# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0292/ # command:# Making conformation for sequence T0292 numbered 1 through 277 Created new target T0292 from T0292.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0292/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0292//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0292/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0292//projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0292/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0292/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0292/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z57A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z57A expands to /projects/compbio/data/pdb/1z57.pdb.gz 1z57A:Skipped atom 406, because occupancy 0.35 <= existing 0.650 in 1z57A Skipped atom 408, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1026, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1028, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1181, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1184, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1255, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1257, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1259, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1261, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1263, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1499, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 1501, because occupancy 0.350 <= existing 0.650 in 1z57A Skipped atom 2508, because occupancy 0.500 <= existing 0.500 in 1z57A Skipped atom 2512, because occupancy 0.500 <= existing 0.500 in 1z57A Skipped atom 2514, because occupancy 0.500 <= existing 0.500 in 1z57A Skipped atom 2516, because occupancy 0.500 <= existing 0.500 in 1z57A Skipped atom 2518, because occupancy 0.500 <= existing 0.500 in 1z57A # T0292 read from 1z57A/merged-good-all-a2m # 1z57A read from 1z57A/merged-good-all-a2m # adding 1z57A to template set # found chain 1z57A in template set Warning: unaligning (T0292)M84 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1z57A)E242 Warning: unaligning (T0292)E85 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1z57A)E242 T0292 4 :EDYEVLYTIGTGSYGRCQKIRR 1z57A 159 :ARYEIVDTLGEGAFGKVVECID # choosing archetypes in rotamer library T0292 26 :KSDGKILVWKELDY 1z57A 182 :KAGGRHVAVKIVKN T0292 43 :TEAEKQMLVSEVNLLREL 1z57A 196 :VDRYCEAARSEIQVLEHL T0292 61 :KHP 1z57A 219 :NST T0292 64 :NIVRYYDRI 1z57A 223 :RCVQMLEWF T0292 75 :RTNTTLYIV 1z57A 232 :EHHGHICIV T0292 86 :YCE 1z57A 243 :LLG T0292 90 :GDLASVITKG 1z57A 246 :LSTYDFIKEN T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRRS 1z57A 256 :GFLPFRLDHIRKMAYQICKSVNFLHSNK T0292 135 :VLHRDLKPANVFL 1z57A 284 :LTHTDLKPENILF T0292 149 :GKQNVKLGDFGLARI 1z57A 317 :INPDIKVVDFGSATY T0292 167 :DTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKE 1z57A 332 :DDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKE T0292 222 :LAGKIR 1z57A 390 :MMERIL T0292 228 :EGKFR 1z57A 414 :HDRLD T0292 234 :IPYR 1z57A 419 :WDEH T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1z57A 447 :HERLFDLIQKMLEYDPAKRITLREALKHPFFDLL Number of specific fragments extracted= 16 number of extra gaps= 1 total=16 Number of alignments=1 # 1z57A read from 1z57A/merged-good-all-a2m # found chain 1z57A in template set Warning: unaligning (T0292)M84 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1z57A)E242 Warning: unaligning (T0292)E85 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1z57A)E242 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKS 1z57A 159 :ARYEIVDTLGEGAFGKVVECIDHK T0292 28 :DGKILVWKELDY 1z57A 184 :GGRHVAVKIVKN T0292 43 :TEAEKQMLVSEVNLLREL 1z57A 196 :VDRYCEAARSEIQVLEHL T0292 61 :KHP 1z57A 219 :NST T0292 64 :NIVRYYDRI 1z57A 223 :RCVQMLEWF T0292 75 :RTNTTLYIV 1z57A 232 :EHHGHICIV T0292 86 :YCEG 1z57A 243 :LLGL T0292 91 :DLASVITKGTKER 1z57A 247 :STYDFIKENGFLP T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1z57A 260 :FRLDHIRKMAYQICKSVNFLHSNK T0292 135 :VLHRDLKPANVFL 1z57A 284 :LTHTDLKPENILF T0292 150 :KQN 1z57A 300 :DYT T0292 153 :VKLGDFGLARI 1z57A 321 :IKVVDFGSATY T0292 167 :DTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1z57A 332 :DDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMER T0292 229 :GKFR 1z57A 396 :GPLP T0292 233 :RIPY 1z57A 407 :RKRK T0292 240 :DELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1z57A 448 :ERLFDLIQKMLEYDPAKRITLREALKHPFFDLLK Number of specific fragments extracted= 16 number of extra gaps= 1 total=32 Number of alignments=2 # 1z57A read from 1z57A/merged-good-all-a2m # found chain 1z57A in template set Warning: unaligning (T0292)M84 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1z57A)E242 Warning: unaligning (T0292)E85 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1z57A)E242 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRK 1z57A 159 :ARYEIVDTLGEGAFGKVVECIDH T0292 27 :SDGKILVWKELDYG 1z57A 183 :AGGRHVAVKIVKNV T0292 44 :EAEKQMLVSEVNLLREL 1z57A 197 :DRYCEAARSEIQVLEHL T0292 61 :KHPN 1z57A 219 :NSTF T0292 65 :IVRYYDRIIDRTN 1z57A 224 :CVQMLEWFEHHGH T0292 80 :LYIV 1z57A 237 :ICIV T0292 86 :YCEG 1z57A 243 :LLGL T0292 91 :DLASVITK 1z57A 247 :STYDFIKE T0292 101 :KERQYLDEEFVLRVMTQLTLALKECHRR 1z57A 255 :NGFLPFRLDHIRKMAYQICKSVNFLHSN T0292 134 :TVLHRDLKPANVFL 1z57A 283 :KLTHTDLKPENILF T0292 148 :DGKQNVKLGDFGLARILNHD 1z57A 316 :LINPDIKVVDFGSATYDDEH T0292 171 :AKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1z57A 336 :HSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSKEHLAMMER T0292 229 :GKFRR 1z57A 396 :GPLPK T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1z57A 442 :SQDVEHERLFDLIQKMLEYDPAKRITLREALKHPFFDLL Number of specific fragments extracted= 14 number of extra gaps= 1 total=46 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1uu3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1uu3A/merged-good-all-a2m # 1uu3A read from 1uu3A/merged-good-all-a2m # found chain 1uu3A in training set Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1uu3A)F242 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uu3A)F242 Warning: unaligning (T0292)S259 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1uu3A)G332 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 1uu3A 78 :RPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKEN T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRI 1uu3A 124 :VPYVTRERDVMSRLDHPFFVKLYFTF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1uu3A 150 :QDDEKLYFGLSYAKNGELLKYIRKIGS T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1uu3A 177 :FDETCTRFYTAEIVSALEYLHGKG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1uu3A 201 :IIHRDLKPENILLNEDMHIQITDFGTAKV T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1uu3A 243 :VGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1uu3A 301 :FPEKFFPKARDLVEKLLVLDATKRL T0292 260 :VEEILENPLILEHHHH 1uu3A 333 :YGPLKAHPFFESVTWE Number of specific fragments extracted= 8 number of extra gaps= 1 total=54 Number of alignments=4 # 1uu3A read from 1uu3A/merged-good-all-a2m # found chain 1uu3A in training set Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1uu3A)F242 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uu3A)F242 Warning: unaligning (T0292)S259 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1uu3A)G332 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1uu3A 78 :RPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1uu3A 120 :KENKVPYVTRERDVMSRLDHPFFVKLYFTF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1uu3A 150 :QDDEKLYFGLSYAKNGELLKYIRKIGS T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1uu3A 177 :FDETCTRFYTAEIVSALEYLHGKG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1uu3A 201 :IIHRDLKPENILLNEDMHIQITDFGTAKV T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1uu3A 243 :VGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1uu3A 301 :FPEKFFPKARDLVEKLLVLDATKRL T0292 260 :VEEILENPLILEHH 1uu3A 333 :YGPLKAHPFFESVT Number of specific fragments extracted= 8 number of extra gaps= 1 total=62 Number of alignments=5 # 1uu3A read from 1uu3A/merged-good-all-a2m # found chain 1uu3A in training set Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1uu3A)F242 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1uu3A)F242 Warning: unaligning (T0292)S259 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1uu3A)G332 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1uu3A 78 :RPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1uu3A 120 :KENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEK T0292 80 :LYIVMEYCEGGDLASVITK 1uu3A 155 :LYFGLSYAKNGELLKYIRK T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1uu3A 174 :IGSFDETCTRFYTAEIVSALEYLHGK T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARI 1uu3A 200 :GIIHRDLKPENILLNEDMHIQITDFGTAKV T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1uu3A 243 :VGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1uu3A 301 :FPEKFFPKARDLVEKLLVLDATKRL T0292 260 :VEEILENPLILEHHHHH 1uu3A 333 :YGPLKAHPFFESVTWEN Number of specific fragments extracted= 8 number of extra gaps= 1 total=70 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p4oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1p4oA/merged-good-all-a2m # 1p4oA read from 1p4oA/merged-good-all-a2m # found chain 1p4oA in training set T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKS 1p4oA 965 :AREKITMSRELGQGSFGMVYEGVAKG T0292 28 :DGK 1p4oA 993 :KDE T0292 31 :ILVWKELDYG 1p4oA 999 :RVAIKTVNEA T0292 42 :MTEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1p4oA 1009 :ASMRERIEFLNEASVMKEFNCHHVVRLLGVV T0292 75 :RTNTTLYIVMEYCEGGDLASVIT 1p4oA 1040 :SQGQPTLVIMELMTRGDLKSYLR T0292 98 :KGTKERQYLDEEFVLRVMTQLTLALKECHRRS 1p4oA 1069 :ANNPVLAPPSLSKMIQMAGEIADGMAYLNANK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLAR 1p4oA 1101 :FVHRDLAARNCMVAEDFTVKIGDFGMTR T0292 163 :ILNHDTSFAK 1p4oA 1135 :YYRKGGKGLL T0292 177 :TPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALM 1p4oA 1145 :PVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLA T0292 212 :PPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 1p4oA 1181 :QPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISS Number of specific fragments extracted= 10 number of extra gaps= 0 total=80 Number of alignments=7 # 1p4oA read from 1p4oA/merged-good-all-a2m # found chain 1p4oA in training set T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRK 1p4oA 965 :AREKITMSRELGQGSFGMVYEGVAK T0292 27 :SDG 1p4oA 993 :KDE T0292 30 :KILVWKELDYG 1p4oA 998 :TRVAIKTVNEA T0292 42 :MTEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1p4oA 1009 :ASMRERIEFLNEASVMKEFNCHHVVRLLGVV T0292 75 :RTNTTLYIVMEYCEGGDLASVIT 1p4oA 1040 :SQGQPTLVIMELMTRGDLKSYLR T0292 98 :KGTKERQYLDEEFVLRVMTQLTLALKECHRRS 1p4oA 1069 :ANNPVLAPPSLSKMIQMAGEIADGMAYLNANK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1p4oA 1101 :FVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYR T0292 172 :KAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCA 1p4oA 1140 :GKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIAT T0292 210 :LMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1p4oA 1179 :AEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEME Number of specific fragments extracted= 9 number of extra gaps= 0 total=89 Number of alignments=8 # 1p4oA read from 1p4oA/merged-good-all-a2m # found chain 1p4oA in training set T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRK 1p4oA 964 :VAREKITMSRELGQGSFGMVYEGVAK T0292 27 :SD 1p4oA 993 :KD T0292 29 :GKILVWKELDYG 1p4oA 997 :ETRVAIKTVNEA T0292 42 :MTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1p4oA 1009 :ASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQP T0292 80 :LYIVMEYCEGGDLASVITKGT 1p4oA 1045 :TLVIMELMTRGDLKSYLRSLR T0292 101 :KERQYLDEEFVLRVMTQLTLALKECHRR 1p4oA 1072 :PVLAPPSLSKMIQMAGEIADGMAYLNAN T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILN 1p4oA 1100 :KFVHRDLAARNCMVAEDFTVKIGDFGMTRDIY T0292 166 :HD 1p4oA 1141 :KG T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCA 1p4oA 1143 :LLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIAT T0292 210 :LMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 1p4oA 1179 :AEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISS T0292 269 :ILEHHHH 1p4oA 1236 :IKEEMEP Number of specific fragments extracted= 11 number of extra gaps= 0 total=100 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xwsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xwsA expands to /projects/compbio/data/pdb/1xws.pdb.gz 1xwsA:Skipped atom 956, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 958, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 960, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1217, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1219, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1221, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1223, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1532, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1534, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1536, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1538, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1540, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1851, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1853, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1859, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1861, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1863, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1865, because occupancy 0.350 <= existing 0.650 in 1xwsA Skipped atom 1867, because occupancy 0.350 <= existing 0.650 in 1xwsA # T0292 read from 1xwsA/merged-good-all-a2m # 1xwsA read from 1xwsA/merged-good-all-a2m # adding 1xwsA to template set # found chain 1xwsA in template set T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMT 1xwsA 34 :LESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRIS T0292 44 :EAE 1xwsA 81 :PNG T0292 52 :SEVNLLREL 1xwsA 88 :MEVVLLKKV T0292 61 :KHPNIVRYYDRI 1xwsA 99 :GFSGVIRLLDWF T0292 75 :RTNTTLYIVMEYCEG 1xwsA 111 :ERPDSFVLILERPEP T0292 90 :GDLASVITKGTK 1xwsA 127 :QDLFDFITERGA T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1xwsA 139 :LQEELARSFFWQVLEAVRHCHNCG T0292 135 :VLHRDLKPANVFL 1xwsA 163 :VLHRDIKDENILI T0292 148 :DGKQNVKLGDFGLARILNHD 1xwsA 177 :LNRGELKLIDFGSGALLKDT T0292 170 :FAKAFVGTPYYMSPEQMNRMSYN 1xwsA 197 :VYTDFDGTRVYSPPEWIRYHRYH T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFS 1xwsA 221 :RSAAVWSLGILLYDMVCGDIPFEHDE T0292 225 :KIREGKF 1xwsA 247 :EIIRGQV T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1xwsA 254 :FFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVL Number of specific fragments extracted= 13 number of extra gaps= 0 total=113 Number of alignments=10 # 1xwsA read from 1xwsA/merged-good-all-a2m # found chain 1xwsA in template set Warning: unaligning (T0292)R2 because first residue in template chain is (1xwsA)P33 T0292 3 :AED 1xwsA 34 :LES T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMT 1xwsA 38 :YQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRIS T0292 52 :SEVNLLRELKHP 1xwsA 88 :MEVVLLKKVSSG T0292 64 :NIVRYYDRI 1xwsA 102 :GVIRLLDWF T0292 75 :RTNTTLYIVMEYCEG 1xwsA 111 :ERPDSFVLILERPEP T0292 90 :GDLASVITKGTK 1xwsA 127 :QDLFDFITERGA T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1xwsA 139 :LQEELARSFFWQVLEAVRHCHNCG T0292 135 :VLHRDLKPANVFLD 1xwsA 163 :VLHRDIKDENILID T0292 149 :GKQNVKLGDFGLARILNH 1xwsA 178 :NRGELKLIDFGSGALLKD T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYN 1xwsA 196 :TVYTDFDGTRVYSPPEWIRYHRYH T0292 193 :EKSDIWSLGCLLYELCALMPPFTA 1xwsA 221 :RSAAVWSLGILLYDMVCGDIPFEH T0292 219 :QKE 1xwsA 245 :DEE T0292 226 :IREGKFR 1xwsA 248 :IIRGQVF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1xwsA 255 :FRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVL Number of specific fragments extracted= 14 number of extra gaps= 0 total=127 Number of alignments=11 # 1xwsA read from 1xwsA/merged-good-all-a2m # found chain 1xwsA in template set T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1xwsA 34 :LESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRI T0292 52 :SEVNLLREL 1xwsA 88 :MEVVLLKKV T0292 61 :KHPNIVRYYDRIIDRTN 1xwsA 99 :GFSGVIRLLDWFERPDS T0292 80 :LYIVMEYCEG 1xwsA 116 :FVLILERPEP T0292 90 :GDLASVITK 1xwsA 127 :QDLFDFITE T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1xwsA 136 :RGALQEELARSFFWQVLEAVRHCHNC T0292 134 :TVLHRDLKPANVFL 1xwsA 162 :GVLHRDIKDENILI T0292 148 :DGKQNVKLGDFGLARILNHD 1xwsA 177 :LNRGELKLIDFGSGALLKDT T0292 170 :FAKAFVGTPYYMSPEQMNRMSYN 1xwsA 197 :VYTDFDGTRVYSPPEWIRYHRYH T0292 193 :EKSDIWSLGCLLYELCALMPPFTAF 1xwsA 221 :RSAAVWSLGILLYDMVCGDIPFEHD T0292 224 :GKIREGKFR 1xwsA 246 :EEIIRGQVF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 1xwsA 255 :FRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLL Number of specific fragments extracted= 12 number of extra gaps= 0 total=139 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ia8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1ia8A/merged-good-all-a2m # 1ia8A read from 1ia8A/merged-good-all-a2m # found chain 1ia8A in training set Warning: unaligning (T0292)S41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ia8A)C48 Warning: unaligning (T0292)A45 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ia8A)C48 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 1ia8A 5 :FVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMK T0292 46 :E 1ia8A 49 :P T0292 48 :QMLVSEVNLLRELKHPNIVRYYDRI 1ia8A 50 :ENIKKEICINKMLNHENVVKFYGHR T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1ia8A 75 :REGNIQYLFLEYCSGGELFDRIEPDIG T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1ia8A 102 :MPEPDAQRFFHQLMAGVVYLHGIG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTS 1ia8A 126 :ITHRDIKPENLLLDERDNLKISDFGLATVFRYNNR T0292 170 :FAKAFVGTPYYMSPEQMNRMSYN 1ia8A 163 :LLNKMCGTLPYVAPELLKRREFH T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQK 1ia8A 187 :EPVDVWSCGIVLTAMLAGELPWDQPSDS T0292 221 :ELAGKIREGKF 1ia8A 216 :QEYSDWKEKKT T0292 233 :RIP 1ia8A 227 :YLN T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1ia8A 232 :KKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKP T0292 274 :HHH 1ia8A 272 :GAK Number of specific fragments extracted= 12 number of extra gaps= 0 total=151 Number of alignments=13 # 1ia8A read from 1ia8A/merged-good-all-a2m # found chain 1ia8A in training set Warning: unaligning (T0292)S41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ia8A)C48 Warning: unaligning (T0292)T43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ia8A)C48 T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 1ia8A 6 :VEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMK T0292 44 :EA 1ia8A 49 :PE T0292 49 :MLVSEVNLLRELKHPNIVRYYDRI 1ia8A 51 :NIKKEICINKMLNHENVVKFYGHR T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1ia8A 75 :REGNIQYLFLEYCSGGELFDRIEPDIG T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1ia8A 102 :MPEPDAQRFFHQLMAGVVYLHGIG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1ia8A 126 :ITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRER T0292 172 :KAFVGTPYYMSPEQMNRMSYN 1ia8A 165 :NKMCGTLPYVAPELLKRREFH T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQK 1ia8A 187 :EPVDVWSCGIVLTAMLAGELPWDQPSDS T0292 221 :ELAGKIREGKFR 1ia8A 216 :QEYSDWKEKKTY T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1ia8A 229 :NPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPL T0292 275 :HH 1ia8A 273 :AK Number of specific fragments extracted= 11 number of extra gaps= 0 total=162 Number of alignments=14 # 1ia8A read from 1ia8A/merged-good-all-a2m # found chain 1ia8A in training set Warning: unaligning (T0292)S41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ia8A)C48 Warning: unaligning (T0292)T43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ia8A)C48 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 1ia8A 5 :FVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMK T0292 44 :E 1ia8A 49 :P T0292 48 :QMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1ia8A 50 :ENIKKEICINKMLNHENVVKFYGHRREGNI T0292 80 :LYIVMEYCEGGDLASVITK 1ia8A 80 :QYLFLEYCSGGELFDRIEP T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1ia8A 99 :DIGMPEPDAQRFFHQLMAGVVYLHGI T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1ia8A 125 :GITHRDIKPENLLLDERDNLKISDFGLATVFRYN T0292 168 :TSFAKAFVGTPYYMSPEQMNRMSYN 1ia8A 161 :ERLLNKMCGTLPYVAPELLKRREFH T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQK 1ia8A 187 :EPVDVWSCGIVLTAMLAGELPWDQPSDS T0292 221 :ELAGKIREGKFRR 1ia8A 216 :QEYSDWKEKKTYL T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1ia8A 230 :PWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGA Number of specific fragments extracted= 10 number of extra gaps= 0 total=172 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bdwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bdwA expands to /projects/compbio/data/pdb/2bdw.pdb.gz 2bdwA:# T0292 read from 2bdwA/merged-good-all-a2m # 2bdwA read from 2bdwA/merged-good-all-a2m # adding 2bdwA to template set # found chain 2bdwA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRI 2bdwA 11 :DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSI T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 2bdwA 80 :QEESFHYLVFDLVTGGELFEDIVAREF T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bdwA 107 :YSEADASHCIQQILESIAYCHSNG T0292 135 :VLHRDLKPANVFL 2bdwA 131 :IVHRNLKPENLLL T0292 148 :DGKQNVKLGDFGLARILNHD 2bdwA 147 :AKGAAVKLADFGLAIEVNDS T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY 2bdwA 168 :EAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEW T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEH 2bdwA 241 :TPEAKSLIDSMLTVNPKKRITADQALKVPWICNR T0292 273 :HH 2bdwA 279 :SA Number of specific fragments extracted= 8 number of extra gaps= 0 total=180 Number of alignments=16 # 2bdwA read from 2bdwA/merged-good-all-a2m # found chain 2bdwA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRI 2bdwA 11 :DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSI T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 2bdwA 80 :QEESFHYLVFDLVTGGELFEDIVAREF T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bdwA 107 :YSEADASHCIQQILESIAYCHSNG T0292 135 :VLHRDLKPANVFL 2bdwA 131 :IVHRNLKPENLLL T0292 148 :DGKQNVKLGDFGLARILNHD 2bdwA 147 :AKGAAVKLADFGLAIEVNDS T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 2bdwA 168 :EAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYD T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 2bdwA 235 :PEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRE Number of specific fragments extracted= 7 number of extra gaps= 0 total=187 Number of alignments=17 # 2bdwA read from 2bdwA/merged-good-all-a2m # found chain 2bdwA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 2bdwA 11 :DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARICRKLQHPNIVRLHDSIQEESF T0292 80 :LYIVMEYCEGGDLASVITK 2bdwA 85 :HYLVFDLVTGGELFEDIVA T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 2bdwA 104 :REFYSEADASHCIQQILESIAYCHSN T0292 134 :TVLHRDLKPANVFL 2bdwA 130 :GIVHRNLKPENLLL T0292 148 :DGKQNVKLGDFGLARILNHD 2bdwA 147 :AKGAAVKLADFGLAIEVNDS T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 2bdwA 168 :EAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDY T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILE 2bdwA 236 :EWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWICN Number of specific fragments extracted= 7 number of extra gaps= 0 total=194 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2eueA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2eueA expands to /projects/compbio/data/pdb/2eue.pdb.gz 2eueA:# T0292 read from 2eueA/merged-good-all-a2m # 2eueA read from 2eueA/merged-good-all-a2m # adding 2eueA to template set # found chain 2eueA in template set Warning: unaligning (T0292)L9 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eueA)K59 Warning: unaligning (T0292)Y10 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eueA)K59 Warning: unaligning (T0292)G18 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)A67 Warning: unaligning (T0292)R19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)K68 Warning: unaligning (T0292)S41 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2eueA)M96 Warning: unaligning (T0292)T79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eueA)I128 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eueA)I128 Warning: unaligning (T0292)V83 because of BadResidue code BAD_PEPTIDE in next template residue (2eueA)I132 Warning: unaligning (T0292)M84 because of BadResidue code BAD_PEPTIDE at template residue (2eueA)I132 Warning: unaligning (T0292)A161 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2eueA)P215 Warning: unaligning (T0292)P178 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)P215 Warning: unaligning (T0292)N187 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2eueA)G230 Warning: unaligning (T0292)R188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)G230 T0292 2 :RAEDYEV 2eueA 51 :HIGNYQI T0292 20 :CQKIRRKSDGKILVWKELDYG 2eueA 69 :VKLAYHTTTGQKVALKIINKK T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRI 2eueA 97 :QGRIEREISYLRLLRHPHIIKLYDVI T0292 75 :RTNT 2eueA 123 :KSKD T0292 81 :YI 2eueA 129 :IM T0292 85 :EYCE 2eueA 133 :EYAG T0292 90 :GDLASVITKGTK 2eueA 137 :NELFDYIVQRDK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2eueA 149 :MSEQEARRFFQQIISAVEYCHRHK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGL 2eueA 173 :IVHRDLKPENLLLDEHLNVKIADFGL T0292 179 :YYMSPEQM 2eueA 216 :NYAAPEVI T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 2eueA 231 :PEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVY T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 2eueA 270 :TLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVD Number of specific fragments extracted= 12 number of extra gaps= 4 total=206 Number of alignments=19 # 2eueA read from 2eueA/merged-good-all-a2m # found chain 2eueA in template set Warning: unaligning (T0292)L9 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eueA)K59 Warning: unaligning (T0292)Y10 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eueA)K59 Warning: unaligning (T0292)G18 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)A67 Warning: unaligning (T0292)R19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)K68 Warning: unaligning (T0292)T43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)M96 Warning: unaligning (T0292)T79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eueA)I128 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eueA)I128 Warning: unaligning (T0292)V83 because of BadResidue code BAD_PEPTIDE in next template residue (2eueA)I132 Warning: unaligning (T0292)M84 because of BadResidue code BAD_PEPTIDE at template residue (2eueA)I132 Warning: unaligning (T0292)A161 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2eueA)P215 Warning: unaligning (T0292)P178 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)P215 Warning: unaligning (T0292)N187 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2eueA)G230 Warning: unaligning (T0292)R188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)G230 T0292 2 :RAEDYEV 2eueA 51 :HIGNYQI T0292 20 :CQKIRRKSDGKILVWKELDY 2eueA 69 :VKLAYHTTTGQKVALKIINK T0292 44 :EAEK 2eueA 97 :QGRI T0292 51 :VSEVNLLRELKHPNIVRYYDRI 2eueA 101 :EREISYLRLLRHPHIIKLYDVI T0292 75 :RTNT 2eueA 123 :KSKD T0292 81 :YI 2eueA 129 :IM T0292 85 :EYCEG 2eueA 133 :EYAGN T0292 91 :DLASVITKGTK 2eueA 138 :ELFDYIVQRDK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2eueA 149 :MSEQEARRFFQQIISAVEYCHRHK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGL 2eueA 173 :IVHRDLKPENLLLDEHLNVKIADFGL T0292 179 :YYMSPEQM 2eueA 216 :NYAAPEVI T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 2eueA 231 :PEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYT T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHH 2eueA 271 :LPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPE Number of specific fragments extracted= 13 number of extra gaps= 4 total=219 Number of alignments=20 # 2eueA read from 2eueA/merged-good-all-a2m # found chain 2eueA in template set Warning: unaligning (T0292)L9 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eueA)K59 Warning: unaligning (T0292)Y10 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eueA)K59 Warning: unaligning (T0292)G18 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)A67 Warning: unaligning (T0292)R19 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)K68 Warning: unaligning (T0292)T43 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)M96 Warning: unaligning (T0292)N77 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eueA)I128 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eueA)I128 Warning: unaligning (T0292)V83 because of BadResidue code BAD_PEPTIDE in next template residue (2eueA)I132 Warning: unaligning (T0292)M84 because of BadResidue code BAD_PEPTIDE at template residue (2eueA)I132 Warning: unaligning (T0292)A161 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2eueA)P215 Warning: unaligning (T0292)P178 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)P215 Warning: unaligning (T0292)N187 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2eueA)G230 