, marking (T0296)I13.CB as missing WARNING: atoms too close: (T0296)E15.CA and (T0296)E15.CB only 0.000 apart, marking (T0296)E15.CB as missing WARNING: atoms too close: (T0296)N17.CA and (T0296)N17.CB only 0.000 apart, marking (T0296)N17.CB as missing WARNING: atoms too close: (T0296)F18.CA and (T0296)F18.CB only 0.000 apart, marking (T0296)F18.CB as missing WARNING: atoms too close: (T0296)D19.CA and (T0296)D19.CB only 0.000 apart, marking (T0296)D19.CB as missing WARNING: atoms too close: (T0296)I20.CA and (T0296)I20.CB only 0.000 apart, marking (T0296)I20.CB as missing WARNING: atoms too close: (T0296)T22.CA and (T0296)T22.CB only 0.000 apart, marking (T0296)T22.CB as missing WARNING: atoms too close: (T0296)I23.CA and (T0296)I23.CB only 0.000 apart, marking (T0296)I23.CB as missing WARNING: atoms too close: (T0296)I27.CA and (T0296)I27.CB only 0.000 apart, marking (T0296)I27.CB as missing WARNING: atoms too close: (T0296)D31.CA and (T0296)D31.CB only 0.000 apart, marking (T0296)D31.CB as missing WARNING: atoms too close: (T0296)D34.CA and (T0296)D34.CB only 0.000 apart, marking (T0296)D34.CB as missing WARNING: atoms too close: (T0296)D36.CA and (T0296)D36.CB only 0.000 apart, marking (T0296)D36.CB as missing WARNING: atoms too close: (T0296)A41.CA and (T0296)A41.CB only 0.000 apart, marking (T0296)A41.CB as missing WARNING: atoms too close: (T0296)E42.CA and (T0296)E42.CB only 0.000 apart, marking (T0296)E42.CB as missing WARNING: atoms too close: (T0296)Y45.CA and (T0296)Y45.CB only 0.000 apart, marking (T0296)Y45.CB as missing WARNING: atoms too close: (T0296)I48.CA and (T0296)I48.CB only 0.000 apart, marking (T0296)I48.CB as missing WARNING: atoms too close: (T0296)T50.CA and (T0296)T50.CB only 0.000 apart, marking (T0296)T50.CB as missing WARNING: atoms too close: (T0296)V58.CA and (T0296)V58.CB only 0.000 apart, marking (T0296)V58.CB as missing WARNING: atoms too close: (T0296)E61.CA and (T0296)E61.CB only 0.000 apart, marking (T0296)E61.CB as missing WARNING: atoms too close: (T0296)A63.CA and (T0296)A63.CB only 0.000 apart, marking (T0296)A63.CB as missing WARNING: atoms too close: (T0296)A64.CA and (T0296)A64.CB only 0.000 apart, marking (T0296)A64.CB as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)E65.CB only 0.000 apart, marking (T0296)E65.CB as missing WARNING: atoms too close: (T0296)L66.CA and (T0296)L66.CB only 0.000 apart, marking (T0296)L66.CB as missing WARNING: atoms too close: (T0296)N72.CA and (T0296)N72.CB only 0.000 apart, marking (T0296)N72.CB as missing WARNING: atoms too close: (T0296)V75.CA and (T0296)V75.CB only 0.000 apart, marking (T0296)V75.CB as missing WARNING: atoms too close: (T0296)A85.CA and (T0296)A85.CB only 0.000 apart, marking (T0296)A85.CB as missing WARNING: atoms too close: (T0296)A86.CA and (T0296)A86.CB only 0.000 apart, marking (T0296)A86.CB as missing WARNING: atoms too close: (T0296)Y92.CA and (T0296)Y92.CB only 0.000 apart, marking (T0296)Y92.CB as missing WARNING: atoms too close: (T0296)A96.CA and (T0296)A96.CB only 0.000 apart, marking (T0296)A96.CB as missing WARNING: atoms too close: (T0296)A98.CA and (T0296)A98.CB only 0.000 apart, marking (T0296)A98.CB as missing WARNING: atoms too close: (T0296)K101.CA and (T0296)K101.CB only 0.000 apart, marking (T0296)K101.CB as missing WARNING: atoms too close: (T0296)A103.CA and (T0296)A103.CB only 0.000 apart, marking (T0296)A103.CB as missing WARNING: atoms too close: (T0296)V108.CA and (T0296)V108.CB only 0.000 apart, marking (T0296)V108.CB as missing WARNING: atoms too close: (T0296)F110.CA and (T0296)F110.CB only 0.000 apart, marking (T0296)F110.CB as missing WARNING: atoms too close: (T0296)F114.CA and (T0296)F114.CB only 0.000 apart, marking (T0296)F114.CB as missing WARNING: atoms too close: (T0296)S115.CA and (T0296)S115.CB only 0.000 apart, marking (T0296)S115.CB as missing WARNING: atoms too close: (T0296)L117.CA and (T0296)L117.CB only 0.000 apart, marking (T0296)L117.CB as missing WARNING: atoms too close: (T0296)Q119.CA and (T0296)Q119.CB only 0.000 apart, marking (T0296)Q119.CB as missing WARNING: atoms too close: (T0296)K124.CA and (T0296)K124.CB only 0.000 apart, marking (T0296)K124.CB as missing WARNING: atoms too close: (T0296)D126.CA and (T0296)D126.CB only 0.000 apart, marking (T0296)D126.CB as missing WARNING: atoms too close: (T0296)N131.CA and (T0296)N131.CB only 0.000 apart, marking (T0296)N131.CB as missing WARNING: atoms too close: (T0296)S132.CA and (T0296)S132.CB only 0.000 apart, marking (T0296)S132.CB as missing WARNING: atoms too close: (T0296)I133.CA and (T0296)I133.CB only 0.000 apart, marking (T0296)I133.CB as missing WARNING: atoms too close: (T0296)R135.CA and (T0296)R135.CB only 0.000 apart, marking (T0296)R135.CB as missing WARNING: atoms too close: (T0296)A136.CA and (T0296)A136.CB only 0.000 apart, marking (T0296)A136.CB as missing WARNING: atoms too close: (T0296)A138.CA and (T0296)A138.CB only 0.000 apart, marking (T0296)A138.CB as missing WARNING: atoms too close: (T0296)V143.CA and (T0296)V143.CB only 0.000 apart, marking (T0296)V143.CB as missing WARNING: atoms too close: (T0296)S146.CA and (T0296)S146.CB only 0.000 apart, marking (T0296)S146.CB as missing WARNING: atoms too close: (T0296)V147.CA and (T0296)V147.CB only 0.000 apart, marking (T0296)V147.CB as missing WARNING: atoms too close: (T0296)S151.CA and (T0296)S151.CB only 0.000 apart, marking (T0296)S151.CB as missing WARNING: atoms too close: (T0296)K153.CA and (T0296)K153.CB only 0.000 apart, marking (T0296)K153.CB as missing WARNING: atoms too close: (T0296)S154.CA and (T0296)S154.CB only 0.000 apart, marking (T0296)S154.CB as missing WARNING: atoms too close: (T0296)I156.CA and (T0296)I156.CB only 0.000 apart, marking (T0296)I156.CB as missing WARNING: atoms too close: (T0296)N157.CA and (T0296)N157.CB only 0.000 apart, marking (T0296)N157.CB as missing WARNING: atoms too close: (T0296)A160.CA and (T0296)A160.CB only 0.000 apart, marking (T0296)A160.CB as missing WARNING: atoms too close: (T0296)V161.CA and (T0296)V161.CB only 0.000 apart, marking (T0296)V161.CB as missing WARNING: atoms too close: (T0296)D163.CA and (T0296)D163.CB only 0.000 apart, marking (T0296)D163.CB as missing WARNING: atoms too close: (T0296)M164.CA and (T0296)M164.CB only 0.000 apart, marking (T0296)M164.CB as missing WARNING: atoms too close: (T0296)I167.CA and (T0296)I167.CB only 0.000 apart, marking (T0296)I167.CB as missing WARNING: atoms too close: (T0296)I168.CA and (T0296)I168.CB only 0.000 apart, marking (T0296)I168.CB as missing WARNING: atoms too close: (T0296)A172.CA and (T0296)A172.CB only 0.000 apart, marking (T0296)A172.CB as missing WARNING: atoms too close: (T0296)N173.CA and (T0296)N173.CB only 0.000 apart, marking (T0296)N173.CB as missing WARNING: atoms too close: (T0296)L174.CA and (T0296)L174.CB only 0.000 apart, marking (T0296)L174.CB as missing WARNING: atoms too close: (T0296)D176.CA and (T0296)D176.CB only 0.000 apart, marking (T0296)D176.CB as missing WARNING: atoms too close: (T0296)K181.CA and (T0296)K181.CB only 0.000 apart, marking (T0296)K181.CB as missing WARNING: atoms too close: (T0296)V184.CA and (T0296)V184.CB only 0.000 apart, marking (T0296)V184.CB as missing WARNING: atoms too close: (T0296)F185.CA and (T0296)F185.CB only 0.000 apart, marking (T0296)F185.CB as missing WARNING: atoms too close: (T0296)A186.CA and (T0296)A186.CB only 0.000 apart, marking (T0296)A186.CB as missing WARNING: atoms too close: (T0296)V189.CA and (T0296)V189.CB only 0.000 apart, marking (T0296)V189.CB as missing WARNING: atoms too close: (T0296)P193.CA and (T0296)P193.CB only 0.000 apart, marking (T0296)P193.CB as missing WARNING: atoms too close: (T0296)F194.CA and (T0296)F194.CB only 0.000 apart, marking (T0296)F194.CB as missing WARNING: atoms too close: (T0296)M195.CA and (T0296)M195.CB only 0.000 apart, marking (T0296)M195.CB as missing WARNING: atoms too close: (T0296)H200.CA and (T0296)H200.CB only 0.000 apart, marking (T0296)H200.CB as missing WARNING: atoms too close: (T0296)V202.CA and (T0296)V202.CB only 0.000 apart, marking (T0296)V202.CB as missing WARNING: atoms too close: (T0296)D206.CA and (T0296)D206.CB only 0.000 apart, marking (T0296)D206.CB as missing WARNING: atoms too close: (T0296)V207.CA and (T0296)V207.CB only 0.000 apart, marking (T0296)V207.CB as missing WARNING: atoms too close: (T0296)N210.CA and (T0296)N210.CB only 0.000 apart, marking (T0296)N210.CB as missing WARNING: atoms too close: (T0296)V213.CA and (T0296)V213.CB only 0.000 apart, marking (T0296)V213.CB as missing WARNING: atoms too close: (T0296)S214.CA and (T0296)S214.CB only 0.000 apart, marking (T0296)S214.CB as missing WARNING: atoms too close: (T0296)V219.CA and (T0296)V219.CB only 0.000 apart, marking (T0296)V219.CB as missing WARNING: atoms too close: (T0296)F231.CA and (T0296)F231.CB only 0.000 apart, marking (T0296)F231.CB as missing WARNING: atoms too close: (T0296)E236.CA and (T0296)E236.CB only 0.000 apart, marking (T0296)E236.CB as missing WARNING: atoms too close: (T0296)T237.CA and (T0296)T237.CB only 0.000 apart, marking (T0296)T237.CB as missing WARNING: atoms too close: (T0296)V238.CA and (T0296)V238.CB only 0.000 apart, marking (T0296)V238.CB as missing WARNING: atoms too close: (T0296)T241.CA and (T0296)T241.CB only 0.000 apart, marking (T0296)T241.CB as missing WARNING: atoms too close: (T0296)F243.CA and (T0296)F243.CB only 0.000 apart, marking (T0296)F243.CB as missing WARNING: atoms too close: (T0296)K244.CA and (T0296)K244.CB only 0.000 apart, marking (T0296)K244.CB as missing WARNING: atoms too close: (T0296)I245.CA and (T0296)I245.CB only 0.000 apart, marking (T0296)I245.CB as missing WARNING: atoms too close: (T0296)T246.CA and (T0296)T246.CB only 0.000 apart, marking (T0296)T246.CB as missing WARNING: atoms too close: (T0296)R247.CA and (T0296)R247.CB