Warning: unaligning (T0292)R188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2eueA)G230 T0292 3 :AEDYEV 2eueA 52 :IGNYQI T0292 20 :CQKIRRKSDGKILVWKELDY 2eueA 69 :VKLAYHTTTGQKVALKIINK T0292 44 :EA 2eueA 97 :QG T0292 49 :MLVSEVNLLRELKHPNIVRYYDRIIDRT 2eueA 99 :RIEREISYLRLLRHPHIIKLYDVIKSKD T0292 81 :YI 2eueA 129 :IM T0292 85 :EYCE 2eueA 133 :EYAG T0292 90 :GDLASVITK 2eueA 137 :NELFDYIVQ T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 2eueA 146 :RDKMSEQEARRFFQQIISAVEYCHRH T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGL 2eueA 172 :KIVHRDLKPENLLLDEHLNVKIADFGL T0292 179 :YYMSPEQM 2eueA 216 :NYAAPEVI T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 2eueA 231 :PEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYT T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHH 2eueA 271 :LPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFKVDLPE Number of specific fragments extracted= 12 number of extra gaps= 4 total=231 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rdqE/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1rdqE/merged-good-all-a2m # 1rdqE read from 1rdqE/merged-good-all-a2m # found chain 1rdqE in training set Warning: unaligning (T0292)C87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rdqE)A124 Warning: unaligning (T0292)E88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rdqE)A124 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rdqE)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rdqE)L198 Warning: unaligning (T0292)M189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rdqE)G214 Warning: unaligning (T0292)S190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rdqE)G214 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1rdqE 39 :QLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVK T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 1rdqE 83 :KQIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEY 1rdqE 111 :KDNSNLYMVMEY T0292 89 :GGDLASVITKGTK 1rdqE 125 :GGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1rdqE 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1rdqE 162 :LIYRDLKPENLLIDQQGYIQVTDFGFAKRVK T0292 169 :SFA 1rdqE 193 :GRT T0292 175 :VGTPYYMSPEQMNR 1rdqE 199 :CGTPEALAPEIILS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1rdqE 215 :YNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRP 1rdqE 256 :RFPSHFSSDLKDLLRNLLQVDLTKRF T0292 260 :VEEILENPLILEH 1rdqE 288 :VNDIKNHKWFATT Number of specific fragments extracted= 11 number of extra gaps= 2 total=242 Number of alignments=22 # 1rdqE read from 1rdqE/merged-good-all-a2m # found chain 1rdqE in training set Warning: unaligning (T0292)C87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rdqE)A124 Warning: unaligning (T0292)E88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rdqE)A124 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rdqE)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rdqE)L198 Warning: unaligning (T0292)M189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rdqE)G214 Warning: unaligning (T0292)S190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rdqE)G214 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1rdqE 39 :QLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1rdqE 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEY 1rdqE 111 :KDNSNLYMVMEY T0292 89 :GGDLASVITKGTK 1rdqE 125 :GGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1rdqE 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1rdqE 162 :LIYRDLKPENLLIDQQGYIQVTDFGFAKRVK T0292 169 :SFA 1rdqE 193 :GRT T0292 175 :VGTPYYMSPEQMNR 1rdqE 199 :CGTPEALAPEIILS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1rdqE 215 :YNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1rdqE 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 259 :SVEEILENPLILEHH 1rdqE 287 :GVNDIKNHKWFATTD Number of specific fragments extracted= 11 number of extra gaps= 2 total=253 Number of alignments=23 # 1rdqE read from 1rdqE/merged-good-all-a2m # found chain 1rdqE in training set Warning: unaligning (T0292)C87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rdqE)A124 Warning: unaligning (T0292)E88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rdqE)A124 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1rdqE)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1rdqE)L198 Warning: unaligning (T0292)M189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1rdqE)G214 Warning: unaligning (T0292)S190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1rdqE)G214 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1rdqE 38 :AQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1rdqE 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSN T0292 80 :LYIVMEY 1rdqE 116 :LYMVMEY T0292 89 :GGDLASVITK 1rdqE 125 :GGEMFSHLRR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1rdqE 135 :IGRFSEPHARFYAAQIVLTFEYLHSL T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1rdqE 161 :DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGR T0292 171 :A 1rdqE 195 :T T0292 175 :VGTPYYMSPEQMNR 1rdqE 199 :CGTPEALAPEIILS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1rdqE 215 :YNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1rdqE 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 261 :EEILENPLILEHH 1rdqE 289 :NDIKNHKWFATTD Number of specific fragments extracted= 11 number of extra gaps= 2 total=264 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t4hA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1t4hA/merged-good-all-a2m # 1t4hA read from 1t4hA/merged-good-all-a2m # found chain 1t4hA in training set Warning: unaligning (T0292)F170 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t4hA)A380 Warning: unaligning (T0292)A171 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t4hA)A380 Warning: unaligning (T0292)Y191 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t4hA)D400 Warning: unaligning (T0292)N192 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t4hA)D400 Warning: unaligning (T0292)L270 because last residue in template chain is (1t4hA)Q480 T0292 4 :EDYEVLY 1t4hA 218 :GRFLKFD T0292 11 :TIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRII 1t4hA 226 :EIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWE T0292 74 :DRTNTTLYIVMEYCEGGDLASVITKGTK 1t4hA 291 :VKGKKCIVLVTELMTSGTLKTYLKRFKV T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1t4hA 319 :MKIKVLRSWCRQILKGLQFLHTRT T0292 133 :HTVLHRDLKPANVFL 1t4hA 343 :PPIIHRDLKCDNIFI T0292 148 :DGKQNVKLGDFGLARILNHD 1t4hA 359 :GPTGSVKIGDLGLATLKRAS T0292 172 :KAFVGTPYYMSPEQM 1t4hA 381 :KAVIGTPEFMAPEMY T0292 188 :RMS 1t4hA 396 :EEK T0292 193 :EKSDIWSLGCLLYELCALMPPFTA 1t4hA 401 :ESVDVYAFGMCMLEMATSEYPYSE T0292 217 :FSQKELAGKIREGKFRRIPYRY 1t4hA 426 :QNAAQIYRRVTSGVKPASFDKV T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLI 1t4hA 449 :IPEVKEIIEGCIRQNKDERYSIKDLLNHAFF Number of specific fragments extracted= 11 number of extra gaps= 2 total=275 Number of alignments=25 # 1t4hA read from 1t4hA/merged-good-all-a2m # found chain 1t4hA in training set Warning: unaligning (T0292)F170 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t4hA)A380 Warning: unaligning (T0292)A171 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t4hA)A380 Warning: unaligning (T0292)Y191 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t4hA)D400 Warning: unaligning (T0292)N192 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t4hA)D400 Warning: unaligning (T0292)L270 because last residue in template chain is (1t4hA)Q480 T0292 4 :EDYEVLY 1t4hA 218 :GRFLKFD T0292 11 :TIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRII 1t4hA 226 :EIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWE T0292 74 :DRTNTTLYIVMEYCEGGDLASVITKGTK 1t4hA 291 :VKGKKCIVLVTELMTSGTLKTYLKRFKV T0292 106 :LDEEFVLRVMTQLTLALKECHRRSDG 1t4hA 319 :MKIKVLRSWCRQILKGLQFLHTRTPP T0292 135 :VLHRDLKPANVFL 1t4hA 345 :IIHRDLKCDNIFI T0292 148 :DGKQNVKLGDFGLARILNHD 1t4hA 359 :GPTGSVKIGDLGLATLKRAS T0292 172 :KAFVGTPYYMSPEQMN 1t4hA 381 :KAVIGTPEFMAPEMYE T0292 189 :MS 1t4hA 397 :EK T0292 193 :EKSDIWSLGCLLYELCALMPPFTA 1t4hA 401 :ESVDVYAFGMCMLEMATSEYPYSE T0292 217 :FSQKELAGKIREGKFRRIPYRYS 1t4hA 426 :QNAAQIYRRVTSGVKPASFDKVA T0292 240 :DELNEIITRMLNLKDYHRPSVEEILENPLI 1t4hA 450 :PEVKEIIEGCIRQNKDERYSIKDLLNHAFF Number of specific fragments extracted= 11 number of extra gaps= 2 total=286 Number of alignments=26 # 1t4hA read from 1t4hA/merged-good-all-a2m # found chain 1t4hA in training set Warning: unaligning (T0292)F170 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t4hA)A380 Warning: unaligning (T0292)A171 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t4hA)A380 Warning: unaligning (T0292)Y191 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1t4hA)D400 Warning: unaligning (T0292)N192 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1t4hA)D400 Warning: unaligning (T0292)L270 because last residue in template chain is (1t4hA)Q480 T0292 8 :VLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 1t4hA 223 :FDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWES T0292 75 :RTNTTLYIVMEYCEGGDLASVITK 1t4hA 292 :KGKKCIVLVTELMTSGTLKTYLKR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1t4hA 316 :FKVMKIKVLRSWCRQILKGLQFLHTR T0292 132 :GHTVLHRDLKPANVFL 1t4hA 342 :TPPIIHRDLKCDNIFI T0292 148 :DGKQNVKLGDFGLARILNHD 1t4hA 359 :GPTGSVKIGDLGLATLKRAS T0292 172 :KAFVGTPYYMSPEQMN 1t4hA 381 :KAVIGTPEFMAPEMYE T0292 189 :MS 1t4hA 397 :EK T0292 193 :EKSDIWSLGCLLYELCALMPPFTA 1t4hA 401 :ESVDVYAFGMCMLEMATSEYPYSE T0292 217 :FSQKELAGKIREGKFRRIPYRY 1t4hA 426 :QNAAQIYRRVTSGVKPASFDKV T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLI 1t4hA 449 :IPEVKEIIEGCIRQNKDERYSIKDLLNHAFF Number of specific fragments extracted= 10 number of extra gaps= 2 total=296 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1csn/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1csn expands to /projects/compbio/data/pdb/1csn.pdb.gz 1csn:Warning: there is no chain 1csn will retry with 1csnA # T0292 read from 1csn/merged-good-all-a2m # 1csn read from 1csn/merged-good-all-a2m # adding 1csn to template set # found chain 1csn in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGS 1csn 10 :VHYKVGRRIGEGSFGVIFEGTNLLNNQQVAIKFEPRRS T0292 42 :MTE 1csn 49 :APQ T0292 50 :LVSEVNLLREL 1csn 52 :LRDEYRTYKLL T0292 61 :KHPNIVRYYDRI 1csn 64 :GCTGIPNVYYFG T0292 75 :RTNTTLYIVMEYCE 1csn 76 :QEGLHNVLVIDLLG T0292 90 :GDLASVITKGTKE 1csn 90 :PSLEDLLDLCGRK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1csn 103 :FSVKTVAMAAKQMLARVQSIHEKS T0292 135 :VLHRDLKPANVFLDGKQN 1csn 127 :LVYRDIKPDNFLIGRPNS T0292 153 :VKLGDFGLARILNHDTSFAKA 1csn 150 :IYVVDFGMVKFYRDPVTKQHI T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFS 1csn 178 :LSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGSLPWQGLK T0292 219 :QKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 1csn 230 :YERIGEKKQSTPLRELCAGFPEEFYKYMHYARNLAFDATPDYDYLQGL Number of specific fragments extracted= 11 number of extra gaps= 0 total=307 Number of alignments=28 # 1csn read from 1csn/merged-good-all-a2m # found chain 1csn in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1csn 10 :VHYKVGRRIGEGSFGVIFEGTNLLNNQQVAIKFEPRRSD T0292 43 :T 1csn 51 :Q T0292 50 :LVSEVNLLREL 1csn 52 :LRDEYRTYKLL T0292 61 :KHPNIVRYYDRI 1csn 64 :GCTGIPNVYYFG T0292 75 :RTNTTLYIVMEYCE 1csn 76 :QEGLHNVLVIDLLG T0292 90 :GDLASVITKGTKE 1csn 90 :PSLEDLLDLCGRK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1csn 103 :FSVKTVAMAAKQMLARVQSIHEKS T0292 135 :VLHRDLKPANVFLDGKQ 1csn 127 :LVYRDIKPDNFLIGRPN T0292 152 :NVKLGDFGLARILNHDTSFA 1csn 149 :MIYVVDFGMVKFYRDPVTKQ T0292 172 :KAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTA 1csn 176 :KNLSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGSLPWQG T0292 217 :FSQKELAGKIRE 1csn 224 :ATNKQKYERIGE T0292 229 :GKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENP 1csn 240 :TPLRELCAGFPEEFYKYMHYARNLAFDATPDYDYLQGLF Number of specific fragments extracted= 12 number of extra gaps= 0 total=319 Number of alignments=29 # 1csn read from 1csn/merged-good-all-a2m # found chain 1csn in template set T0292 5 :DYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1csn 11 :HYKVGRRIGEGSFGVIFEGTNLLNNQQVAIKFEPRRSD T0292 43 :T 1csn 51 :Q T0292 50 :LVSEVNLLREL 1csn 52 :LRDEYRTYKLL T0292 61 :KHPNIVRYYDRIIDRTN 1csn 64 :GCTGIPNVYYFGQEGLH T0292 80 :LYIVMEYCE 1csn 81 :NVLVIDLLG T0292 90 :GDLASVITK 1csn 90 :PSLEDLLDL T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRR 1csn 99 :CGRKFSVKTVAMAAKQMLARVQSIHEK T0292 134 :TVLHRDLKPANVFL 1csn 126 :SLVYRDIKPDNFLI T0292 148 :DGKQNVKLGDFGLARILN 1csn 145 :KNANMIYVVDFGMVKFYR T0292 166 :HDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFS 1csn 170 :IPYREKKNLSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGSLPWQGLK T0292 219 :QKELAGKIREGK 1csn 230 :YERIGEKKQSTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILE 1csn 245 :LCAGFPEEFYKYMHYARNLAFDATPDYDYLQG Number of specific fragments extracted= 12 number of extra gaps= 0 total=331 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1blxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1blxA expands to /projects/compbio/data/pdb/1blx.pdb.gz 1blxA:# T0292 read from 1blxA/merged-good-all-a2m # 1blxA read from 1blxA/merged-good-all-a2m # adding 1blxA to template set # found chain 1blxA in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)K29 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)K29 Warning: unaligning (T0292)T43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)S57 Warning: unaligning (T0292)A45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)S57 Warning: unaligning (T0292)I72 because of BadResidue code BAD_PEPTIDE in next template residue (1blxA)T84 Warning: unaligning (T0292)I73 because of BadResidue code BAD_PEPTIDE at template residue (1blxA)T84 Warning: unaligning (T0292)A143 because of BadResidue code BAD_PEPTIDE in next template residue (1blxA)N150 Warning: unaligning (T0292)N144 because of BadResidue code BAD_PEPTIDE at template residue (1blxA)N150 Warning: unaligning (T0292)D167 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)Q173 Warning: unaligning (T0292)T168 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)Q173 Warning: unaligning (T0292)A173 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)V179 Warning: unaligning (T0292)F174 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)V179 T0292 3 :AEDYEVLYTIGTGSYGRC 1blxA 10 :DQQYECVAEIGEGAYGKV T0292 23 :IRRKS 1blxA 30 :ARDLK T0292 28 :DGKILVWKELDY 1blxA 36 :GGRFVALKRVRV T0292 40 :GSM 1blxA 53 :GMP T0292 46 :EKQMLVSEVN 1blxA 58 :TIREVAVLRH T0292 57 :LRELKHPNIVRYYDR 1blxA 68 :LETFEHPNVVRLFDV T0292 74 :DRTNTTLYIVMEYCE 1blxA 88 :TDRETKLTLVFEHVD