only 0.000 apart, marking (T0296)R247.CB as missing WARNING: atoms too close: (T0296)Q250.CA and (T0296)Q250.CB only 0.000 apart, marking (T0296)Q250.CB as missing WARNING: atoms too close: (T0296)L251.CA and (T0296)L251.CB only 0.000 apart, marking (T0296)L251.CB as missing WARNING: atoms too close: (T0296)M255.CA and (T0296)M255.CB only 0.000 apart, marking (T0296)M255.CB as missing WARNING: atoms too close: (T0296)A256.CA and (T0296)A256.CB only 0.000 apart, marking (T0296)A256.CB as missing WARNING: atoms too close: (T0296)R259.CA and (T0296)R259.CB only 0.000 apart, marking (T0296)R259.CB as missing WARNING: atoms too close: (T0296)L260.CA and (T0296)L260.CB only 0.000 apart, marking (T0296)L260.CB as missing WARNING: atoms too close: (T0296)L269.CA and (T0296)L269.CB only 0.000 apart, marking (T0296)L269.CB as missing WARNING: atoms too close: (T0296)S270.CA and (T0296)S270.CB only 0.000 apart, marking (T0296)S270.CB as missing WARNING: atoms too close: (T0296)T274.CA and (T0296)T274.CB only 0.000 apart, marking (T0296)T274.CB as missing WARNING: atoms too close: (T0296)P275.CA and (T0296)P275.CB only 0.000 apart, marking (T0296)P275.CB as missing WARNING: atoms too close: (T0296)V277.CA and (T0296)V277.CB only 0.000 apart, marking (T0296)V277.CB as missing WARNING: atoms too close: (T0296)D279.CA and (T0296)D279.CB only 0.000 apart, marking (T0296)D279.CB as missing WARNING: atoms too close: (T0296)S280.CA and (T0296)S280.CB only 0.000 apart, marking (T0296)S280.CB as missing WARNING: atoms too close: (T0296)V281.CA and (T0296)V281.CB only 0.000 apart, marking (T0296)V281.CB as missing WARNING: atoms too close: (T0296)A282.CA and (T0296)A282.CB only 0.000 apart, marking (T0296)A282.CB as missing WARNING: atoms too close: (T0296)R283.CA and (T0296)R283.CB only 0.000 apart, marking (T0296)R283.CB as missing WARNING: atoms too close: (T0296)V284.CA and (T0296)V284.CB only 0.000 apart, marking (T0296)V284.CB as missing WARNING: atoms too close: (T0296)M288.CA and (T0296)M288.CB only 0.000 apart, marking (T0296)M288.CB as missing WARNING: atoms too close: (T0296)E291.CA and (T0296)E291.CB only 0.000 apart, marking (T0296)E291.CB as missing WARNING: atoms too close: (T0296)T292.CA and (T0296)T292.CB only 0.000 apart, marking (T0296)T292.CB as missing WARNING: atoms too close: (T0296)T298.CA and (T0296)T298.CB only 0.000 apart, marking (T0296)T298.CB as missing WARNING: atoms too close: (T0296)A301.CA and (T0296)A301.CB only 0.000 apart, marking (T0296)A301.CB as missing WARNING: atoms too close: (T0296)L304.CA and (T0296)L304.CB only 0.000 apart, marking (T0296)L304.CB as missing WARNING: atoms too close: (T0296)L305.CA and (T0296)L305.CB only 0.000 apart, marking (T0296)L305.CB as missing WARNING: atoms too close: (T0296)N306.CA and (T0296)N306.CB only 0.000 apart, marking (T0296)N306.CB as missing WARNING: atoms too close: (T0296)K310.CA and (T0296)K310.CB only 0.000 apart, marking (T0296)K310.CB as missing WARNING: atoms too close: (T0296)V314.CA and (T0296)V314.CB only 0.000 apart, marking (T0296)V314.CB as missing WARNING: atoms too close: (T0296)M315.CA and (T0296)M315.CB only 0.000 apart, marking (T0296)M315.CB as missing WARNING: atoms too close: (T0296)A316.CA and (T0296)A316.CB only 0.000 apart, marking (T0296)A316.CB as missing WARNING: atoms too close: (T0296)C317.CA and (T0296)C317.CB only 0.000 apart, marking (T0296)C317.CB as missing WARNING: atoms too close: (T0296)N318.CA and (T0296)N318.CB only 0.000 apart, marking (T0296)N318.CB as missing WARNING: atoms too close: (T0296)Q319.CA and (T0296)Q319.CB only 0.000 apart, marking (T0296)Q319.CB as missing WARNING: atoms too close: (T0296)S331.CA and (T0296)S331.CB only 0.000 apart, marking (T0296)S331.CB as missing WARNING: atoms too close: (T0296)D333.CA and (T0296)D333.CB only 0.000 apart, marking (T0296)D333.CB as missing WARNING: atoms too close: (T0296)A339.CA and (T0296)A339.CB only 0.000 apart, marking (T0296)A339.CB as missing WARNING: atoms too close: (T0296)V340.CA and (T0296)V340.CB only 0.000 apart, marking (T0296)V340.CB as missing WARNING: atoms too close: (T0296)Q341.CA and (T0296)Q341.CB only 0.000 apart, marking (T0296)Q341.CB as missing WARNING: atoms too close: (T0296)N342.CA and (T0296)N342.CB only 0.000 apart, marking (T0296)N342.CB as missing WARNING: atoms too close: (T0296)S344.CA and (T0296)S344.CB only 0.000 apart, marking (T0296)S344.CB as missing WARNING: atoms too close: (T0296)L345.CA and (T0296)L345.CB only 0.000 apart, marking (T0296)L345.CB as missing WARNING: atoms too close: (T0296)N346.CA and (T0296)N346.CB only 0.000 apart, marking (T0296)N346.CB as missing WARNING: atoms too close: (T0296)L347.CA and (T0296)L347.CB only 0.000 apart, marking (T0296)L347.CB as missing WARNING: atoms too close: (T0296)E348.CA and (T0296)E348.CB only 0.000 apart, marking (T0296)E348.CB as missing WARNING: atoms too close: (T0296)K349.CA and (T0296)K349.CB only 0.000 apart, marking (T0296)K349.CB as missing WARNING: atoms too close: (T0296)L350.CA and (T0296)L350.CB only 0.000 apart, marking (T0296)L350.CB as missing WARNING: atoms too close: (T0296)E351.CA and (T0296)E351.CB only 0.000 apart, marking (T0296)E351.CB as missing WARNING: atoms too close: (T0296)M353.CA and (T0296)M353.CB only 0.000 apart, marking (T0296)M353.CB as missing WARNING: atoms too close: (T0296)C357.CA and (T0296)C357.CB only 0.000 apart, marking (T0296)C357.CB as missing WARNING: atoms too close: (T0296)V359.CA and (T0296)V359.CB only 0.000 apart, marking (T0296)V359.CB as missing WARNING: atoms too close: (T0296)M363.CA and (T0296)M363.CB only 0.000 apart, marking (T0296)M363.CB as missing WARNING: atoms too close: (T0296)A365.CA and (T0296)A365.CB only 0.000 apart, marking (T0296)A365.CB as missing WARNING: atoms too close: (T0296)I366.CA and (T0296)I366.CB only 0.000 apart, marking (T0296)I366.CB as missing WARNING: atoms too close: (T0296)E368.CA and (T0296)E368.CB only 0.000 apart, marking (T0296)E368.CB as missing WARNING: atoms too close: (T0296)D369.CA and (T0296)D369.CB only 0.000 apart, marking (T0296)D369.CB as missing WARNING: atoms too close: (T0296)T370.CA and (T0296)T370.CB only 0.000 apart, marking (T0296)T370.CB as missing WARNING: atoms too close: (T0296)A372.CA and (T0296)A372.CB only 0.000 apart, marking (T0296)A372.CB as missing WARNING: atoms too close: (T0296)E373.CA and (T0296)E373.CB only 0.000 apart, marking (T0296)E373.CB as missing WARNING: atoms too close: (T0296)T374.CA and (T0296)T374.CB only 0.000 apart, marking (T0296)T374.CB as missing WARNING: atoms too close: (T0296)I375.CA and (T0296)I375.CB only 0.000 apart, marking (T0296)I375.CB as missing WARNING: atoms too close: (T0296)A377.CA and (T0296)A377.CB only 0.000 apart, marking (T0296)A377.CB as missing WARNING: atoms too close: (T0296)D381.CA and (T0296)D381.CB only 0.000 apart, marking (T0296)D381.CB as missing WARNING: atoms too close: (T0296)E382.CA and (T0296)E382.CB only 0.000 apart, marking (T0296)E382.CB as missing WARNING: atoms too close: (T0296)A383.CA and (T0296)A383.CB only 0.000 apart, marking (T0296)A383.CB as missing WARNING: atoms too close: (T0296)A384.CA and (T0296)A384.CB only 0.000 apart, marking (T0296)A384.CB as missing WARNING: atoms too close: (T0296)I388.CA and (T0296)I388.CB only 0.000 apart, marking (T0296)I388.CB as missing WARNING: atoms too close: (T0296)N389.CA and (T0296)N389.CB only 0.000 apart, marking (T0296)N389.CB as missing WARNING: atoms too close: (T0296)M390.CA and (T0296)M390.CB only 0.000 apart, marking (T0296)M390.CB as missing WARNING: atoms too close: (T0296)K391.CA and (T0296)K391.CB only 0.000 apart, marking (T0296)K391.CB as missing WARNING: atoms too close: (T0296)T392.CA and (T0296)T392.CB only 0.000 apart, marking (T0296)T392.CB as missing WARNING: atoms too close: (T0296)A394.CA and (T0296)A394.CB only 0.000 apart, marking (T0296)A394.CB as missing WARNING: atoms too close: (T0296)V395.CA and (T0296)V395.CB only 0.000 apart, marking (T0296)V395.CB as missing WARNING: atoms too close: (T0296)I397.CA and (T0296)I397.CB only 0.000 apart, marking (T0296)I397.CB as missing WARNING: atoms too close: (T0296)K402.CA and (T0296)K402.CB only 0.000 apart, marking (T0296)K402.CB as missing WARNING: atoms too close: (T0296)E403.CA and (T0296)E403.CB only 0.000 apart, marking (T0296)E403.CB as missing WARNING: atoms too close: (T0296)D405.CA and (T0296)D405.CB only 0.000 apart, marking (T0296)D405.CB as missing WARNING: atoms too close: (T0296)M406.CA and (T0296)M406.CB only 0.000 apart, marking (T0296)M406.CB as missing WARNING: atoms too close: (T0296)E408.CA and (T0296)E408.CB only 0.000 apart, marking (T0296)E408.CB as missing WARNING: atoms too close: (T0296)T415.CA and (T0296)T415.CB only 0.000 apart, marking (T0296)T415.CB as missing WARNING: atoms too close: (T0296)V418.CA and (T0296)V418.CB only 0.000 apart, marking (T0296)V418.CB as missing WARNING: atoms too close: (T0296)M419.CA and (T0296)M419.CB only 0.000 apart, marking (T0296)M419.CB as missing WARNING: atoms too close: (T0296)A424.CA and (T0296)A424.CB only 0.000 apart, marking (T0296)A424.CB as missing WARNING: atoms too close: (T0296)S425.CA and (T0296)S425.CB only 0.000 apart, marking (T0296)S425.CB as missing WARNING: atoms too close: (T0296)S426.CA and (T0296)S426.CB only 0.000 apart, marking (T0296)S426.CB as missing WARNING: atoms too close: (T0296)V427.CA and (T0296)V427.CB only 0.000 apart, marking (T0296)V427.CB as missing WARNING: atoms too close: (T0296)S431.CA and (T0296)S431.CB only 0.000 apart, marking (T0296)S431.CB as missing WARNING: atoms too close: (T0296)Q435.CA and (T0296)Q435.CB only 0.000 apart, marking (T0296)Q435.CB as missing WARNING: atoms too close: (T0296)P437.CA and (T0296)P437.CB only 0.000 apart, marking (T0296)P437.CB as missing WARNING: atoms too close: (T0296)A438.CA and (T0296)A438.CB only 0.000 apart, marking (T0296)A438.CB as missing WARNING: atoms too close: (T0296)I440.CA and (T0296)I440.CB only 0.000 apart, marking (T0296)I440.CB as missing WARNING: atoms too close: (T0296)K444.CA and (T0296)K444.CB only 0.000 apart, marking (T0296)K444.CB as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)D2.CA and (T0296)D2.CB only 0.000 apart, marking (T0296)D2.CB as missing WARNING: atoms too close: (T0296)Q5.CA and (T0296)Q5.CB only 0.000 apart, marking (T0296)Q5.CB as missing WARNING: atoms too close: (T0296)I13.CA and (T0296)I13.CB only 0.000 apart, marking (T0296)I13.CB as missing WARNING: atoms too close: (T0296)T22.CA and (T0296)T22.CB only 0.000 apart, marking (T0296)T22.CB as missing WARNING: atoms too close: (T0296)L30.CA and (T0296)L30.CB only 0.000 apart, marking (T0296)L30.CB as missing WARNING: atoms too close: (T0296)E42.CA and (T0296)E42.CB only 0.000 apart, marking (T0296)E42.CB as missing WARNING: atoms too close: (T0296)Y45.CA and (T0296)Y45.CB only 0.000 apart, marking (T0296)Y45.CB as missing WARNING: atoms too close: (T0296)K47.CA and (T0296)K47.CB only 0.000 apart, marking (T0296)K47.CB as missing WARNING: atoms too close: (T0296)T50.CA and (T0296)T50.CB only 0.000 apart, marking (T0296)T50.CB as missing WARNING: atoms too close: (T0296)V56.CA and (T0296)V56.CB only 0.000 apart, marking (T0296)V56.CB as missing WARNING: atoms too close: (T0296)P79.CA and (T0296)P79.CB only 0.000 apart, marking (T0296)P79.CB as missing WARNING: atoms too close: (T0296)D100.CA and (T0296)D100.CB only 0.000 apart, marking (T0296)D100.CB as missing WARNING: atoms too close: (T0296)K101.CA and (T0296)K101.CB only 0.000 apart, marking (T0296)K101.CB as missing WARNING: atoms too close: (T0296)K104.CA and (T0296)K104.CB only 0.000 apart, marking (T0296)K104.CB as missing WARNING: atoms too close: (T0296)I111.CA and (T0296)I111.CB only 0.000 apart, marking (T0296)I111.CB as missing WARNING: atoms too close: (T0296)S115.CA and (T0296)S115.CB only 0.000 apart, marking (T0296)S115.CB as missing WARNING: atoms too close: (T0296)Y122.CA and (T0296)Y122.CB only 0.000 apart, marking (T0296)Y122.CB as missing WARNING: atoms too close: (T0296)K124.CA and (T0296)K124.CB only 0.000 apart, marking (T0296)K124.CB as missing WARNING: atoms too close: (T0296)S146.CA and (T0296)S146.CB only 0.000 apart, marking (T0296)S146.CB as missing WARNING: atoms too close: (T0296)V147.CA and (T0296)V147.CB only 0.000 apart, marking (T0296)V147.CB as missing WARNING: atoms too close: (T0296)I156.CA and (T0296)I156.CB only 0.000 apart, marking (T0296)I156.CB as missing WARNING: atoms too close: (T0296)M158.CA and (T0296)M158.CB only 0.000 apart, marking (T0296)M158.CB as missing WARNING: atoms too close: (T0296)V161.CA and (T0296)V161.CB only 0.000 apart, marking (T0296)V161.CB as missing WARNING: atoms too close: (T0296)E170.CA and (T0296)E170.CB only 0.000 apart, marking (T0296)E170.CB as missing WARNING: atoms too close: (T0296)S175.CA and (T0296)S175.CB only 0.000 apart, marking (T0296)S175.CB as missing WARNING: atoms too close: (T0296)M177.CA and (T0296)M177.CB only 0.000 apart, marking (T0296)M177.CB as missing WARNING: atoms too close: (T0296)E190.CA and (T0296)E190.CB only 0.000 apart, marking (T0296)E190.CB as missing WARNING: atoms too close: (T0296)F194.CA and (T0296)F194.CB only 0.000 apart, marking (T0296)F194.CB as missing WARNING: atoms too close: (T0296)F199.CA and (T0296)F199.CB only 0.000 apart, marking (T0296)F199.CB as missing WARNING: atoms too close: (T0296)H200.CA and (T0296)H200.CB only 0.000 apart, marking (T0296)H200.CB as missing WARNING: atoms too close: (T0296)N210.CA and (T0296)N210.CB only 0.000 apart, marking (T0296)N210.CB as missing WARNING: atoms too close: (T0296)V213.CA and (T0296)V213.CB only 0.000 apart, marking (T0296)V213.CB as missing WARNING: atoms too close: (T0296)K220.CA and (T0296)K220.CB only 0.000 apart, marking (T0296)K220.CB as missing WARNING: atoms too close: (T0296)K225.CA and (T0296)K225.CB only 0.000 apart, marking (T0296)K225.CB as missing WARNING: atoms too close: (T0296)T237.CA and (T0296)T237.CB only 0.000 apart, marking (T0296)T237.CB as missing WARNING: atoms too close: (T0296)V238.CA and (T0296)V238.CB only 0.000 apart, marking (T0296)V238.CB as missing WARNING: atoms too close: (T0296)A242.CA and (T0296)A242.CB only 0.000 apart, marking (T0296)A242.CB as missing WARNING: atoms too close: (T0296)F243.CA and (T0296)F243.CB only 0.000 apart, marking (T0296)F243.CB as missing WARNING: atoms too close: (T0296)I245.CA and (T0296)I245.CB only 0.000 apart, marking (T0296)I245.CB as missing WARNING: atoms too close: (T0296)L251.CA and (T0296)L251.CB only 0.000 apart, marking (T0296)L251.CB as missing WARNING: atoms too close: (T0296)V252.CA and (T0296)V252.CB only 0.000 apart, marking (T0296)V252.CB as missing WARNING: atoms too close: (T0296)M255.CA and (T0296)M255.CB only 0.000 apart, marking (T0296)M255.CB as missing WARNING: atoms too close: (T0296)A256.CA and (T0296)A256.CB only 0.000 apart, marking (T0296)A256.CB as missing WARNING: atoms too close: (T0296)I266.CA and (T0296)I266.CB only 0.000 apart, marking (T0296)I266.CB as missing WARNING: atoms too close: (T0296)A272.CA and (T0296)A272.CB only 0.000 apart, marking (T0296)A272.CB as missing WARNING: atoms too close: (T0296)R283.CA and (T0296)R283.CB only 0.000 apart, marking (T0296)R283.CB as missing WARNING: atoms too close: (T0296)M288.CA and (T0296)M288.CB only 0.000 apart, marking (T0296)M288.CB as missing WARNING: atoms too close: (T0296)L305.CA and (T0296)L305.CB only 0.000 apart, marking (T0296)L305.CB as missing WARNING: atoms too close: (T0296)A316.CA and (T0296)A316.CB only 0.000 apart, marking (T0296)A316.CB as missing WARNING: atoms too close: (T0296)V330.CA and (T0296)V330.CB only 0.000 apart, marking (T0296)V330.CB as missing WARNING: atoms too close: (T0296)E334.CA and (T0296)E334.CB only 0.000 apart, marking (T0296)E334.CB as missing WARNING: atoms too close: (T0296)Q341.CA and (T0296)Q341.CB only 0.000 apart, marking (T0296)Q341.CB as missing WARNING: atoms too close: (T0296)E348.CA and (T0296)E348.CB only 0.000 apart, marking (T0296)E348.CB as missing WARNING: atoms too close: (T0296)K349.CA and (T0296)K349.CB only 0.000 apart, marking (T0296)K349.CB as missing WARNING: atoms too close: (T0296)A352.CA and (T0296)A352.CB only 0.000 apart, marking (T0296)A352.CB as missing WARNING: atoms too close: (T0296)M353.CA and (T0296)M353.CB only 0.000 apart, marking (T0296)M353.CB as missing WARNING: atoms too close: (T0296)T354.CA and (T0296)T354.CB only 0.000 apart, marking (T0296)T354.CB as missing WARNING: atoms too close: (T0296)V359.CA and (T0296)V359.CB only 0.000 apart, marking (T0296)V359.CB as missing WARNING: atoms too close: (T0296)I366.CA and (T0296)I366.CB only 0.000 apart, marking (T0296)I366.CB as missing WARNING: atoms too close: (T0296)T370.CA and (T0296)T370.CB only 0.000 apart, marking (T0296)T370.CB as missing WARNING: atoms too close: (T0296)A372.CA and (T0296)A372.CB only 0.000 apart, marking (T0296)A372.CB as missing WARNING: atoms too close: (T0296)A377.CA and (T0296)A377.CB only 0.000 apart, marking (T0296)A377.CB as missing WARNING: atoms too close: (T0296)D405.CA and (T0296)D405.CB only 0.000 apart, marking (T0296)D405.CB as missing WARNING: atoms too close: (T0296)L412.CA and (T0296)L412.CB only 0.000 apart, marking (T0296)L412.CB as missing WARNING: atoms too close: (T0296)M419.CA and (T0296)M419.CB only 0.000 apart, marking (T0296)M419.CB as missing WARNING: atoms too close: (T0296)A424.CA and (T0296)A424.CB only 0.000 apart, marking (T0296)A424.CB as missing WARNING: atoms too close: (T0296)S426.CA and (T0296)S426.CB only 0.000 apart, marking (T0296)S426.CB as missing WARNING: atoms too close: (T0296)V427.CA and (T0296)V427.CB only 0.000 apart, marking (T0296)V427.CB as missing WARNING: atoms too close: (T0296)S431.CA and (T0296)S431.CB only 0.000 apart, marking (T0296)S431.CB as missing WARNING: atoms too close: (T0296)I440.CA and (T0296)I440.CB only 0.000 apart, marking (T0296)I440.CB as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)T9.CA and (T0296)T9.CB only 0.000 apart, marking (T0296)T9.CB as missing WARNING: atoms too close: (T0296)I10.CA and (T0296)I10.CB only 0.000 apart, marking (T0296)I10.CB as missing WARNING: atoms too close: (T0296)Q16.CA and (T0296)Q16.CB only 0.000 apart, marking (T0296)Q16.CB as missing WARNING: atoms too close: (T0296)T22.CA and (T0296)T22.CB only 0.000 apart, marking (T0296)T22.CB as missing WARNING: atoms too close: (T0296)L30.CA and (T0296)L30.CB only 0.000 apart, marking (T0296)L30.CB as missing WARNING: atoms too close: (T0296)A41.CA and (T0296)A41.CB only 0.000 apart, marking (T0296)A41.CB as missing WARNING: atoms too close: (T0296)K43.CA and (T0296)K43.CB only 0.000 apart, marking (T0296)K43.CB as missing WARNING: atoms too close: (T0296)Q46.CA and (T0296)Q46.CB only 0.000 apart, marking (T0296)Q46.CB as missing WARNING: atoms too close: (T0296)K47.CA and (T0296)K47.CB only 0.000 apart, marking (T0296)K47.CB as missing WARNING: atoms too close: (T0296)T50.CA and (T0296)T50.CB only 0.000 apart, marking (T0296)T50.CB as missing WARNING: atoms too close: (T0296)N54.CA and (T0296)N54.CB only 0.000 apart, marking (T0296)N54.CB as missing WARNING: atoms too close: (T0296)V56.CA and (T0296)V56.CB only 0.000 apart, marking (T0296)V56.CB as missing WARNING: atoms too close: (T0296)I62.CA and (T0296)I62.CB only 0.000 apart, marking (T0296)I62.CB as missing WARNING: atoms too close: (T0296)R74.CA and (T0296)R74.CB only 0.000 apart, marking (T0296)R74.CB as missing WARNING: atoms too close: (T0296)V77.CA and (T0296)V77.CB only 0.000 apart, marking (T0296)V77.CB as missing WARNING: atoms too close: (T0296)A85.CA and (T0296)A85.CB only 0.000 apart, marking (T0296)A85.CB as missing WARNING: atoms too close: (T0296)Y92.CA and (T0296)Y92.CB only 0.000 apart, marking (T0296)Y92.CB as missing WARNING: atoms too close: (T0296)K97.CA and (T0296)K97.CB only 0.000 apart, marking (T0296)K97.CB as missing WARNING: atoms too close: (T0296)L99.CA and (T0296)L99.CB only 0.000 apart, marking (T0296)L99.CB as missing WARNING: atoms too close: (T0296)S115.CA and (T0296)S115.CB only 0.000 apart, marking (T0296)S115.CB as missing WARNING: atoms too close: (T0296)N131.CA and (T0296)N131.CB only 0.000 apart, marking (T0296)N131.CB as missing WARNING: atoms too close: (T0296)V143.CA and (T0296)V143.CB only 0.000 apart, marking (T0296)V143.CB as missing WARNING: atoms too close: (T0296)V147.CA and (T0296)V147.CB only 0.000 apart, marking (T0296)V147.CB as missing WARNING: atoms too close: (T0296)I156.CA and (T0296)I156.CB only 0.000 apart, marking (T0296)I156.CB as missing WARNING: atoms too close: (T0296)N157.CA and (T0296)N157.CB only 0.000 apart, marking (T0296)N157.CB as missing WARNING: atoms too close: (T0296)A160.CA and (T0296)A160.CB only 0.000 apart, marking (T0296)A160.CB as missing WARNING: atoms too close: (T0296)I168.CA and (T0296)I168.CB only 0.000 apart, marking (T0296)I168.CB as missing WARNING: atoms too close: (T0296)A186.CA and (T0296)A186.CB only 0.000 apart, marking (T0296)A186.CB as missing WARNING: atoms too close: (T0296)A188.CA and (T0296)A188.CB only 0.000 apart, marking (T0296)A188.CB as missing WARNING: atoms too close: (T0296)V189.CA and (T0296)V189.CB only 0.000 apart, marking (T0296)V189.CB as missing WARNING: atoms too close: (T0296)E190.CA and (T0296)E190.CB only 0.000 apart, marking (T0296)E190.CB as missing WARNING: atoms too close: (T0296)A198.CA and (T0296)A198.CB only 0.000 apart, marking (T0296)A198.CB as missing WARNING: atoms too close: (T0296)F199.CA and (T0296)F199.CB only 0.000 apart, marking (T0296)F199.CB as missing WARNING: atoms too close: (T0296)N210.CA and (T0296)N210.CB only 0.000 apart, marking (T0296)N210.CB as missing WARNING: atoms too close: (T0296)V211.CA and (T0296)V211.CB only 0.000 apart, marking (T0296)V211.CB as missing WARNING: atoms too close: (T0296)V213.CA and (T0296)V213.CB only 0.000 apart, marking (T0296)V213.CB as missing WARNING: atoms too close: (T0296)V233.CA and (T0296)V233.CB only 0.000 apart, marking (T0296)V233.CB as missing WARNING: atoms too close: (T0296)E236.CA and (T0296)E236.CB only 0.000 apart, marking (T0296)E236.CB as missing WARNING: atoms too close: (T0296)T237.CA and (T0296)T237.CB only 0.000 apart, marking (T0296)T237.CB as missing WARNING: atoms too close: (T0296)A242.CA and (T0296)A242.CB only 0.000 apart, marking (T0296)A242.CB as missing WARNING: atoms too close: (T0296)F243.CA and (T0296)F243.CB only 0.000 apart, marking (T0296)F243.CB as missing WARNING: atoms too close: (T0296)I245.CA and (T0296)I245.CB only 0.000 apart, marking (T0296)I245.CB as missing WARNING: atoms too close: (T0296)V252.CA and (T0296)V252.CB only 0.000 apart, marking (T0296)V252.CB as missing WARNING: atoms too close: (T0296)A256.CA and (T0296)A256.CB only 0.000 apart, marking (T0296)A256.CB as missing WARNING: atoms too close: (T0296)R283.CA and (T0296)R283.CB only 0.000 apart, marking (T0296)R283.CB as missing WARNING: atoms too close: (T0296)L302.CA and (T0296)L302.CB only 0.000 apart, marking (T0296)L302.CB as missing WARNING: atoms too close: (T0296)N318.CA and (T0296)N318.CB only 0.000 apart, marking (T0296)N318.CB as missing WARNING: atoms too close: (T0296)Q319.CA and (T0296)Q319.CB only 0.000 apart, marking (T0296)Q319.CB as missing WARNING: atoms too close: (T0296)I328.CA and (T0296)I328.CB only 0.000 apart, marking (T0296)I328.CB as missing WARNING: atoms too close: (T0296)V330.CA and (T0296)V330.CB only 0.000 apart, marking (T0296)V330.CB as missing WARNING: atoms too close: (T0296)D333.CA and (T0296)D333.CB only 0.000 apart, marking (T0296)D333.CB as missing WARNING: atoms too close: (T0296)M336.CA and (T0296)M336.CB only 0.000 apart, marking (T0296)M336.CB as missing WARNING: atoms too close: (T0296)I337.CA and (T0296)I337.CB only 0.000 apart, marking (T0296)I337.CB as missing WARNING: atoms too close: (T0296)A339.CA and (T0296)A339.CB only 0.000 apart, marking (T0296)A339.CB as missing WARNING: atoms too close: (T0296)L345.CA and (T0296)L345.CB only 0.000 apart, marking (T0296)L345.CB as missing WARNING: atoms too close: (T0296)N346.CA and (T0296)N346.CB only 0.000 apart, marking (T0296)N346.CB as missing WARNING: atoms too close: (T0296)K349.CA and (T0296)K349.CB only 0.000 apart, marking (T0296)K349.CB as missing WARNING: atoms too close: (T0296)E351.CA and (T0296)E351.CB only 0.000 apart, marking (T0296)E351.CB as missing WARNING: atoms too close: (T0296)C357.CA and (T0296)C357.CB only 0.000 apart, marking (T0296)C357.CB as missing WARNING: atoms too close: (T0296)V359.CA and (T0296)V359.CB only 0.000 apart, marking (T0296)V359.CB as missing WARNING: atoms too close: (T0296)M363.CA and (T0296)M363.CB only 0.000 apart, marking (T0296)M363.CB as missing WARNING: atoms too close: (T0296)I366.CA and (T0296)I366.CB only 0.000 apart, marking (T0296)I366.CB as missing WARNING: atoms too close: (T0296)T370.CA and (T0296)T370.CB only 0.000 apart, marking (T0296)T370.CB as missing WARNING: atoms too close: (T0296)E382.CA and (T0296)E382.CB only 0.000 apart, marking (T0296)E382.CB as missing WARNING: atoms too close: (T0296)R396.CA and (T0296)R396.CB only 0.000 apart, marking (T0296)R396.CB as missing WARNING: atoms too close: (T0296)D405.CA and (T0296)D405.CB only 0.000 apart, marking (T0296)D405.CB as missing WARNING: atoms too close: (T0296)A424.CA and (T0296)A424.CB only 0.000 apart, marking (T0296)A424.CB as missing WARNING: atoms too close: (T0296)S426.CA and (T0296)S426.CB only 0.000 apart, marking (T0296)S426.CB as missing WARNING: atoms too close: (T0296)K444.CA and (T0296)K444.CB only 0.000 apart, marking (T0296)K444.CB as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM-T99_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL2 # ReadConformPDB reading from PDB file servers/SAM-T99_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL3 # ReadConformPDB reading from PDB file servers/SAM-T99_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL4 # ReadConformPDB reading from PDB file servers/SAM-T99_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL5 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 440 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 418 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # Found a chain break before 398 # copying to AlignedFragments data structure # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 429 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 192 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 440 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # Found a chain break before 439 # copying to AlignedFragments data structure # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 432 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 414 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 429 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 349 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 353 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 410 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 370 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 333 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 439 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)G59.CA and (T0296)L66.CA only 0.000 apart, marking (T0296)L66.CA as missing WARNING: atoms too close: (T0296)D60.CA and (T0296)G67.CA only 0.000 apart, marking (T0296)D60.CA as missing WARNING: atoms too close: (T0296)I62.CA and (T0296)I68.CA only 0.000 apart, marking (T0296)I68.CA as missing WARNING: atoms too close: (T0296)A63.N and (T0296)P69.N only 0.000 apart, marking (T0296)P69.N as missing WARNING: atoms too close: (T0296)A63.CA and (T0296)P69.CA only 0.000 apart, marking (T0296)P69.CA as missing WARNING: atoms too close: (T0296)A63.CB and (T0296)P69.CB only 0.000 apart, marking (T0296)P69.CB as missing WARNING: atoms too close: (T0296)A63.C and (T0296)P69.C only 0.000 apart, marking (T0296)P69.C as missing WARNING: atoms too close: (T0296)A64.CA and (T0296)I70.CA only 0.000 apart, marking (T0296)I70.CA as missing WARNING: atoms too close: (T0296)E65.CA and (T0296)V71.CA only 0.000 apart, marking (T0296)V71.CA as missing WARNING: atoms too close: (T0296)G113.CA and (T0296)K124.CA only 0.000 apart, marking (T0296)K124.CA as missing WARNING: atoms too close: (T0296)F114.N and (T0296)G125.N only 0.000 apart, marking (T0296)F114.N as missing WARNING: atoms too close: (T0296)F114.CA and (T0296)G125.CA only 0.000 apart, marking (T0296)F114.CA as missing WARNING: atoms too close: (T0296)F114.O and (T0296)G125.O only 0.000 apart, marking (T0296)F114.O as missing WARNING: atoms too close: (T0296)F114.C and (T0296)G125.C only 0.000 apart, marking (T0296)F114.C as missing WARNING: atoms too close: (T0296)S115.N and (T0296)D126.N only 0.000 apart, marking (T0296)D126.N as missing WARNING: atoms too close: (T0296)S115.CA and (T0296)D126.CA only 0.000 apart, marking (T0296)D126.CA as missing WARNING: atoms too close: (T0296)S115.CB and (T0296)D126.CB only 0.000 apart, marking (T0296)D126.CB as missing WARNING: atoms too close: (T0296)S115.O and (T0296)D126.O only 0.000 apart, marking (T0296)D126.O as missing WARNING: atoms too close: (T0296)S115.C and (T0296)D126.C only 0.000 apart, marking (T0296)D126.C as missing WARNING: atoms too close: (T0296)A116.N and (T0296)E127.N only 0.000 apart, marking (T0296)E127.N as missing WARNING: atoms too close: (T0296)A116.CA and (T0296)E127.CA only 0.000 apart, marking (T0296)E127.CA as missing WARNING: atoms too close: (T0296)A116.CB and (T0296)E127.CB only 0.000 apart, marking (T0296)E127.CB