T0292 90 :GDLASVITKG 1blxA 103 :QDLTTYLDKV T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRRS 1blxA 113 :PEPGVPTETIKDMMFQLLRGLDFLHSHR T0292 135 :VLHRDLKP 1blxA 141 :VVHRDLKP T0292 145 :VFLDGKQNVKLGDFGLAR 1blxA 151 :ILVTSSGQIKLADFGLAR T0292 164 :LNH 1blxA 169 :IYS T0292 169 :SFAK 1blxA 174 :MALT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1blxA 180 :VVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILD T0292 229 :GKFRRIPYRY 1blxA 245 :RDVALPRQAF T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1blxA 270 :DELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKE Number of specific fragments extracted= 16 number of extra gaps= 6 total=347 Number of alignments=31 # 1blxA read from 1blxA/merged-good-all-a2m # found chain 1blxA in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)K29 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)K29 Warning: unaligning (T0292)T43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)S57 Warning: unaligning (T0292)E44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)S57 Warning: unaligning (T0292)I72 because of BadResidue code BAD_PEPTIDE in next template residue (1blxA)T84 Warning: unaligning (T0292)I73 because of BadResidue code BAD_PEPTIDE at template residue (1blxA)T84 Warning: unaligning (T0292)A143 because of BadResidue code BAD_PEPTIDE in next template residue (1blxA)N150 Warning: unaligning (T0292)N144 because of BadResidue code BAD_PEPTIDE at template residue (1blxA)N150 Warning: unaligning (T0292)D167 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)Q173 Warning: unaligning (T0292)T168 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)Q173 Warning: unaligning (T0292)A173 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)V179 Warning: unaligning (T0292)F174 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)V179 T0292 2 :RAED 1blxA 8 :RADQ T0292 6 :YEVLYTIGTGSYGRC 1blxA 13 :YECVAEIGEGAYGKV T0292 23 :IRRKS 1blxA 30 :ARDLK T0292 28 :DGKILVWKELDY 1blxA 36 :GGRFVALKRVRV T0292 40 :GSM 1blxA 53 :GMP T0292 50 :LVSEVNLLREL 1blxA 58 :TIREVAVLRHL T0292 61 :KHPNIVRYYDR 1blxA 72 :EHPNVVRLFDV T0292 74 :DRTNTT 1blxA 86 :SRTDRE T0292 80 :LYIVMEYCEG 1blxA 94 :LTLVFEHVDQ T0292 91 :DLASVITKGTKER 1blxA 104 :DLTTYLDKVPEPG T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1blxA 117 :VPTETIKDMMFQLLRGLDFLHSHR T0292 135 :VLHRDLKP 1blxA 141 :VVHRDLKP T0292 145 :VFLDGKQNVKLGDFGLARI 1blxA 151 :ILVTSSGQIKLADFGLARI T0292 165 :NH 1blxA 170 :YS T0292 169 :SFAK 1blxA 174 :MALT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 1blxA 180 :VVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEED T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1blxA 269 :IDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKE Number of specific fragments extracted= 17 number of extra gaps= 6 total=364 Number of alignments=32 # 1blxA read from 1blxA/merged-good-all-a2m # found chain 1blxA in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)K29 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)K29 Warning: unaligning (T0292)T43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)S57 Warning: unaligning (T0292)E44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)S57 Warning: unaligning (T0292)I72 because of BadResidue code BAD_PEPTIDE in next template residue (1blxA)T84 Warning: unaligning (T0292)I73 because of BadResidue code BAD_PEPTIDE at template residue (1blxA)T84 Warning: unaligning (T0292)A143 because of BadResidue code BAD_PEPTIDE in next template residue (1blxA)N150 Warning: unaligning (T0292)N144 because of BadResidue code BAD_PEPTIDE at template residue (1blxA)N150 Warning: unaligning (T0292)H166 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)Q173 Warning: unaligning (T0292)D167 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)Q173 Warning: unaligning (T0292)A173 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1blxA)V179 Warning: unaligning (T0292)F174 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1blxA)V179 T0292 3 :AEDYEVLYTIGTGSYGRC 1blxA 10 :DQQYECVAEIGEGAYGKV T0292 23 :IRRKSD 1blxA 30 :ARDLKN T0292 29 :GKILVWKELDY 1blxA 37 :GRFVALKRVRV T0292 40 :GS 1blxA 53 :GM T0292 50 :LVSEVNLLREL 1blxA 58 :TIREVAVLRHL T0292 61 :KHPNIVRYYDR 1blxA 72 :EHPNVVRLFDV T0292 74 :DRTNTTLYIVMEYCEG 1blxA 88 :TDRETKLTLVFEHVDQ T0292 91 :DLASVITK 1blxA 104 :DLTTYLDK T0292 101 :KERQYLDEEFVLRVMTQLTLALKECHRR 1blxA 112 :VPEPGVPTETIKDMMFQLLRGLDFLHSH T0292 134 :TVLHRDLKP 1blxA 140 :RVVHRDLKP T0292 145 :VFLDGKQNVKLGDFGLARILN 1blxA 151 :ILVTSSGQIKLADFGLARIYS T0292 169 :SFAK 1blxA 174 :MALT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1blxA 180 :VVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1blxA 265 :FVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKE Number of specific fragments extracted= 14 number of extra gaps= 6 total=378 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xh9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xh9A expands to /projects/compbio/data/pdb/1xh9.pdb.gz 1xh9A:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 1xh9A/merged-good-all-a2m # 1xh9A read from 1xh9A/merged-good-all-a2m # adding 1xh9A to template set # found chain 1xh9A in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xh9A)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xh9A)L198 Warning: unaligning (T0292)M189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xh9A)G214 Warning: unaligning (T0292)S190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xh9A)G214 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1xh9A 39 :HLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVK T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 1xh9A 83 :KEIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1xh9A 111 :KDNSNLYMVMEYAPGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1xh9A 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1xh9A 162 :LIYRDLKPENLMIDQQGYIKVTDFGLAKRVK T0292 169 :SFA 1xh9A 193 :GRT T0292 175 :VGTPYYMSPEQMNR 1xh9A 199 :CGTPEYLAPEIILS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1xh9A 215 :YNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRP 1xh9A 256 :RFPSHFSSDLKDLLRNLLQVDLTKRF T0292 260 :VEEILENPLILEH 1xh9A 288 :VNDIKNHKWFATT Number of specific fragments extracted= 10 number of extra gaps= 1 total=388 Number of alignments=34 # 1xh9A read from 1xh9A/merged-good-all-a2m # found chain 1xh9A in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xh9A)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xh9A)L198 Warning: unaligning (T0292)M189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xh9A)G214 Warning: unaligning (T0292)S190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xh9A)G214 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1xh9A 39 :HLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1xh9A 81 :KLKEIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1xh9A 111 :KDNSNLYMVMEYAPGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1xh9A 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1xh9A 162 :LIYRDLKPENLMIDQQGYIKVTDFGLAKRVK T0292 169 :SFA 1xh9A 193 :GRT T0292 175 :VGTPYYMSPEQMNR 1xh9A 199 :CGTPEYLAPEIILS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1xh9A 215 :YNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1xh9A 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 259 :SVEEILENPLILEHH 1xh9A 287 :GVNDIKNHKWFATTD Number of specific fragments extracted= 10 number of extra gaps= 1 total=398 Number of alignments=35 # 1xh9A read from 1xh9A/merged-good-all-a2m # found chain 1xh9A in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xh9A)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xh9A)L198 Warning: unaligning (T0292)M189 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1xh9A)G214 Warning: unaligning (T0292)S190 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1xh9A)G214 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1xh9A 38 :AHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1xh9A 81 :KLKEIEHTLNEKRILQAVNFPFLVKLEFSFKDNSN T0292 80 :LYIVMEYCEGGDLASVITK 1xh9A 116 :LYMVMEYAPGGEMFSHLRR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1xh9A 135 :IGRFSEPHARFYAAQIVLTFEYLHSL T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1xh9A 161 :DLIYRDLKPENLMIDQQGYIKVTDFGLAKRVKGR T0292 171 :A 1xh9A 195 :T T0292 175 :VGTPYYMSPEQMNR 1xh9A 199 :CGTPEYLAPEIILS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1xh9A 215 :YNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1xh9A 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 261 :EEILENPLILEH 1xh9A 289 :NDIKNHKWFATT Number of specific fragments extracted= 10 number of extra gaps= 1 total=408 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jvpP/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jvpP expands to /projects/compbio/data/pdb/1jvp.pdb.gz 1jvpP:Skipped atom 173, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 175, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 177, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 179, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 181, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 183, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 185, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 449, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 451, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 453, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 455, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 601, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 603, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 605, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 607, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 609, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 611, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 613, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 615, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 617, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 619, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 621, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 623, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 625, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 627, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 629, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 631, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 633, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 635, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 637, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 639, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 641, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 643, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 645, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 647, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 649, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 651, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 653, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 663, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 665, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 677, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 679, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 681, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 683, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 685, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 687, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 689, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 691, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 693, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 949, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 951, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1009, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1011, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1013, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1015, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1017, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1019, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1044, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1046, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1048, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1050, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1081, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1083, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1085, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1087, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1176, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1178, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1180, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1182, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1184, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1186, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1188, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1190, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1192, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1194, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1196, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1198, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1200, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1202, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1204, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1206, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1208, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1210, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1212, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1214, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1216, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1218, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1220, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1222, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1224, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1226, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1228, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1230, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1232, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1234, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1236, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1288, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1290, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1292, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1332, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1334, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1336, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1338, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1340, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1342, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 