as missing WARNING: atoms too close: (T0296)A116.O and (T0296)E127.O only 0.000 apart, marking (T0296)E127.O as missing WARNING: atoms too close: (T0296)A116.C and (T0296)E127.C only 0.000 apart, marking (T0296)E127.C as missing WARNING: atoms too close: (T0296)L117.N and (T0296)I128.N only 0.000 apart, marking (T0296)I128.N as missing WARNING: atoms too close: (T0296)L117.CA and (T0296)I128.CA only 0.000 apart, marking (T0296)I128.CA as missing WARNING: atoms too close: (T0296)L117.CB and (T0296)I128.CB only 0.000 apart, marking (T0296)I128.CB as missing WARNING: atoms too close: (T0296)L117.O and (T0296)I128.O only 0.000 apart, marking (T0296)I128.O as missing WARNING: atoms too close: (T0296)L117.C and (T0296)I128.C only 0.000 apart, marking (T0296)I128.C as missing WARNING: atoms too close: (T0296)V118.N and (T0296)L129.N only 0.000 apart, marking (T0296)L129.N as missing WARNING: atoms too close: (T0296)V118.CA and (T0296)L129.CA only 0.000 apart, marking (T0296)L129.CA as missing WARNING: atoms too close: (T0296)V118.CB and (T0296)L129.CB only 0.000 apart, marking (T0296)L129.CB as missing WARNING: atoms too close: (T0296)V118.O and (T0296)L129.O only 0.000 apart, marking (T0296)L129.O as missing WARNING: atoms too close: (T0296)V118.C and (T0296)L129.C only 0.000 apart, marking (T0296)L129.C as missing WARNING: atoms too close: (T0296)Q119.N and (T0296)I130.N only 0.000 apart, marking (T0296)I130.N as missing WARNING: atoms too close: (T0296)Q119.CA and (T0296)I130.CA only 0.000 apart, marking (T0296)I130.CA as missing WARNING: atoms too close: (T0296)Q119.CB and (T0296)I130.CB only 0.000 apart, marking (T0296)I130.CB as missing WARNING: atoms too close: (T0296)Q119.C and (T0296)I130.C only 0.000 apart, marking (T0296)I130.C as missing WARNING: atoms too close: (T0296)K120.CA and (T0296)N131.CA only 0.000 apart, marking (T0296)N131.CA as missing WARNING: atoms too close: (T0296)G121.CA and (T0296)S132.CA only 0.000 apart, marking (T0296)S132.CA as missing WARNING: atoms too close: (T0296)D232.CA and (T0296)P275.CA only 0.000 apart, marking (T0296)P275.CA as missing WARNING: atoms too close: (T0296)V233.CA and (T0296)A276.CA only 0.000 apart, marking (T0296)V233.CA as missing WARNING: atoms too close: (T0296)V234.CA and (T0296)V277.CA only 0.000 apart, marking (T0296)V277.CA as missing WARNING: atoms too close: (T0296)I245.CA and (T0296)M288.CA only 0.000 apart, marking (T0296)M288.CA as missing WARNING: atoms too close: (T0296)T246.N and (T0296)G289.N only 0.000 apart, marking (T0296)T246.N as missing WARNING: atoms too close: (T0296)T246.CA and (T0296)G289.CA only 0.000 apart, marking (T0296)T246.CA as missing WARNING: atoms too close: (T0296)T246.O and (T0296)G289.O only 0.000 apart, marking (T0296)T246.O as missing WARNING: atoms too close: (T0296)T246.C and (T0296)G289.C only 0.000 apart, marking (T0296)T246.C as missing WARNING: atoms too close: (T0296)R247.N and (T0296)L290.N only 0.000 apart, marking (T0296)L290.N as missing WARNING: atoms too close: (T0296)R247.CA and (T0296)L290.CA only 0.000 apart, marking (T0296)L290.CA as missing WARNING: atoms too close: (T0296)R247.CB and (T0296)L290.CB only 0.000 apart, marking (T0296)L290.CB as missing WARNING: atoms too close: (T0296)R247.O and (T0296)L290.O only 0.000 apart, marking (T0296)L290.O as missing WARNING: atoms too close: (T0296)R247.C and (T0296)L290.C only 0.000 apart, marking (T0296)L290.C as missing WARNING: atoms too close: (T0296)I248.N and (T0296)E291.N only 0.000 apart, marking (T0296)E291.N as missing WARNING: atoms too close: (T0296)I248.CA and (T0296)E291.CA only 0.000 apart, marking (T0296)E291.CA as missing WARNING: atoms too close: (T0296)I248.CB and (T0296)E291.CB only 0.000 apart, marking (T0296)E291.CB as missing WARNING: atoms too close: (T0296)I248.O and (T0296)E291.O only 0.000 apart, marking (T0296)E291.O as missing WARNING: atoms too close: (T0296)I248.C and (T0296)E291.C only 0.000 apart, marking (T0296)E291.C as missing WARNING: atoms too close: (T0296)G249.N and (T0296)H296.N only 0.000 apart, marking (T0296)H296.N as missing WARNING: atoms too close: (T0296)G249.CA and (T0296)H296.CA only 0.000 apart, marking (T0296)H296.CA as missing WARNING: atoms too close: (T0296)G249.O and (T0296)H296.O only 0.000 apart, marking (T0296)H296.O as missing WARNING: atoms too close: (T0296)G249.C and (T0296)H296.C only 0.000 apart, marking (T0296)H296.C as missing WARNING: atoms too close: (T0296)Q250.N and (T0296)G297.N only 0.000 apart, marking (T0296)Q250.N as missing WARNING: atoms too close: (T0296)Q250.CA and (T0296)G297.CA only 0.000 apart, marking (T0296)Q250.CA as missing WARNING: atoms too close: (T0296)Q250.C and (T0296)G297.C only 0.000 apart, marking (T0296)Q250.C as missing WARNING: atoms too close: (T0296)L251.CA and (T0296)T298.CA only 0.000 apart, marking (T0296)T298.CA as missing WARNING: atoms too close: (T0296)V252.CA and (T0296)T299.CA only 0.000 apart, marking (T0296)T299.CA as missing WARNING: atoms too close: (T0296)Q254.CA and (T0296)A300.CA only 0.000 apart, marking (T0296)Q254.CA as missing WARNING: atoms too close: (T0296)M255.CA and (T0296)K311.CA only 0.000 apart, marking (T0296)K311.CA as missing WARNING: atoms too close: (T0296)A256.N and (T0296)G312.N only 0.000 apart, marking (T0296)G312.N as missing WARNING: atoms too close: (T0296)A256.CA and (T0296)G312.CA only 0.000 apart, marking (T0296)G312.CA as missing WARNING: atoms too close: (T0296)A256.O and (T0296)G312.O only 0.000 apart, marking (T0296)G312.O as missing WARNING: atoms too close: (T0296)A256.C and (T0296)G312.C only 0.000 apart, marking (T0296)G312.C as missing WARNING: atoms too close: (T0296)S257.N and (T0296)G313.N only 0.000 apart, marking (T0296)S257.N as missing WARNING: atoms too close: (T0296)S257.CA and (T0296)G313.CA only 0.000 apart, marking (T0296)S257.CA as missing WARNING: atoms too close: (T0296)S257.O and (T0296)G313.O only 0.000 apart, marking (T0296)S257.O as missing WARNING: atoms too close: (T0296)S257.C and (T0296)G313.C only 0.000 apart, marking (T0296)S257.C as missing WARNING: atoms too close: (T0296)E258.N and (T0296)V314.N only 0.000 apart, marking (T0296)V314.N as missing WARNING: atoms too close: (T0296)E258.CA and (T0296)V314.CA only 0.000 apart, marking (T0296)V314.CA as missing WARNING: atoms too close: (T0296)E258.CB and (T0296)V314.CB only 0.000 apart, marking (T0296)V314.CB as missing WARNING: atoms too close: (T0296)E258.C and (T0296)V314.C only 0.000 apart, marking (T0296)V314.C as missing WARNING: atoms too close: (T0296)R259.CA and (T0296)M315.CA only 0.000 apart, marking (T0296)M315.CA as missing WARNING: atoms too close: (T0296)L260.CA and (T0296)A316.CA only 0.000 apart, marking (T0296)L260.CA as missing WARNING: atoms too close: (T0296)G265.CA and (T0296)N318.CA only 0.000 apart, marking (T0296)N318.CA as missing WARNING: atoms too close: (T0296)I266.N and (T0296)Q319.N only 0.000 apart, marking (T0296)Q319.N as missing WARNING: atoms too close: (T0296)I266.CA and (T0296)Q319.CA only 0.000 apart, marking (T0296)Q319.CA as missing WARNING: atoms too close: (T0296)I266.CB and (T0296)Q319.CB only 0.000 apart, marking (T0296)Q319.CB as missing WARNING: atoms too close: (T0296)I266.O and (T0296)Q319.O only 0.000 apart, marking (T0296)Q319.O as missing WARNING: atoms too close: (T0296)I266.C and (T0296)Q319.C only 0.000 apart, marking (T0296)Q319.C as missing WARNING: atoms too close: (T0296)V267.N and (T0296)V320.N only 0.000 apart, marking (T0296)V320.N as missing WARNING: atoms too close: (T0296)V267.CA and (T0296)V320.CA only 0.000 apart, marking (T0296)V320.CA as missing WARNING: atoms too close: (T0296)V267.CB and (T0296)V320.CB only 0.000 apart, marking (T0296)V320.CB as missing WARNING: atoms too close: (T0296)V267.O and (T0296)V320.O only 0.000 apart, marking (T0296)V320.O as missing WARNING: atoms too close: (T0296)V267.C and (T0296)V320.C only 0.000 apart, marking (T0296)V320.C as missing WARNING: atoms too close: (T0296)D268.N and (T0296)G321.N only 0.000 apart, marking (T0296)D268.N as missing WARNING: atoms too close: (T0296)D268.CA and (T0296)G321.CA only 0.000 apart, marking (T0296)D268.CA as missing WARNING: atoms too close: (T0296)D268.C and (T0296)G321.C only 0.000 apart, marking (T0296)D268.C as missing WARNING: atoms too close: (T0296)L269.CA and (T0296)G322.CA only 0.000 apart, marking (T0296)L269.CA as missing WARNING: atoms too close: (T0296)S270.CA and (T0296)S324.CA only 0.000 apart, marking (T0296)S324.CA as missing WARNING: atoms too close: (T0296)G278.CA and (T0296)G325.CA only 0.000 apart, marking (T0296)G325.CA as missing WARNING: atoms too close: (T0296)D279.N and (T0296)A326.N only 0.000 apart, marking (T0296)D279.N as missing WARNING: atoms too close: (T0296)D279.CA and (T0296)A326.CA only 0.000 apart, marking (T0296)D279.CA as missing WARNING: atoms too close: (T0296)D279.CB and (T0296)A326.CB only 0.000 apart, marking (T0296)D279.CB as missing WARNING: atoms too close: (T0296)D279.O and (T0296)A326.O only 0.000 apart, marking (T0296)D279.O as missing WARNING: atoms too close: (T0296)D279.C and (T0296)A326.C only 0.000 apart, marking (T0296)D279.C as missing WARNING: atoms too close: (T0296)S280.N and (T0296)F327.N only 0.000 apart, marking (T0296)F327.N as missing WARNING: atoms too close: (T0296)S280.CA and (T0296)F327.CA only 0.000 apart, marking (T0296)F327.CA as missing WARNING: atoms too close: (T0296)S280.CB and (T0296)F327.CB only 0.000 apart, marking (T0296)F327.CB as missing WARNING: atoms too close: (T0296)S280.O and (T0296)F327.O only 0.000 apart, marking (T0296)F327.O as missing WARNING: atoms too close: (T0296)S280.C and (T0296)F327.C only 0.000 apart, marking (T0296)F327.C as missing WARNING: atoms too close: (T0296)V281.N and (T0296)I328.N only 0.000 apart, marking (T0296)I328.N as missing WARNING: atoms too close: (T0296)V281.CA and (T0296)I328.CA only 0.000 apart, marking (T0296)I328.CA as missing WARNING: atoms too close: (T0296)V281.CB and (T0296)I328.CB only 0.000 apart, marking (T0296)I328.CB as missing WARNING: atoms too close: (T0296)V281.O and (T0296)I328.O only 0.000 apart, marking (T0296)I328.O as missing WARNING: atoms too close: (T0296)V281.C and (T0296)I328.C only 0.000 apart, marking (T0296)I328.C as missing WARNING: atoms too close: (T0296)A282.N and (T0296)P329.N only 0.000 apart, marking (T0296)P329.N as missing WARNING: atoms too close: (T0296)A282.CA and (T0296)P329.CA only 0.000 apart, marking (T0296)P329.CA as missing WARNING: atoms too close: (T0296)A282.CB and (T0296)P329.CB only 0.000 apart, marking (T0296)P329.CB as missing WARNING: atoms too close: (T0296)A282.C and (T0296)P329.C only 0.000 apart, marking (T0296)P329.C as missing WARNING: atoms too close: (T0296)R283.CA and (T0296)V330.CA only 0.000 apart, marking (T0296)V330.CA as missing WARNING: atoms too close: (T0296)V284.CA and (T0296)S331.CA only 0.000 apart, marking (T0296)S331.CA as missing WARNING: atoms too close: (T0296)E286.CA and (T0296)E332.CA only 0.000 apart, marking (T0296)E332.CA as missing WARNING: atoms too close: (T0296)E287.CA and (T0296)D333.CA only 0.000 apart, marking (T0296)D333.CA as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 Skipped atom 851, because occupancy 1.000 <= existing 1.000 in servers/UNI-EID_sfst_AL2.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 435 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 428 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 423 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/gtg_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation gtg_AL1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 363 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 339 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 407 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 421 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 241 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)V161.O and (T0296)A162.N only 0.000 apart, marking (T0296)A162.N as missing WARNING: atoms too close: (T0296)D362.O and (T0296)M363.N only 0.000 apart, marking (T0296)M363.N as missing WARNING: atoms too close: (T0296)I436.O and (T0296)P437.N only 0.000 apart, marking (T0296)P437.N as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS2.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)D362.O and (T0296)M363.N only 0.000 apart, marking (T0296)M363.N as missing WARNING: atoms too close: (T0296)R396.O and (T0296)I397.N only 0.000 apart, marking (T0296)I397.N as missing WARNING: atoms too close: (T0296)I436.O and (T0296)P437.N only 0.000 apart, marking (T0296)P437.N as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS3.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS4.pdb.gz looking for model 1 # Found a chain break before 442 # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0296)A196.O and (T0296)G197.N only 0.000 apart, marking (T0296)G197.N as missing WARNING: atoms too close: (T0296)D362.O and (T0296)M363.N only 0.000 apart, marking (T0296)M363.N as missing # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # Found a chain break before 441 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # Found a chain break before 366 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # Found a chain break before 440 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # Found a chain break before 437 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 WARNING: atom 404 has residue number 20 < previous residue 106 in servers/mGen-3D_TS1.pdb.gz WARNING: atom 1515 has residue number 370 < previous residue 387 in servers/mGen-3D_TS1.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 445 in servers/nFOLD_TS1.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 445 in servers/nFOLD_TS2.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 WARNING: atom 953 has residue number 216 < previous residue 445 in servers/nFOLD_TS3.pdb.gz WARNING: atom 1 has residue number 1 < previous residue 309 in servers/nFOLD_TS3.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 WARNING: atom 617 has residue number 139 < previous residue 445 in servers/nFOLD_TS4.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 WARNING: atom 1 has residue number 1 < previous residue 445 in servers/nFOLD_TS5.pdb.gz # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0296 can't currently be optimized by undertaker # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score 2.6556 model score 2.5171 model score 2.6318 model score 2.7058 model score 2.7120 model score 2.1194 model score 2.1977 model score 2.1972 model score 2.1972 model score 1.8618 model score 2.5211 model score 2.6676 model score 2.1428 model score 2.4132 model score 2.3571 model score 2.2353 model score 2.3221 model score 2.3096 model score 2.2701 model score 1.6247 model score 1.7293 model score 1.8720 model score 1.7644 model score 1.8612 model score 2.2402 model score 2.3959 model score 2.2693 model score 2.1925 model score 2.0011 model score 2.1925 model score 1.8774 model score 1.2771 model score 1.1347 model score 1.2771 model score 1.9205 model score 1.3092 model score 1.6370 model score 1.4276 model score 1.5056 model score 1.8881 model score 1.7833 model score 1.2768 model score 1.2776 model score 1.2773 model score 1.2779 model score 1.2778 model score 2.1724 model score 2.1192 model score 2.4416 model score 1.7739 model score 1.5380 model score 1.1347 model score 1.2771 model score 1.2771 model score 1.7739 model score 1.8774 model score 2.3096 model score 2.3931 model score 2.3571 model score 2.3499 model score 2.2438 model score 1.2787 model score 1.2789 model score 1.2819 model score 1.2792 model score 1.2784 model score 1.2787 model score 1.2784 model score 1.2808 model score 1.2784 model score 1.2822 model score 2.6420 model score 2.3867 model score 2.6024 model score 2.6235 model score 2.3945 model score 2.0747 model score 2.2511 model score 2.3644 model score 1.7343 model score 1.8843 model score 1.2804 model score 1.2810 model score 1.2787 model score 1.2783 model score 1.9949 model score 1.9195 model score 1.5996 model score 2.2405 model score 2.0694 model score 2.2540 model score 2.2129 model score 2.8642 model score 2.2056 model score 2.9780 model score 2.9780 model score 1.3205 model score 1.5380 model score 1.5415 model score 1.3117 model score 1.3826 model score 1.3474 model score 1.8084 model score 1.7170 model score 2.2245 model score 2.2504 model score 1.9519 model score 1.9490 model score 1.6790 model score 1.7408 model score 2.0664 model score 2.0653 model score 2.1086 model score 2.1442 model score 1.6855 model score 1.7640 model score 1.5894 model score 1.9438 model score 2.2461 model score 2.6172 model score 2.6399 model score 2.3127 model score 2.3133 model score 2.5041 model score 2.4758 model score 2.5187 model score 2.5187 model score 1.2762 model score 2.4999 model score 1.8460 model score 1.5864 model score 2.1646 model score 2.4150 model score 1.8436 model score 1.9411 model score 1.9411 model score 1.9212 model score 2.5216 model score 1.1649 model score 2.2034 model score 2.1791 model score 2.1020 model score 2.1029 model score 2.4443 model score 1.5167 model score 1.5131 model score 1.7652 model score 1.7483 model score 2.5216 model score 1.8240 model score 2.1606 model score 2.2033 model score 2.2397 model score 1.7629 model score 1.7564 model score 1.8349 model score 2.1494 model score 1.7986 model score 2.2740 model score 2.2364 model score 2.1720 model score 2.1650 model score 1.2645 model score 2.1984 model score 1.7673 model score 2.3395 model score 1.9271 model score 2.1856 model score 1.7879 model score 2.0744 model score 1.3027 model score 1.6942 model score 2.0529 model score 1.9957 model score 1.2770 model score 1.2760 model score 1.2771 model score 1.2779 model score 1.2771 model score 1.2795 model score 1.2774 model score 1.2771 model score 1.2788 model score 1.2772 model score 1.2280 model score 0.9393 model score 0.7717 model score 1.2067 model score 1.2587 model score 1.9438 model score 1.8240 model score 1.7629 model score 2.2886 model score 1.9669 model score 1.8909 model score 1.8914 model score 1.7115 model score 2.0273 model score 1.5947 model score 2.4202 model score 2.4881 model score 2.0229 model score 2.0790 model score 2.2584 model score 1.2770 model score 1.2798 model score 1.2798 model score 1.2790 model score 1.2793 model score 1.5445 model score 1.2778 model score 1.2809 model score 1.2778 model score 1.2780 model score 1.2787 model score 1.8452 model score 1.8161 model score 2.0000 model score 1.7196 model score 1.7308 model score 1.7790 model score 1.8606 model score 1.2778 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.8640 model score 1.6976 model score 1.5039 model score 2.0810 model score 2.1090 model score 2.3018 model score 2.4971 model score 2.4840 model score 2.3134 model score 2.4377 model score 1.6492 model score 1.5286 model score 1.9235 model score 2.7292 model score 1.6555 model score 2.2392 model score 2.2074 model score 2.3192 model score 2.1577 model score 2.2370 model score 1.5406 model score 1.8616 model score 1.2599 model score 1.3237 model score 1.5195 model score 1.4032 model score 2.1180 USE_META, weight: 0.2315 cost: 2.6556 min: 0.7717 max: 2.9780 USE_META, weight: 0.2880 cost: 2.5171 min: 0.7717 max: 2.9780 USE_META, weight: 0.2412 cost: 2.6318 min: 0.7717 max: 2.9780 USE_META, weight: 0.2111 cost: 2.7058 min: 0.7717 max: 2.9780 USE_META, weight: 0.2085 cost: 2.7120 min: 0.7717 max: 2.9780 USE_META, weight: 0.4502 cost: 2.1194 min: 0.7717 max: 2.9780 USE_META, weight: 0.4183 cost: 2.1977 min: 0.7717 max: 2.9780 USE_META, weight: 0.4185 cost: 2.1972 min: 0.7717 