1344, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2006, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2008, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2010, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2012, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2014, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2016, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2018, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2020, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2022, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2024, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2026, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2028, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2030, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2032, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2034, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2036, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2038, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2040, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2042, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2044, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2046, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2048, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2050, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2052, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2054, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2056, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2058, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2060, because occupancy 0.500 <= existing 0.500 in 1jvpP Skipped atom 2062, because occupancy 0.500 <= existing 0.500 in 1jvpP # T0292 read from 1jvpP/merged-good-all-a2m # 1jvpP read from 1jvpP/merged-good-all-a2m # adding 1jvpP to template set # found chain 1jvpP in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1jvpP)M1 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jvpP)V44 Warning: unaligning (T0292)M42 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jvpP)V44 Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jvpP)V163 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jvpP)V163 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 1jvpP 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKI T0292 43 :TEAE 1jvpP 45 :PSTA T0292 51 :VSEVNLLRELKHPNIVRYYDRI 1jvpP 49 :IREISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEYCE 1jvpP 71 :HTENKLYLVFEFLH T0292 90 :GDLASVITKG 1jvpP 85 :QDLKKFMDAS T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRRS 1jvpP 95 :ALTGIPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1jvpP 123 :VLHRDLKPQNLLINTEGAIKLADFGLARA T0292 176 :GTPYYMSPEQMNR 1jvpP 164 :VTLWYRAPEILLG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1jvpP 178 :KYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFR T0292 229 :GKFRRIP 1jvpP 238 :PSFPKWA T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1jvpP 253 :PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 11 number of extra gaps= 0 total=419 Number of alignments=37 # 1jvpP read from 1jvpP/merged-good-all-a2m # found chain 1jvpP in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1jvpP)M1 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jvpP)V44 Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jvpP)V163 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jvpP)V163 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 1jvpP 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKI T0292 43 :TEAEK 1jvpP 45 :PSTAI T0292 52 :SEVNLLRELKHPNIVRYYDRI 1jvpP 50 :REISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEYCEG 1jvpP 71 :HTENKLYLVFEFLHQ T0292 91 :DLASVITKGTKER 1jvpP 86 :DLKKFMDASALTG T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1jvpP 99 :IPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1jvpP 123 :VLHRDLKPQNLLINTEGAIKLADFGLARA T0292 176 :GTPYYMSPEQMNR 1jvpP 164 :VTLWYRAPEILLG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 1jvpP 178 :KYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVV T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1jvpP 255 :LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVT T0292 274 :HHHH 1jvpP 295 :HLRL Number of specific fragments extracted= 11 number of extra gaps= 0 total=430 Number of alignments=38 # 1jvpP read from 1jvpP/merged-good-all-a2m # found chain 1jvpP in template set Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jvpP)V44 Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jvpP)V163 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jvpP)V163 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 1jvpP 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKI T0292 43 :TEAEK 1jvpP 45 :PSTAI T0292 52 :SEVNLLRELKHPNIVRYYDRIIDRTN 1jvpP 50 :REISLLKELNHPNIVKLLDVIHTENK T0292 80 :LYIVMEYCEG 1jvpP 76 :LYLVFEFLHQ T0292 91 :DLASVITK 1jvpP 86 :DLKKFMDA T0292 101 :KERQYLDEEFVLRVMTQLTLALKECHRR 1jvpP 94 :SALTGIPLPLIKSYLFQLLQGLAFCHSH T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARI 1jvpP 122 :RVLHRDLKPQNLLINTEGAIKLADFGLARA T0292 176 :GTPYYMSPEQMNR 1jvpP 164 :VTLWYRAPEILLG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1jvpP 178 :KYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1jvpP 251 :VVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 10 number of extra gaps= 0 total=440 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p4fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1p4fA expands to /projects/compbio/data/pdb/1p4f.pdb.gz 1p4fA:Skipped atom 166, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 168, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 170, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 172, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 174, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 176, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 178, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 180, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 182, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 184, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 186, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 188, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 190, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1110, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1112, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1114, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1116, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1118, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1120, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1122, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1124, because occupancy 0.500 <= existing 0.500 in 1p4fA Skipped atom 1126, because occupancy 0.500 <= existing 0.500 in 1p4fA # T0292 read from 1p4fA/merged-good-all-a2m # 1p4fA read from 1p4fA/merged-good-all-a2m # adding 1p4fA to template set # found chain 1p4fA in template set Warning: unaligning (T0292)T79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p4fA)V89 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p4fA)V89 Warning: unaligning (T0292)V95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)T112 Warning: unaligning (T0292)D107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1p4fA)T112 Warning: unaligning (T0292)Q151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)P155 Warning: unaligning (T0292)N152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1p4fA)P155 Warning: unaligning (T0292)E271 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)Q292 T0292 2 :RAED 1p4fA 8 :NVDD T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1p4fA 13 :YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKK T0292 40 :GSMTEA 1p4fA 49 :TKSSRR T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRI 1p4fA 58 :REDIEREVSILKEIQHPNVITLHEVY T0292 75 :RTNT 1p4fA 84 :ENKT T0292 81 :YIVMEYCEGGDLAS 1p4fA 90 :ILILELVAGGELFD T0292 108 :EEFVLRVMTQLTLALKECHRRS 1p4fA 113 :EEEATEFLKQILNGVYYLHSLQ T0292 135 :VLHRDLKPANVFL 1p4fA 135 :IAHFDLKPENIML T0292 148 :DGK 1p4fA 149 :DRN T0292 153 :VKLGDFGLARILNHD 1p4fA 157 :IKIIDFGLAHKIDFG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIP 1p4fA 172 :NEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFED T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1p4fA 242 :SNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIK Number of specific fragments extracted= 12 number of extra gaps= 2 total=452 Number of alignments=40 # 1p4fA read from 1p4fA/merged-good-all-a2m # found chain 1p4fA in template set Warning: unaligning (T0292)T79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p4fA)V89 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p4fA)V89 Warning: unaligning (T0292)V95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)T112 Warning: unaligning (T0292)D107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1p4fA)T112 Warning: unaligning (T0292)Q151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)P155 Warning: unaligning (T0292)E271 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)Q292 T0292 1 :SRAED 1p4fA 7 :ENVDD T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1p4fA 13 :YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKK T0292 40 :GSMTEAE 1p4fA 54 :RGVSRED T0292 50 :LVSEVNLLRELKHPNIVRYYDRI 1p4fA 61 :IEREVSILKEIQHPNVITLHEVY T0292 75 :RTNT 1p4fA 84 :ENKT T0292 81 :YIVMEYCEGGDLAS 1p4fA 90 :ILILELVAGGELFD T0292 108 :EEFVLRVMTQLTLALKECHRRS 1p4fA 113 :EEEATEFLKQILNGVYYLHSLQ T0292 135 :VLHRDLKPANVFL 1p4fA 135 :IAHFDLKPENIML T0292 148 :DGK 1p4fA 149 :DRN T0292 152 :NVKLGDFGLARILNHD 1p4fA 156 :RIKIIDFGLAHKIDFG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIP 1p4fA 172 :NEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFED T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1p4fA 242 :SNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIK Number of specific fragments extracted= 12 number of extra gaps= 2 total=464 Number of alignments=41 # 1p4fA read from 1p4fA/merged-good-all-a2m # found chain 1p4fA in template set Warning: unaligning (T0292)N77 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1p4fA)V89 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1p4fA)V89 Warning: unaligning (T0292)V95 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)T112 Warning: unaligning (T0292)D107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1p4fA)T112 Warning: unaligning (T0292)E271 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1p4fA)Q292 T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1p4fA 10 :DDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKK T0292 43 :T 1p4fA 57 :S T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRIIDRT 1p4fA 58 :REDIEREVSILKEIQHPNVITLHEVYENKT T0292 81 :YIVMEYCEGGDLAS 1p4fA 90 :ILILELVAGGELFD T0292 108 :EEFVLRVMTQLTLALKECHRR 1p4fA 113 :EEEATEFLKQILNGVYYLHSL T0292 134 :TVLHRDLKPANVFL 1p4fA 134 :QIAHFDLKPENIML T0292 148 :DGK 1p4fA 149 :DRN T0292 152 :NVKLGDFGLARILNHD 1p4fA 156 :RIKIIDFGLAHKIDFG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1p4fA 172 :NEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1p4fA 240 :YFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIK Number of specific fragments extracted= 10 number of extra gaps= 1 total=474 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b9hA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b9hA expands to /projects/compbio/data/pdb/2b9h.pdb.gz 2b9hA:# T0292 read from 2b9hA/merged-good-all-a2m # 2b9hA read from 2b9hA/merged-good-all-a2m # adding 2b9hA to template set # found chain 2b9hA in template set Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b9hA)V180 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b9hA)V180 T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 2b9hA 10 :SSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEP T0292 43 :TEAEK 2b9hA 47 :FDKPL T0292 48 :QMLVSEVNLLRELKHPNIVRYYDRII 2b9hA 54 :LRTLREIKILKHFKHENIITIFNIQR T0292 74 :DRTNTTLYIVMEYCE 2b9hA 83 :FENFNEVYIIQELMQ T0292 90 :GDLASVITKGT 2b9hA 98 :TDLHRVISTQM T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2b9hA 109 :LSDDHIQYFIYQTLRAVKVLHGSN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARIL 2b9hA 133 :VIHRDLKPSNLLINSNCDLKVCDFGLARII T0292 173 :AFVGTPYYMSPEQM 2b9hA 181 :EFVATRWYRAPEVM T0292 187 :NRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 2b9hA 196 :TSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFG T0292 231 :FRRIP 2b9hA 263 :LPMYP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 2b9hA 276 :PRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTY Number of specific fragments extracted= 11 number of extra gaps= 0 total=485 Number of alignments=43 # 2b9hA read from 2b9hA/merged-good-all-a2m # found chain 2b9hA in template set Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b9hA)V180 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b9hA)V180 T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 2b9hA 10 :SSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEP T0292 40 :G 2b9hA 48 :D T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRII 2b9hA 49 :KPLFALRTLREIKILKHFKHENIITIFNIQR T0292 74 :D 2b9hA 82 :S T0292 75 :RTNTTLYIVMEYCEG 2b9hA 84 :ENFNEVYIIQELMQT T0292 91 :DLASVITKGT 2b9hA 99 :DLHRVISTQM T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2b9hA 109 :LSDDHIQYFIYQTLRAVKVLHGSN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARIL 2b9hA 133 :VIHRDLKPSNLLINSNCDLKVCDFGLARII T0292 173 :AFVGTPYYMSPEQMNR 2b9hA 181 :EFVATRWYRAPEVMLT T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 2b9hA 198 :AKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGTPHSDN T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 2b9hA 278 :VNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYH Number of specific fragments extracted= 11 number of extra gaps= 0 total=496 Number of alignments=44 # 2b9hA read from 2b9hA/merged-good-all-a2m # found chain 2b9hA in template set Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2b9hA)V180 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2b9hA)V180 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 2b9hA 11 :SDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKIEP T0292 42 :MTEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 2b9hA 48 :DKPLFALRTLREIKILKHFKHENIITIFNIQRP T0292 75 :RTNTTLYIVMEYCEG 2b9hA 84 :ENFNEVYIIQELMQT T0292 91 :DLASVITK 2b9hA 99 :DLHRVIST T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 2b9hA 107 :QMLSDDHIQYFIYQTLRAVKVLHGS T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARIL 2b9hA 132 :NVIHRDLKPSNLLINSNCDLKVCDFGLARII T0292 173 :AFVGTPYYMSPEQMNR 2b9hA 181 :EFVATRWYRAPEVMLT T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 2b9hA 198 :AKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFG T0292 229 :GKFRR 2b9hA 240 :GTPHS T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 2b9hA 274 :MFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPND Number of specific fragments extracted= 10 number of extra gaps= 0 total=506 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bfxA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bfxA expands to /projects/compbio/data/pdb/2bfx.pdb.gz 2bfxA:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 2bfxA/merged-good-all-a2m # 2bfxA read from 2bfxA/merged-good-all-a2m # adding 2bfxA to template set # found chain 2bfxA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bfxA)M249 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bfxA)M249 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 2bfxA 89 :TIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQLEKEG T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRI 2bfxA 135 :EHQLRREIEIQSHLRHPNILRMYNYF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 2bfxA 161 :HDRKRIYLMLEFAPRGELYKELQKHGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bfxA 188 :FDEQRSATFMEELADALHYCHERK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARIL 2bfxA 212 :VIHRDIKPENLLMGYKGELKIADFGWSVHA T0292 167 :DTSFA 2bfxA 242 :PSLRR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 2bfxA 250 :CGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSPSHTETHRRIVNVDL T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 2bfxA 307 :KFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKAN T0292 275 :HH 2bfxA 350 :VL Number of specific fragments extracted= 9 number of extra gaps= 0 total=515 Number of alignments=46 # 2bfxA read from 2bfxA/merged-good-all-a2m # found chain 2bfxA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bfxA)M249 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bfxA)M249 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 2bfxA 89 :TIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQL T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 2bfxA 131 :KEGVEHQLRREIEIQSHLRHPNILRMYNYF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 2bfxA 161 :HDRKRIYLMLEFAPRGELYKELQKHGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bfxA 188 :FDEQRSATFMEELADALHYCHERK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 2bfxA 212 :VIHRDIKPENLLMGYKGELKIADFGWSVHAP T0292 168 :TSFA 2bfxA 243 :SLRR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 2bfxA 250 :CGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSPSHTETHRRIVNVDLK T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 2bfxA 308 :FPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL Number of specific fragments extracted= 8 number of extra gaps= 0 total=523 Number of alignments=47 # 2bfxA read from 2bfxA/merged-good-all-a2m # found chain 2bfxA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bfxA)M249 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bfxA)M249 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 2bfxA 89 :TIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQL T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 2bfxA 131 :KEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKR T0292 80 :LYIVMEYCEGGDLASVITK 2bfxA 166 :IYLMLEFAPRGELYKELQK T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 2bfxA 185 :HGRFDEQRSATFMEELADALHYCHER T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 2bfxA 211 :KVIHRDIKPENLLMGYKGELKIADFGWSVHAPSL T0292 170 :FA 2bfxA 245 :RR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 2bfxA 250 :CGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSPSHTETHRRIVNVDLK T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 2bfxA 308 :FPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL Number of specific fragments extracted= 8 number of extra gaps= 0 total=531 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gz8A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1gz8A/merged-good-all-a2m # 1gz8A read from 1gz8A/merged-good-all-a2m # found chain 1gz8A in training set Warning: unaligning (T0292)A3 because first residue in template chain is (1gz8A)M1 Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1gz8A)K20 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1gz8A)K20 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1gz8A)V44 Warning: unaligning (T0292)M42 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1gz8A)V44 Warning: unaligning (T0292)R188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1gz8A)K178 Warning: unaligning (T0292)S190 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1gz8A)K178 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE at template residue (1gz8A)S181 Warning: unaligning (T0292)Y236 because of BadResidue code BAD_PEPTIDE at template residue (1gz8A)P253 T0292 4 :EDYEVLYTIGTGSYGRC 1gz8A 2 :ENFQKVEKIGEGTYGVV T0292 23 :IRRKSDGKILVWKEL 1gz8A 21 :ARNKLTGEVVALKKI T0292 43 :TEA 1gz8A 45 :PST T0292 50 :LVSEVNLLRELKHPNIVRYYDRI 1gz8A 48 :AIREISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEYCE 1gz8A 71 :HTENKLYLVFEFLH T0292 90 :GDLASVITKG 1gz8A 85 :QDLKKFMDAS T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRRS 1gz8A 95 :ALTGIPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMN 1gz8A 123 :VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILL T0292 191 :Y 1gz8A 179 :Y T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1gz8A 182 :TAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFR T0292 229 :GKFRRIP 1gz8A 238 :PSFPKWA T0292 237 :RYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1gz8A 254 :PLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 12 number of extra gaps= 3 total=543 Number of alignments=49 # 1gz8A read from 1gz8A/merged-good-all-a2m # found chain 1gz8A in training set Warning: unaligning (T0292)A3 because first residue in template chain is (1gz8A)M1 Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1gz8A)K20 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1gz8A)K20 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1gz8A)V44 Warning: unaligning (T0292)R188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1gz8A)K178 Warning: unaligning (T0292)M189 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1gz8A)K178 Warning: unaligning (T0292)Y191 because of BadResidue code BAD_PEPTIDE in next template residue (1gz8A)S181 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE at template residue (1gz8A)S181 T0292 4 :EDYEVLYTIGTGSYGRC 1gz8A 2 :ENFQKVEKIGEGTYGVV T0292 23 :IRRKSDGKILVWKEL 1gz8A 21 :ARNKLTGEVVALKKI T0292 43 :TEA 1gz8A 45 :PST T0292 50 :LVSEVNLLRELKHPNIVRYYDRI 1gz8A 48 :AIREISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEYCEG 1gz8A 71 :HTENKLYLVFEFLHQ T0292 91 :DLASVITKGTKER 1gz8A 86 :DLKKFMDASALTG T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1gz8A 99 :IPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMN 1gz8A 123 :VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILL T0292 190 :S 1gz8A 179 :Y T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 1gz8A 182 :TAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVV T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1gz8A 255 :LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVT T0292 274 :HHHH 1gz8A 295 :HLRL Number of specific fragments extracted= 12 number of extra gaps= 2 total=555 Number of alignments=50 # 1gz8A read from 1gz8A/merged-good-all-a2m # found chain 1gz8A in training set Warning: unaligning (T0292)A3 because first residue in template chain is (1gz8A)M1 Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1gz8A)K20 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1gz8A)K20 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1gz8A)V44 Warning: unaligning (T0292)R188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1gz8A)K178 Warning: unaligning (T0292)M189 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1gz8A)K178 Warning: unaligning (T0292)Y191 because of BadResidue code BAD_PEPTIDE in next template residue (1gz8A)S181 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE at template residue (1gz8A)S181 Warning: unaligning (T0292)P235 because of BadResidue code BAD_PEPTIDE in next template residue (1gz8A)P253 Warning: unaligning (T0292)Y236 because of BadResidue code BAD_PEPTIDE at template residue (1gz8A)P253 T0292 4 :EDYEVLYTIGTGSYGRC 1gz8A 2 :ENFQKVEKIGEGTYGVV T0292 23 :IRRKSDGKILVWKEL 1gz8A 21 :ARNKLTGEVVALKKI T0292 43 :TEAE 1gz8A 45 :PSTA T0292 51 :VSEVNLLRELKHPNIVRYYDRIIDRTN 1gz8A 49 :IREISLLKELNHPNIVKLLDVIHTENK T0292 80 :LYIVMEYCEG 1gz8A 76 :LYLVFEFLHQ T0292 91 :DLASVITK 1gz8A 86 :DLKKFMDA T0292 101 :KERQYLDEEFVLRVMTQLTLALKECHRR 1gz8A 94 :SALTGIPLPLIKSYLFQLLQGLAFCHSH T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMN 1gz8A 122 :RVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILL T0292 190 :S 1gz8A 179 :Y T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1gz8A 182 :TAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTP T0292 234 :I 1gz8A 251 :V T0292 237 :RYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1gz8A 254 :PLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 12 number of extra gaps= 3 total=567 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2evaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2evaA expands to /projects/compbio/data/pdb/2eva.pdb.gz 2evaA:Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 2evaA Skipped atom 696, because occupancy 0.500 <= existing 0.500 in 2evaA Skipped atom 698, because occupancy 0.500 <= existing 0.500 in 2evaA Skipped atom 700, because occupancy 0.500 <= existing 0.500 in 2evaA # T0292 read from 2evaA/merged-good-all-a2m # 2evaA read from 2evaA/merged-good-all-a2m # adding 2evaA to template set # found chain 2evaA in template set Warning: unaligning (T0292)L160 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2evaA)G191 Warning: unaligning (T0292)G176 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2evaA)G191 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRR 2evaA 32 :DYKEIEVEEVVGRGAFGVVCKAKW T0292 28 :DGKILVWKELDYG 2evaA 56 :RAKDVAIKQIESE T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 2evaA 69 :SERKAFIVELRQLSRVNHPNIVKLYGAC T0292 75 :RTNT 2evaA 97 :LNPV T0292 81 :YIVMEYCEGGDLASVITKGTK 2evaA 101 :CLVMEYAEGGSLYNVLHGAEP T0292 105 :YLDEEFVLRVMTQLTLALKECHRRSDGG 2evaA 124 :YYTAAHAMSWCLQCSQGVAYLHSMQPKA T0292 135 :VLHRDLKPANVFLDGK 2evaA 152 :LIHRDLKPPNLLLVAG T0292 151 :QNVKLGDFG 2evaA 169 :TVLKICDFG T0292 177 :TPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFT 2evaA 192 :SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFD T0292 216 :AFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 2evaA 233 :GGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKI T0292 267 :PLILEH 2evaA 289 :RYFPGA T0292 274 :HHHH 2evaA 296 :EPLQ Number of specific fragments extracted= 12 number of extra gaps= 0 total=579 Number of alignments=52 # 2evaA read from 2evaA/merged-good-all-a2m # found chain 2evaA in template set Warning: unaligning (T0292)L160 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2evaA)G191 Warning: unaligning (T0292)G176 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2evaA)G191 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRK 2evaA 32 :DYKEIEVEEVVGRGAFGVVCKAKWR T0292 29 :GKILVWKELDYG 2evaA 57 :AKDVAIKQIESE T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 2evaA 69 :SERKAFIVELRQLSRVNHPNIVKLYGAC T0292 75 :RTNT 2evaA 97 :LNPV T0292 81 :YIVMEYCEGGDLASVITKGTKERQ 2evaA 101 :CLVMEYAEGGSLYNVLHGAEPLPY T0292 106 :LDEEFVLRVMTQLTLALKECHRRSDGG 2evaA 125 :YTAAHAMSWCLQCSQGVAYLHSMQPKA T0292 135 :VLHRDLKPANVFLDGKQ 2evaA 152 :LIHRDLKPPNLLLVAGG T0292 152 :NVKLGDFG 2evaA 170 :VLKICDFG T0292 177 :TPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFT 2evaA 192 :SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFD T0292 216 :AFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 2evaA 233 :GGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKI T0292 267 :PLILEHH 2evaA 288 :MRYFPGA T0292 275 :HH 2evaA 296 :EP Number of specific fragments extracted= 12 number of extra gaps= 0 total=591 Number of alignments=53 # 2evaA read from 2evaA/merged-good-all-a2m # found chain 2evaA in template set Warning: unaligning (T0292)L160 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2evaA)G191 Warning: unaligning (T0292)G176 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2evaA)G191 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRK 2evaA 31 :IDYKEIEVEEVVGRGAFGVVCKAKWR T0292 29 :GKILVWKELDYGS 2evaA 57 :AKDVAIKQIESES T0292 46 :EKQMLVSEVNLLRELKHPNIVRYYDRIIDR 2evaA 70 :ERKAFIVELRQLSRVNHPNIVKLYGACLNP T0292 80 :LYIVMEYCEGGDLASVITK 2evaA 100 :VCLVMEYAEGGSLYNVLHG T0292 100 :TKERQYLDEEFVLRVMTQLTLALKECHRR 2evaA 119 :AEPLPYYTAAHAMSWCLQCSQGVAYLHSM T0292 131 :GGHTVLHRDLKPANVFL 2evaA 148 :QPKALIHRDLKPPNLLL T0292 148 :DGKQNVKLGDFG 2evaA 166 :AGGTVLKICDFG T0292 177 :TPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFT 2evaA 192 :SAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFD T0292 216 :AFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 2evaA 233 :GGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKI T0292 267 :PLILEHHH 2evaA 289 :RYFPGADE Number of specific fragments extracted= 10 number of extra gaps= 0 total=601 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1mq4A expands to /projects/compbio/data/pdb/1mq4.pdb.gz 1mq4A:# T0292 read from 1mq4A/merged-good-all-a2m # 1mq4A read from 1mq4A/merged-good-all-a2m # adding 1mq4A to template set # found chain 1mq4A in template set Warning: unaligning (T0292)H166 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1mq4A)P282 Warning: unaligning (T0292)D167 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1mq4A)P282 Warning: unaligning (T0292)F170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mq4A)T288 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1mq4A)T288 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 1mq4A 129 :ALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAG T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRI 1mq4A 175 :EHQLRREVEIQSHLRHPNILRLYGYF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1mq4A 201 :HDATRVYLILEYAPLGTVYRELQKLSK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1mq4A 228 :FDEQRTATYITELANALSYCHSKR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLAR 1mq4A 252 :VIHRDIKPENLLLGSAGELKIADFGWSV T0292 165 :N 1mq4A 280 :H T0292 168 :TS 1mq4A 283 :SS T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1mq4A 289 :LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEF T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILE 1mq4A 347 :TFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITA Number of specific fragments extracted= 9 number of extra gaps= 1 total=610 Number of alignments=55 # 1mq4A read from 1mq4A/merged-good-all-a2m # found chain 1mq4A in template set Warning: unaligning (T0292)L164 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1mq4A)P282 Warning: unaligning (T0292)N165 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1mq4A)P282 Warning: unaligning (T0292)F170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mq4A)T288 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1mq4A)T288 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1mq4A 129 :ALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQL T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1mq4A 171 :KAGVEHQLRREVEIQSHLRHPNILRLYGYF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1mq4A 201 :HDATRVYLILEYAPLGTVYRELQKLSK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1mq4A 228 :FDEQRTATYITELANALSYCHSKR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1mq4A 252 :VIHRDIKPENLLLGSAGELKIADFGWSVH T0292 166 :H 1mq4A 283 :S T0292 169 :S 1mq4A 284 :S T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1mq4A 289 :LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFT T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILE 1mq4A 348 :FPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITA Number of specific fragments extracted= 9 number of extra gaps= 1 total=619 Number of alignments=56 # 1mq4A read from 1mq4A/merged-good-all-a2m # found chain 1mq4A in template set Warning: unaligning (T0292)L164 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1mq4A)P282 Warning: unaligning (T0292)N165 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1mq4A)P282 Warning: unaligning (T0292)F170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1mq4A)T288 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1mq4A)T288 Warning: unaligning (T0292)H274 because last residue in template chain is (1mq4A)S388 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1mq4A 128 :WALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQL T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1mq4A 171 :KAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATR T0292 80 :LYIVMEYCEGGDLASVITK 1mq4A 206 :VYLILEYAPLGTVYRELQK T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1mq4A 225 :LSKFDEQRTATYITELANALSYCHSK T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARI 1mq4A 251 :RVIHRDIKPENLLLGSAGELKIADFGWSVH T0292 166 :HD 1mq4A 283 :SS T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1mq4A 289 :LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFT T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1mq4A 348 :FPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANS Number of specific fragments extracted= 8 number of extra gaps= 1 total=627 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1e1xA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1e1xA expands to /projects/compbio/data/pdb/1e1x.pdb.gz 1e1xA:# T0292 read from 1e1xA/merged-good-all-a2m # 1e1xA read from 1e1xA/merged-good-all-a2m # adding 1e1xA to template set # found chain 1e1xA in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1e1xA)M1 Warning: unaligning (T0292)L37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1e1xA)V44 Warning: unaligning (T0292)M42 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1e1xA)V44 Warning: unaligning (T0292)C87 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)H84 Warning: unaligning (T0292)E88 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)H84 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)S181 Warning: unaligning (T0292)A216 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)D206 Warning: unaligning (T0292)F217 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)D206 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKE 1e1xA 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKK T0292 43 :TEAE 1e1xA 45 :PSTA T0292 51 :VSEVNLLRELKHPNIVRYYDRI 1e1xA 49 :IREISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEY 1e1xA 71 :HTENKLYLVFEF T0292 90 :GDLASVITKG 1e1xA 85 :QDLKKFMDAS T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRRS 1e1xA 95 :ALTGIPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNRMSY 1e1xA 123 :VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKY T0292 193 :EKSDIWSLGCLLYELCALMPPFT 1e1xA 182 :TAVDIWSLGCIFAEMVTRRALFP T0292 218 :SQKELAGKIRE 1e1xA 207 :SEIDQLFRIFR T0292 229 :GKFRRIP 1e1xA 238 :PSFPKWA T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1e1xA 253 :PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 11 number of extra gaps= 3 total=638 Number of alignments=58 # 1e1xA read from 1e1xA/merged-good-all-a2m # found chain 1e1xA in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1e1xA)M1 Warning: unaligning (T0292)L37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1e1xA)V44 Warning: unaligning (T0292)C87 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)H84 Warning: unaligning (T0292)G89 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)H84 Warning: unaligning (T0292)Y191 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)S181 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)S181 Warning: unaligning (T0292)A216 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)D206 Warning: unaligning (T0292)F217 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)D206 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKE 1e1xA 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKK T0292 43 :TEAEK 1e1xA 45 :PSTAI T0292 52 :SEVNLLRELKHPNIVRYYDRI 1e1xA 50 :REISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEY 1e1xA 71 :HTENKLYLVFEF T0292 90 :GDLASVITKGTKER 1e1xA 85 :QDLKKFMDASALTG T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1e1xA 99 :IPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNR 1e1xA 123 :VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLG T0292 189 :MS 1e1xA 178 :KY T0292 193 :EKSDIWSLGCLLYELCALMPPFT 1e1xA 182 :TAVDIWSLGCIFAEMVTRRALFP T0292 218 :SQKELAGKIREGKFRRIPYR 1e1xA 207 :SEIDQLFRIFRTLGTPDEVV T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1e1xA 255 :LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVT T0292 274 :HHHH 1e1xA 295 :HLRL Number of specific fragments extracted= 12 number of extra gaps= 3 total=650 Number of alignments=59 # 1e1xA read from 1e1xA/merged-good-all-a2m # found chain 1e1xA in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1e1xA)M1 Warning: unaligning (T0292)L37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1e1xA)V44 Warning: unaligning (T0292)C87 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)H84 Warning: unaligning (T0292)E88 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)H84 Warning: unaligning (T0292)Y191 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)S181 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)S181 Warning: unaligning (T0292)A216 because of BadResidue code BAD_PEPTIDE in next template residue (1e1xA)D206 Warning: unaligning (T0292)F217 because of BadResidue code BAD_PEPTIDE at template residue (1e1xA)D206 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKE 1e1xA 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKK T0292 43 :TEAEKQ 1e1xA 45 :PSTAIR T0292 53 :EVNLLRELKHPNIVRYYDRIIDRTN 1e1xA 51 :EISLLKELNHPNIVKLLDVIHTENK T0292 80 :LYIVMEY 1e1xA 76 :LYLVFEF T0292 90 :GDLASVITK 1e1xA 85 :QDLKKFMDA T0292 101 :KERQYLDEEFVLRVMTQLTLALKECHRR 1e1xA 94 :SALTGIPLPLIKSYLFQLLQGLAFCHSH T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNR 1e1xA 122 :RVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLG T0292 189 :MS 1e1xA 178 :KY T0292 193 :EKSDIWSLGCLLYELCALMPPFT 1e1xA 182 :TAVDIWSLGCIFAEMVTRRALFP T0292 218 :SQKELAGKIREGKFRR 1e1xA 207 :SEIDQLFRIFRTLGTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1e1xA 251 :VVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 11 number of extra gaps= 3 total=661 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zrzA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zrzA expands to /projects/compbio/data/pdb/1zrz.pdb.gz 1zrzA:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 1zrzA/merged-good-all-a2m # 1zrzA read from 1zrzA/merged-good-all-a2m # adding 1zrzA to template set # found chain 1zrzA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zrzA)F404 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zrzA)F404 Warning: unaligning (T0292)A216 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zrzA)Q455 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1zrzA 241 :GLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVND T0292 45 :AEKQMLVSEVNLLREL 1zrzA 285 :EDIDWVQTEKHVFEQA T0292 61 :KHPNIVRYYDRI 1zrzA 302 :NHPFLVGLHSCF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1zrzA 314 :QTESRLFFVIEYVNGGDLMFHMQRQRK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1zrzA 341 :LPEEHARFYSAEISLALNYLHERG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1zrzA 365 :IIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPF 1zrzA 405 :CGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPF T0292 217 :FSQKELAGKIREGKF 1zrzA 456 :NTEDYLFQVILEKQI T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPS 1zrzA 471 :RIPRSMSVKAASVLKSFLNKDPKERLG T0292 260 :VEEILENPLILEH 1zrzA 504 :FADIQGHPFFRNV Number of specific fragments extracted= 10 number of extra gaps= 0 total=671 Number of alignments=61 # 1zrzA read from 1zrzA/merged-good-all-a2m # found chain 1zrzA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zrzA)F404 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zrzA)F404 Warning: unaligning (T0292)T215 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zrzA)Q455 Warning: unaligning (T0292)F217 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zrzA)Q455 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1zrzA 241 :GLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELV T0292 43 :TEAEKQMLVSEVNLLREL 1zrzA 283 :DDEDIDWVQTEKHVFEQA T0292 61 :KHPNIVRYYDRI 1zrzA 302 :NHPFLVGLHSCF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1zrzA 314 :QTESRLFFVIEYVNGGDLMFHMQRQRK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1zrzA 341 :LPEEHARFYSAEISLALNYLHERG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1zrzA 365 :IIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPF 1zrzA 405 :CGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPF T0292 218 :SQKE 1zrzA 456 :NTED T0292 222 :LAGKIREGKFR 1zrzA 461 :LFQVILEKQIR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1zrzA 472 :IPRSMSVKAASVLKSFLNKDPKERL T0292 259 :SVEEILENPLILEHH 1zrzA 503 :GFADIQGHPFFRNVD T0292 274 :H 1zrzA 525 :Q Number of specific fragments extracted= 12 number of extra gaps= 0 total=683 Number of alignments=62 # 1zrzA read from 1zrzA/merged-good-all-a2m # found chain 1zrzA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zrzA)F404 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zrzA)F404 Warning: unaligning (T0292)A216 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zrzA)Q455 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1zrzA 241 :GLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELV T0292 43 :TEAEKQMLVSEVNLLREL 1zrzA 283 :DDEDIDWVQTEKHVFEQA T0292 61 :KHPNIVRYYDRIIDRTN 1zrzA 302 :NHPFLVGLHSCFQTESR T0292 80 :LYIVMEYCEGGDLASVITK 1zrzA 319 :LFFVIEYVNGGDLMFHMQR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1zrzA 338 :QRKLPEEHARFYSAEISLALNYLHER T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1zrzA 364 :GIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPF 1zrzA 405 :CGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPF T0292 217 :FSQKELAGKIREGKFR 1zrzA 456 :NTEDYLFQVILEKQIR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPS 1zrzA 472 :IPRSMSVKAASVLKSFLNKDPKERLG T0292 260 :VEEILENPLILEHH 1zrzA 504 :FADIQGHPFFRNVD Number of specific fragments extracted= 10 number of extra gaps= 0 total=693 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pme/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pme expands to /projects/compbio/data/pdb/1pme.pdb.gz 1pme:Warning: there is no chain 1pme will retry with 1pmeA # T0292 read from 1pme/merged-good-all-a2m # 1pme read from 1pme/merged-good-all-a2m # adding 1pme to template set # found chain 1pme in template set Warning: unaligning (T0292)G13 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1pme)Y36 Warning: unaligning (T0292)Y17 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1pme)Y36 Warning: unaligning (T0292)K150 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1pme)D162 Warning: unaligning (T0292)N152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1pme)D162 T0292 3 :AEDYEVLYTI 1pme 22 :GPRYTNLSYI T0292 18 :GRCQKIRRKSDGKILVWKELDYGS 1pme 37 :GMVCSAYDNVNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 1pme 61 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYC 1pme 100 :DVYLVTHLM T0292 89 :GGDLASVITK 1pme 109 :GADLYKLLKT T0292 100 :TK 1pme 119 :QH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1pme 121 :LSNDHICYFLYQILRGLKYIHSAN T0292 135 :VLHRDLKPANVFLDG 1pme 145 :VLHRDLKPSNLLLNT T0292 153 :VKLGDFGLARILNHDT 1pme 163 :LKICDFGLARVADPDH T0292 169 :SFAKAFVGTPYYMSPEQMNRMS 1pme 182 :GFLTEYVATRWYRAPEIMLNSK T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1pme 205 :YTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG T0292 229 :GKFRRIP 1pme 268 :PHKNKVP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1pme 280 :PNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQY T0292 273 :HHHH 1pme 323 :PIAE Number of specific fragments extracted= 14 number of extra gaps= 0 total=707 Number of alignments=64 # 1pme read from 1pme/merged-good-all-a2m # found chain 1pme in template set Warning: unaligning (T0292)G13 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1pme)Y36 Warning: unaligning (T0292)Y17 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1pme)Y36 Warning: unaligning (T0292)K150 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1pme)D162 Warning: unaligning (T0292)N152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1pme)D162 T0292 3 :AEDYEVLYTI 1pme 22 :GPRYTNLSYI T0292 18 :GRCQKIRRKSDGKILVWKELDYGS 1pme 37 :GMVCSAYDNVNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 1pme 61 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYC 1pme 100 :DVYLVTHLM T0292 89 :GGDLASVITKGT 1pme 109 :GADLYKLLKTQH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1pme 121 :LSNDHICYFLYQILRGLKYIHSAN T0292 135 :VLHRDLKPANVFLDG 1pme 145 :VLHRDLKPSNLLLNT T0292 153 :VKLGDFGLARILNHDTSFA 1pme 163 :LKICDFGLARVADPDHDHT T0292 172 :KAFVGTPYYMSPEQMNR 1pme 185 :TEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPY 1pme 203 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQE T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1pme 282 :ADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYY T0292 274 :H 1pme 326 :E Number of specific fragments extracted= 12 number of extra gaps= 0 total=719 Number of alignments=65 # 1pme read from 1pme/merged-good-all-a2m # found chain 1pme in template set Warning: unaligning (T0292)G13 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1pme)Y36 Warning: unaligning (T0292)Y17 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1pme)Y36 Warning: unaligning (T0292)K150 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1pme)D162 Warning: unaligning (T0292)N152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1pme)D162 T0292 4 :EDYEVLYTI 1pme 23 :PRYTNLSYI T0292 18 :GRCQKIRRKSDGKILVWKELDYGS 1pme 37 :GMVCSAYDNVNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 1pme 61 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYCE 1pme 100 :DVYLVTHLMG T0292 90 :GDLASVITK 1pme 110 :ADLYKLLKT T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1pme 119 :QHLSNDHICYFLYQILRGLKYIHSA T0292 134 :TVLHRDLKPANVFLDG 1pme 144 :NVLHRDLKPSNLLLNT T0292 153 :VKLGDFGLARILNHD 1pme 163 :LKICDFGLARVADPD T0292 168 :TSFAKAFVGTPYYMSPEQMNR 1pme 181 :TGFLTEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1pme 203 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1pme 278 :LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSD Number of specific fragments extracted= 11 number of extra gaps= 0 total=730 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fgkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fgkA expands to /projects/compbio/data/pdb/1fgk.pdb.gz 1fgkA:Skipped atom 908, because occupancy 0.500 <= existing 0.500 in 1fgkA # T0292 read from 1fgkA/merged-good-all-a2m # 1fgkA read from 1fgkA/merged-good-all-a2m # adding 1fgkA to template set # found chain 1fgkA in template set Warning: unaligning (T0292)G13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fgkA)Q491 Warning: unaligning (T0292)R19 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fgkA)Q491 Warning: unaligning (T0292)S27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fgkA)P505 Warning: unaligning (T0292)R103 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fgkA)E592 T0292 2 :RAEDYEVLYTI 1fgkA 474 :PRDRLVLGKPL T0292 20 :CQKIR 1fgkA 492 :VVLAE T0292 28 :DG 1fgkA 506 :NR T0292 30 :KILVWKEL 1fgkA 509 :TKVAVKML T0292 39 :YGSMTEAEKQMLVSEVNLLREL 1fgkA 517 :KSDATEKDLSDLISEMEMMKMI T0292 61 :KHPNIVRYYDRI 1fgkA 540 :KHKNIINLLGAC T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1fgkA 552 :TQDGPLYVIVEYASKGNLREYLQARRP T0292 104 :QYLDEEFVLRVMTQLTLALKECHRRS 1fgkA 593 :EQLSSKDLVSCAYQVARGMEYLASKK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTP 1fgkA 619 :CIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRL T0292 179 :YYMSPEQMNRMSYNEKSDIWSLGCLLYELCA 1fgkA 665 :KWMAPEALFDRIYTHQSDVWSFGVLLWEIFT T0292 210 :LMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 1fgkA 697 :GGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVED Number of specific fragments extracted= 11 number of extra gaps= 0 total=741 Number of alignments=67 # 1fgkA read from 1fgkA/merged-good-all-a2m # found chain 1fgkA in template set Warning: unaligning (T0292)G13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fgkA)Q491 Warning: unaligning (T0292)R19 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fgkA)Q491 Warning: unaligning (T0292)R103 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fgkA)E592 T0292 2 :RAEDYEVLYTI 1fgkA 474 :PRDRLVLGKPL T0292 20 :CQKIRRK 1fgkA 492 :VVLAEAI T0292 30 :KILVWKELDYG 1fgkA 509 :TKVAVKMLKSD T0292 42 :MTEAEKQMLVSEVNLLREL 1fgkA 520 :ATEKDLSDLISEMEMMKMI T0292 61 :KHPNIVRYYDRI 1fgkA 540 :KHKNIINLLGAC T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1fgkA 552 :TQDGPLYVIVEYASKGNLREYLQARRP T0292 104 :QYLDEEFVLRVMTQLTLALKECHRRS 1fgkA 593 :EQLSSKDLVSCAYQVARGMEYLASKK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1fgkA 619 :CIHRDLAARNVLVTEDNVMKIADFGLARDIHH T0292 167 :DTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCA 1fgkA 653 :YYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFT T0292 210 :LMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPL 1fgkA 697 :GGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLD Number of specific fragments extracted= 10 number of extra gaps= 0 total=751 Number of alignments=68 # 1fgkA read from 1fgkA/merged-good-all-a2m # found chain 1fgkA in template set Warning: unaligning (T0292)G13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1fgkA)Q491 Warning: unaligning (T0292)R19 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fgkA)Q491 Warning: unaligning (T0292)R103 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1fgkA)E592 T0292 1 :SRAEDYEVLYTI 1fgkA 473 :LPRDRLVLGKPL T0292 20 :CQKIRRK 1fgkA 492 :VVLAEAI T0292 30 :KILVWKELDYG 1fgkA 509 :TKVAVKMLKSD T0292 42 :MTEAEKQMLVSEVNLLREL 1fgkA 520 :ATEKDLSDLISEMEMMKMI T0292 61 :KHPNIVRYYDRIIDRTN 1fgkA 540 :KHKNIINLLGACTQDGP T0292 80 :LYIVMEYCEGGDLASVITKGT 1fgkA 557 :LYVIVEYASKGNLREYLQARR T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1fgkA 593 :EQLSSKDLVSCAYQVARGMEYLASK T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILN 1fgkA 618 :KCIHRDLAARNVLVTEDNVMKIADFGLARDIH T0292 166 :HDTSFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCA 1fgkA 652 :DYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFT T0292 210 :LMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 1fgkA 697 :GGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVED Number of specific fragments extracted= 10 number of extra gaps= 0 total=761 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hcl/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hcl expands to /projects/compbio/data/pdb/1hcl.pdb.gz 1hcl:Warning: there is no chain 1hcl will retry with 1hclA Skipped atom 1022, because occupancy 0.200 <= existing 0.800 in 1hcl Skipped atom 1024, because occupancy 0.200 <= existing 0.800 in 1hcl Skipped atom 1026, because occupancy 0.200 <= existing 0.800 in 1hcl Skipped atom 1028, because occupancy 0.200 <= existing 0.800 in 1hcl Skipped atom 1030, because occupancy 0.200 <= existing 0.800 in 1hcl Skipped atom 2093, because occupancy 0.370 <= existing 0.660 in 1hcl # T0292 read from 1hcl/merged-good-all-a2m # 1hcl read from 1hcl/merged-good-all-a2m # adding 1hcl to template set # found chain 1hcl in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1hcl)M1 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1hcl)T41 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 1hcl 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKI T0292 40 :GSMTEA 1hcl 42 :EGVPST T0292 50 :LVSEVNLLRELKHPNIVRYYDRI 1hcl 48 :AIREISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEYCE 1hcl 71 :HTENKLYLVFEFLH T0292 90 :GDLASVITKG 1hcl 85 :QDLKKFMDAS T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRRS 1hcl 95 :ALTGIPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNRMSY 1hcl 123 :VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKY T0292 192 :NEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1hcl 181 :STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFR T0292 229 :GKFRRIP 1hcl 238 :PSFPKWA T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1hcl 253 :PPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 10 number of extra gaps= 0 total=771 Number of alignments=70 # 1hcl read from 1hcl/merged-good-all-a2m # found chain 1hcl in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1hcl)M1 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1hcl)T41 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 1hcl 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKI T0292 40 :GSMTEA 1hcl 42 :EGVPST T0292 50 :LVSEVNLLRELKHPNIVRYYDRI 1hcl 48 :AIREISLLKELNHPNIVKLLDVI T0292 75 :RTNTTLYIVMEYCEG 1hcl 71 :HTENKLYLVFEFLHQ T0292 91 :DLASVITKGTKER 1hcl 86 :DLKKFMDASALTG T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1hcl 99 :IPLPLIKSYLFQLLQGLAFCHSHR T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNR 1hcl 123 :VLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 1hcl 178 :KYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVV T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1hcl 255 :LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVT T0292 274 :HHH 1hcl 295 :HLR Number of specific fragments extracted= 10 number of extra gaps= 0 total=781 Number of alignments=71 # 1hcl read from 1hcl/merged-good-all-a2m # found chain 1hcl in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1hcl)M1 Warning: unaligning (T0292)D38 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1hcl)T41 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 1hcl 2 :ENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKI T0292 40 :GSMTEAE 1hcl 42 :EGVPSTA T0292 51 :VSEVNLLRELKHPNIVRYYDRIIDRTN 1hcl 49 :IREISLLKELNHPNIVKLLDVIHTENK T0292 80 :LYIVMEYCEG 1hcl 76 :LYLVFEFLHQ T0292 91 :DLASVITK 1hcl 86 :DLKKFMDA T0292 101 :KERQYLDEEFVLRVMTQLTLALKECHRR 1hcl 94 :SALTGIPLPLIKSYLFQLLQGLAFCHSH T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKAFVGTPYYMSPEQMNR 1hcl 122 :RVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1hcl 178 :KYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1hcl 251 :VVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPV Number of specific fragments extracted= 9 number of extra gaps= 0 total=790 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1h1wA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1h1wA expands to /projects/compbio/data/pdb/1h1w.pdb.gz 1h1wA:Skipped atom 73, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 75, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 77, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 79, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 81, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 269, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 271, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 365, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 367, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 369, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 371, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 375, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 377, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 949, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 951, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 953, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 955, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 957, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 959, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 961, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1026, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1028, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1172, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1174, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1176, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1178, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1180, because occupancy 0.500 <= existing 0.500 in 1h1wA Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Skipped atom 1432, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1434, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1436, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1438, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1440, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1986, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 1988, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 2280, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 2282, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 2284, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 2286, because occupancy 0.500 <= existing 0.500 in 1h1wA Skipped atom 2288, because occupancy 0.500 <= existing 0.500 in 1h1wA # T0292 read from 1h1wA/merged-good-all-a2m # 1h1wA read from 1h1wA/merged-good-all-a2m # adding 1h1wA to template set # found chain 1h1wA in template set Warning: unaligning (T0292)H166 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h1wA)A237 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h1wA)F242 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h1wA)F242 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 1h1wA 78 :RPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIKEN T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRI 1h1wA 124 :VPYVTRERDVMSRLDHPFFVKLYFTF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1h1wA 150 :QDDEKLYFGLSYAKNGELLKYIRKIGS T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1h1wA 177 :FDETCTRFYTAEIVSALEYLHGKG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1h1wA 201 :IIHRDLKPENILLNEDMHIQITDFGTAKVLS T0292 170 :FA 1h1wA 238 :RA T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1h1wA 243 :VGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1h1wA 301 :FPEKFFPKARDLVEKLLVLDATKRL T0292 259 :SVEEILENPLILEHHHH 1h1wA 332 :GYGPLKAHPFFESVTWE Number of specific fragments extracted= 9 number of extra gaps= 0 total=799 Number of alignments=73 # 1h1wA read from 1h1wA/merged-good-all-a2m # found chain 1h1wA in template set Warning: unaligning (T0292)H166 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h1wA)A237 Warning: unaligning (T0292)A171 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h1wA)A237 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h1wA)F242 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h1wA)F242 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1h1wA 78 :RPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1h1wA 120 :KENKVPYVTRERDVMSRLDHPFFVKLYFTF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1h1wA 150 :QDDEKLYFGLSYAKNGELLKYIRKIGS T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1h1wA 177 :FDETCTRFYTAEIVSALEYLHGKG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1h1wA 201 :IIHRDLKPENILLNEDMHIQITDFGTAKVLS T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1h1wA 243 :VGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1h1wA 301 :FPEKFFPKARDLVEKLLVLDATKRL T0292 259 :SVEEILENPLILEHH 1h