max: 2.9780 USE_META, weight: 0.4185 cost: 2.1972 min: 0.7717 max: 2.9780 USE_META, weight: 0.5553 cost: 1.8618 min: 0.7717 max: 2.9780 USE_META, weight: 0.2864 cost: 2.5211 min: 0.7717 max: 2.9780 USE_META, weight: 0.2266 cost: 2.6676 min: 0.7717 max: 2.9780 USE_META, weight: 0.4407 cost: 2.1428 min: 0.7717 max: 2.9780 USE_META, weight: 0.3304 cost: 2.4132 min: 0.7717 max: 2.9780 USE_META, weight: 0.3533 cost: 2.3571 min: 0.7717 max: 2.9780 USE_META, weight: 0.4030 cost: 2.2353 min: 0.7717 max: 2.9780 USE_META, weight: 0.3676 cost: 2.3221 min: 0.7717 max: 2.9780 USE_META, weight: 0.3727 cost: 2.3096 min: 0.7717 max: 2.9780 USE_META, weight: 0.3888 cost: 2.2701 min: 0.7717 max: 2.9780 USE_META, weight: 0.6521 cost: 1.6247 min: 0.7717 max: 2.9780 USE_META, weight: 0.6094 cost: 1.7293 min: 0.7717 max: 2.9780 USE_META, weight: 0.5512 cost: 1.8720 min: 0.7717 max: 2.9780 USE_META, weight: 0.5951 cost: 1.7644 min: 0.7717 max: 2.9780 USE_META, weight: 0.5556 cost: 1.8612 min: 0.7717 max: 2.9780 USE_META, weight: 0.4010 cost: 2.2402 min: 0.7717 max: 2.9780 USE_META, weight: 0.3375 cost: 2.3959 min: 0.7717 max: 2.9780 USE_META, weight: 0.3891 cost: 2.2693 min: 0.7717 max: 2.9780 USE_META, weight: 0.4204 cost: 2.1925 min: 0.7717 max: 2.9780 USE_META, weight: 0.4985 cost: 2.0011 min: 0.7717 max: 2.9780 USE_META, weight: 0.4204 cost: 2.1925 min: 0.7717 max: 2.9780 USE_META, weight: 0.5490 cost: 1.8774 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.8519 cost: 1.1347 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.5314 cost: 1.9205 min: 0.7717 max: 2.9780 USE_META, weight: 0.7807 cost: 1.3092 min: 0.7717 max: 2.9780 USE_META, weight: 0.6470 cost: 1.6370 min: 0.7717 max: 2.9780 USE_META, weight: 0.7324 cost: 1.4276 min: 0.7717 max: 2.9780 USE_META, weight: 0.7006 cost: 1.5056 min: 0.7717 max: 2.9780 USE_META, weight: 0.5446 cost: 1.8881 min: 0.7717 max: 2.9780 USE_META, weight: 0.5874 cost: 1.7833 min: 0.7717 max: 2.9780 USE_META, weight: 0.7939 cost: 1.2768 min: 0.7717 max: 2.9780 USE_META, weight: 0.7936 cost: 1.2776 min: 0.7717 max: 2.9780 USE_META, weight: 0.7937 cost: 1.2773 min: 0.7717 max: 2.9780 USE_META, weight: 0.7935 cost: 1.2779 min: 0.7717 max: 2.9780 USE_META, weight: 0.7936 cost: 1.2778 min: 0.7717 max: 2.9780 USE_META, weight: 0.4286 cost: 2.1724 min: 0.7717 max: 2.9780 USE_META, weight: 0.4503 cost: 2.1192 min: 0.7717 max: 2.9780 USE_META, weight: 0.3188 cost: 2.4416 min: 0.7717 max: 2.9780 USE_META, weight: 0.5912 cost: 1.7739 min: 0.7717 max: 2.9780 USE_META, weight: 0.6874 cost: 1.5380 min: 0.7717 max: 2.9780 USE_META, weight: 0.8519 cost: 1.1347 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.5912 cost: 1.7739 min: 0.7717 max: 2.9780 USE_META, weight: 0.5490 cost: 1.8774 min: 0.7717 max: 2.9780 USE_META, weight: 0.3727 cost: 2.3096 min: 0.7717 max: 2.9780 USE_META, weight: 0.3386 cost: 2.3931 min: 0.7717 max: 2.9780 USE_META, weight: 0.3533 cost: 2.3571 min: 0.7717 max: 2.9780 USE_META, weight: 0.3562 cost: 2.3499 min: 0.7717 max: 2.9780 USE_META, weight: 0.3995 cost: 2.2438 min: 0.7717 max: 2.9780 USE_META, weight: 0.7932 cost: 1.2787 min: 0.7717 max: 2.9780 USE_META, weight: 0.7931 cost: 1.2789 min: 0.7717 max: 2.9780 USE_META, weight: 0.7919 cost: 1.2819 min: 0.7717 max: 2.9780 USE_META, weight: 0.7930 cost: 1.2792 min: 0.7717 max: 2.9780 USE_META, weight: 0.7933 cost: 1.2784 min: 0.7717 max: 2.9780 USE_META, weight: 0.7932 cost: 1.2787 min: 0.7717 max: 2.9780 USE_META, weight: 0.7933 cost: 1.2784 min: 0.7717 max: 2.9780 USE_META, weight: 0.7923 cost: 1.2808 min: 0.7717 max: 2.9780 USE_META, weight: 0.7933 cost: 1.2784 min: 0.7717 max: 2.9780 USE_META, weight: 0.7917 cost: 1.2822 min: 0.7717 max: 2.9780 USE_META, weight: 0.2371 cost: 2.6420 min: 0.7717 max: 2.9780 USE_META, weight: 0.3412 cost: 2.3867 min: 0.7717 max: 2.9780 USE_META, weight: 0.2532 cost: 2.6024 min: 0.7717 max: 2.9780 USE_META, weight: 0.2446 cost: 2.6235 min: 0.7717 max: 2.9780 USE_META, weight: 0.3380 cost: 2.3945 min: 0.7717 max: 2.9780 USE_META, weight: 0.4685 cost: 2.0747 min: 0.7717 max: 2.9780 USE_META, weight: 0.3965 cost: 2.2511 min: 0.7717 max: 2.9780 USE_META, weight: 0.3503 cost: 2.3644 min: 0.7717 max: 2.9780 USE_META, weight: 0.6073 cost: 1.7343 min: 0.7717 max: 2.9780 USE_META, weight: 0.5461 cost: 1.8843 min: 0.7717 max: 2.9780 USE_META, weight: 0.7925 cost: 1.2804 min: 0.7717 max: 2.9780 USE_META, weight: 0.7922 cost: 1.2810 min: 0.7717 max: 2.9780 USE_META, weight: 0.7932 cost: 1.2787 min: 0.7717 max: 2.9780 USE_META, weight: 0.7933 cost: 1.2783 min: 0.7717 max: 2.9780 USE_META, weight: 0.5010 cost: 1.9949 min: 0.7717 max: 2.9780 USE_META, weight: 0.5318 cost: 1.9195 min: 0.7717 max: 2.9780 USE_META, weight: 0.6623 cost: 1.5996 min: 0.7717 max: 2.9780 USE_META, weight: 0.4008 cost: 2.2405 min: 0.7717 max: 2.9780 USE_META, weight: 0.4707 cost: 2.0694 min: 0.7717 max: 2.9780 USE_META, weight: 0.3954 cost: 2.2540 min: 0.7717 max: 2.9780 USE_META, weight: 0.4121 cost: 2.2129 min: 0.7717 max: 2.9780 USE_META, weight: 0.1464 cost: 2.8642 min: 0.7717 max: 2.9780 USE_META, weight: 0.4151 cost: 2.2056 min: 0.7717 max: 2.9780 USE_META, weight: 0.1000 cost: 2.9780 min: 0.7717 max: 2.9780 USE_META, weight: 0.1000 cost: 2.9780 min: 0.7717 max: 2.9780 USE_META, weight: 0.7761 cost: 1.3205 min: 0.7717 max: 2.9780 USE_META, weight: 0.6874 cost: 1.5380 min: 0.7717 max: 2.9780 USE_META, weight: 0.6860 cost: 1.5415 min: 0.7717 max: 2.9780 USE_META, weight: 0.7797 cost: 1.3117 min: 0.7717 max: 2.9780 USE_META, weight: 0.7508 cost: 1.3826 min: 0.7717 max: 2.9780 USE_META, weight: 0.7652 cost: 1.3474 min: 0.7717 max: 2.9780 USE_META, weight: 0.5771 cost: 1.8084 min: 0.7717 max: 2.9780 USE_META, weight: 0.6144 cost: 1.7170 min: 0.7717 max: 2.9780 USE_META, weight: 0.4074 cost: 2.2245 min: 0.7717 max: 2.9780 USE_META, weight: 0.3968 cost: 2.2504 min: 0.7717 max: 2.9780 USE_META, weight: 0.5186 cost: 1.9519 min: 0.7717 max: 2.9780 USE_META, weight: 0.5198 cost: 1.9490 min: 0.7717 max: 2.9780 USE_META, weight: 0.6299 cost: 1.6790 min: 0.7717 max: 2.9780 USE_META, weight: 0.6047 cost: 1.7408 min: 0.7717 max: 2.9780 USE_META, weight: 0.4719 cost: 2.0664 min: 0.7717 max: 2.9780 USE_META, weight: 0.4723 cost: 2.0653 min: 0.7717 max: 2.9780 USE_META, weight: 0.4547 cost: 2.1086 min: 0.7717 max: 2.9780 USE_META, weight: 0.4401 cost: 2.1442 min: 0.7717 max: 2.9780 USE_META, weight: 0.6272 cost: 1.6855 min: 0.7717 max: 2.9780 USE_META, weight: 0.5952 cost: 1.7640 min: 0.7717 max: 2.9780 USE_META, weight: 0.6664 cost: 1.5894 min: 0.7717 max: 2.9780 USE_META, weight: 0.5219 cost: 1.9438 min: 0.7717 max: 2.9780 USE_META, weight: 0.3986 cost: 2.2461 min: 0.7717 max: 2.9780 USE_META, weight: 0.2472 cost: 2.6172 min: 0.7717 max: 2.9780 USE_META, weight: 0.2379 cost: 2.6399 min: 0.7717 max: 2.9780 USE_META, weight: 0.3714 cost: 2.3127 min: 0.7717 max: 2.9780 USE_META, weight: 0.3712 cost: 2.3133 min: 0.7717 max: 2.9780 USE_META, weight: 0.2933 cost: 2.5041 min: 0.7717 max: 2.9780 USE_META, weight: 0.3049 cost: 2.4758 min: 0.7717 max: 2.9780 USE_META, weight: 0.2874 cost: 2.5187 min: 0.7717 max: 2.9780 USE_META, weight: 0.2874 cost: 2.5187 min: 0.7717 max: 2.9780 USE_META, weight: 0.7942 cost: 1.2762 min: 0.7717 max: 2.9780 USE_META, weight: 0.2951 cost: 2.4999 min: 0.7717 max: 2.9780 USE_META, weight: 0.5618 cost: 1.8460 min: 0.7717 max: 2.9780 USE_META, weight: 0.6677 cost: 1.5864 min: 0.7717 max: 2.9780 USE_META, weight: 0.4318 cost: 2.1646 min: 0.7717 max: 2.9780 USE_META, weight: 0.3297 cost: 2.4150 min: 0.7717 max: 2.9780 USE_META, weight: 0.5628 cost: 1.8436 min: 0.7717 max: 2.9780 USE_META, weight: 0.5230 cost: 1.9411 min: 0.7717 max: 2.9780 USE_META, weight: 0.5230 cost: 1.9411 min: 0.7717 max: 2.9780 USE_META, weight: 0.5311 cost: 1.9212 min: 0.7717 max: 2.9780 USE_META, weight: 0.2862 cost: 2.5216 min: 0.7717 max: 2.9780 USE_META, weight: 0.8396 cost: 1.1649 min: 0.7717 max: 2.9780 USE_META, weight: 0.4160 cost: 2.2034 min: 0.7717 max: 2.9780 USE_META, weight: 0.4259 cost: 2.1791 min: 0.7717 max: 2.9780 USE_META, weight: 0.4573 cost: 2.1020 min: 0.7717 max: 2.9780 USE_META, weight: 0.4570 cost: 2.1029 min: 0.7717 max: 2.9780 USE_META, weight: 0.3177 cost: 2.4443 min: 0.7717 max: 2.9780 USE_META, weight: 0.6961 cost: 1.5167 min: 0.7717 max: 2.9780 USE_META, weight: 0.6976 cost: 1.5131 min: 0.7717 max: 2.9780 USE_META, weight: 0.5947 cost: 1.7652 min: 0.7717 max: 2.9780 USE_META, weight: 0.6016 cost: 1.7483 min: 0.7717 max: 2.9780 USE_META, weight: 0.2862 cost: 2.5216 min: 0.7717 max: 2.9780 USE_META, weight: 0.5707 cost: 1.8240 min: 0.7717 max: 2.9780 USE_META, weight: 0.4334 cost: 2.1606 min: 0.7717 max: 2.9780 USE_META, weight: 0.4160 cost: 2.2033 min: 0.7717 max: 2.9780 USE_META, weight: 0.4012 cost: 2.2397 min: 0.7717 max: 2.9780 USE_META, weight: 0.5957 cost: 1.7629 min: 0.7717 max: 2.9780 USE_META, weight: 0.5983 cost: 1.7564 min: 0.7717 max: 2.9780 USE_META, weight: 0.5663 cost: 1.8349 min: 0.7717 max: 2.9780 USE_META, weight: 0.4380 cost: 2.1494 min: 0.7717 max: 2.9780 USE_META, weight: 0.5811 cost: 1.7986 min: 0.7717 max: 2.9780 USE_META, weight: 0.3872 cost: 2.2740 min: 0.7717 max: 2.9780 USE_META, weight: 0.4025 cost: 2.2364 min: 0.7717 max: 2.9780 USE_META, weight: 0.4288 cost: 2.1720 min: 0.7717 max: 2.9780 USE_META, weight: 0.4316 cost: 2.1650 min: 0.7717 max: 2.9780 USE_META, weight: 0.7990 cost: 1.2645 min: 0.7717 max: 2.9780 USE_META, weight: 0.4180 cost: 2.1984 min: 0.7717 max: 2.9780 USE_META, weight: 0.5939 cost: 1.7673 min: 0.7717 max: 2.9780 USE_META, weight: 0.3604 cost: 2.3395 min: 0.7717 max: 2.9780 USE_META, weight: 0.5287 cost: 1.9271 min: 0.7717 max: 2.9780 USE_META, weight: 0.4232 cost: 2.1856 min: 0.7717 max: 2.9780 USE_META, weight: 0.5855 cost: 1.7879 min: 0.7717 max: 2.9780 USE_META, weight: 0.4686 cost: 2.0744 min: 0.7717 max: 2.9780 USE_META, weight: 0.7834 cost: 1.3027 min: 0.7717 max: 2.9780 USE_META, weight: 0.6237 cost: 1.6942 min: 0.7717 max: 2.9780 USE_META, weight: 0.4774 cost: 2.0529 min: 0.7717 max: 2.9780 USE_META, weight: 0.5007 cost: 1.9957 min: 0.7717 max: 2.9780 USE_META, weight: 0.7939 cost: 1.2770 min: 0.7717 max: 2.9780 USE_META, weight: 0.7943 cost: 1.2760 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7935 cost: 1.2779 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7929 cost: 1.2795 min: 0.7717 max: 2.9780 USE_META, weight: 0.7937 cost: 1.2774 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7931 cost: 1.2788 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2772 min: 0.7717 max: 2.9780 USE_META, weight: 0.8138 cost: 1.2280 min: 0.7717 max: 2.9780 USE_META, weight: 0.9316 cost: 0.9393 min: 0.7717 max: 2.9780 USE_META, weight: 1.0000 cost: 0.7717 min: 0.7717 max: 2.9780 USE_META, weight: 0.8226 cost: 1.2067 min: 0.7717 max: 2.9780 USE_META, weight: 0.8014 cost: 1.2587 min: 0.7717 max: 2.9780 USE_META, weight: 0.5219 cost: 1.9438 min: 0.7717 max: 2.9780 USE_META, weight: 0.5707 cost: 1.8240 min: 0.7717 max: 2.9780 USE_META, weight: 0.5957 cost: 1.7629 min: 0.7717 max: 2.9780 USE_META, weight: 0.3812 cost: 2.2886 min: 0.7717 max: 2.9780 USE_META, weight: 0.5124 cost: 1.9669 min: 0.7717 max: 2.9780 USE_META, weight: 0.5435 cost: 1.8909 min: 0.7717 max: 2.9780 USE_META, weight: 0.5433 cost: 1.8914 min: 0.7717 max: 2.9780 USE_META, weight: 0.6166 cost: 1.7115 min: 0.7717 max: 2.9780 USE_META, weight: 0.4878 cost: 2.0273 min: 0.7717 max: 2.9780 USE_META, weight: 0.6643 cost: 1.5947 min: 0.7717 max: 2.9780 USE_META, weight: 0.3275 cost: 2.4202 min: 0.7717 max: 2.9780 USE_META, weight: 0.2999 cost: 2.4881 min: 0.7717 max: 2.9780 USE_META, weight: 0.4896 cost: 2.0229 min: 0.7717 max: 2.9780 USE_META, weight: 0.4667 cost: 2.0790 min: 0.7717 max: 2.9780 USE_META, weight: 0.3935 cost: 2.2584 min: 0.7717 max: 2.9780 USE_META, weight: 0.7939 cost: 1.2770 min: 0.7717 max: 2.9780 USE_META, weight: 0.7927 cost: 1.2798 min: 0.7717 max: 2.9780 USE_META, weight: 0.7927 cost: 1.2798 min: 0.7717 max: 2.9780 USE_META, weight: 0.7930 cost: 1.2790 min: 0.7717 max: 2.9780 USE_META, weight: 0.7929 cost: 1.2793 min: 0.7717 max: 2.9780 USE_META, weight: 0.6847 cost: 1.5445 min: 0.7717 max: 2.9780 USE_META, weight: 0.7935 cost: 1.2778 min: 0.7717 max: 2.9780 USE_META, weight: 0.7923 cost: 1.2809 min: 0.7717 max: 2.9780 USE_META, weight: 0.7936 cost: 1.2778 min: 0.7717 max: 2.9780 USE_META, weight: 0.7935 cost: 1.2780 min: 0.7717 max: 2.9780 USE_META, weight: 0.7932 cost: 1.2787 min: 0.7717 max: 2.9780 USE_META, weight: 0.5621 cost: 1.8452 min: 0.7717 max: 2.9780 USE_META, weight: 0.5740 cost: 1.8161 min: 0.7717 max: 2.9780 USE_META, weight: 0.4989 cost: 2.0000 min: 0.7717 max: 2.9780 USE_META, weight: 0.6133 cost: 1.7196 min: 0.7717 max: 2.9780 USE_META, weight: 0.6087 cost: 1.7308 min: 0.7717 max: 2.9780 USE_META, weight: 0.5891 cost: 1.7790 min: 0.7717 max: 2.9780 USE_META, weight: 0.5558 cost: 1.8606 min: 0.7717 max: 2.9780 USE_META, weight: 0.7936 cost: 1.2778 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.7938 cost: 1.2771 min: 0.7717 max: 2.9780 USE_META, weight: 0.5544 cost: 1.8640 min: 0.7717 max: 2.9780 USE_META, weight: 0.6223 cost: 1.6976 min: 0.7717 max: 2.9780 USE_META, weight: 0.7013 cost: 1.5039 min: 0.7717 max: 2.9780 USE_META, weight: 0.4659 cost: 2.0810 min: 0.7717 max: 2.9780 USE_META, weight: 0.4545 cost: 2.1090 min: 0.7717 max: 2.9780 USE_META, weight: 0.3758 cost: 2.3018 min: 0.7717 max: 2.9780 USE_META, weight: 0.2962 cost: 2.4971 min: 0.7717 max: 2.9780 USE_META, weight: 0.3015 cost: 2.4840 min: 0.7717 max: 2.9780 USE_META, weight: 0.3711 cost: 2.3134 min: 0.7717 max: 2.9780 USE_META, weight: 0.3204 cost: 2.4377 min: 0.7717 max: 2.9780 USE_META, weight: 0.6421 cost: 1.6492 min: 0.7717 max: 2.9780 USE_META, weight: 0.6912 cost: 1.5286 min: 0.7717 max: 2.9780 USE_META, weight: 0.5302 cost: 1.9235 min: 0.7717 max: 2.9780 USE_META, weight: 0.2015 cost: 2.7292 min: 0.7717 max: 2.9780 USE_META, weight: 0.6395 cost: 1.6555 min: 0.7717 max: 2.9780 USE_META, weight: 0.4014 cost: 2.2392 min: 0.7717 max: 2.9780 USE_META, weight: 0.4143 cost: 2.2074 min: 0.7717 max: 2.9780 USE_META, weight: 0.3687 cost: 2.3192 min: 0.7717 max: 2.9780 USE_META, weight: 0.4346 cost: 2.1577 min: 0.7717 max: 2.9780 USE_META, weight: 0.4023 cost: 2.2370 min: 0.7717 max: 2.9780 USE_META, weight: 0.6863 cost: 1.5406 min: 0.7717 max: 2.9780 USE_META, weight: 0.5554 cost: 1.8616 min: 0.7717 max: 2.9780 USE_META, weight: 0.8009 cost: 1.2599 min: 0.7717 max: 2.9780 USE_META, weight: 0.7748 cost: 1.3237 min: 0.7717 max: 2.9780 USE_META, weight: 0.6950 cost: 1.5195 min: 0.7717 max: 2.9780 USE_META, weight: 0.7424 cost: 1.4032 min: 0.7717 max: 2.9780 USE_META, weight: 0.4508 cost: 2.1180 min: 0.7717 max: 2.9780 USE_EVALUE, weight: 0.9274 eval: 4.4987 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9274 eval: 4.4987 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9274 eval: 4.4987 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 1.0000 eval: 0.1661 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 1.0000 eval: 0.1661 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 1.0000 eval: 0.1661 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9883 eval: 0.8646 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9883 eval: 0.8646 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9883 eval: 0.8646 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9451 eval: 3.4458 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9451 eval: 3.4458 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9451 eval: 3.4458 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9414 eval: 3.6657 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9414 eval: 3.6657 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9414 eval: 3.6657 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9293 eval: 4.3877 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9293 eval: 4.3877 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9293 eval: 4.3877 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9535 eval: 2.9441 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9535 eval: 2.9441 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9535 eval: 2.9441 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9961 eval: 0.3993 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9961 eval: 0.3993 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9961 eval: 0.3993 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9337 eval: 4.1222 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9337 eval: 4.1222 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9337 eval: 4.1222 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9629 eval: 2.3824 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9629 eval: 2.3824 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9629 eval: 2.3824 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9375 eval: 3.8979 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9375 eval: 3.8979 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9375 eval: 3.8979 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9651 eval: 2.2505 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9651 eval: 2.2505 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9651 eval: 2.2505 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9662 eval: 2.1816 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9662 eval: 2.1816 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9662 eval: 2.1816 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9299 eval: 4.3502 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9299 eval: 4.3502 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9299 eval: 4.3502 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9375 eval: 3.8973 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9375 eval: 3.8973 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9375 eval: 3.8973 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9912 eval: 0.6912 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9912 eval: 0.6912 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9912 eval: 0.6912 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9701 eval: 1.9489 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9701 eval: 1.9489 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9701 eval: 1.9489 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9820 eval: 1.2421 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9820 eval: 1.2421 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9820 eval: 1.2421 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9248 eval: 4.6574 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9248 eval: 4.6574 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9248 eval: 4.6574 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.1000 eval: 53.9000 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.1000 eval: 53.9000 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.1000 eval: 53.9000 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9517 eval: 3.0494 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9517 eval: 3.0494 min: 0.1661 max: 53.9000 USE_EVALUE, weight: 0.9517 eval: 3.0494 min: 0.1661 max: 53.9000 Number of contacts in models: 255 Number of contacts in alignments: 63 NUMB_ALIGNS: 63 Adding 54448 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -844.0632, CN propb: -844.0632 weights: 0.1200 constraints: 2891 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 2891 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 2891 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 51557 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 51557 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 54448 # command: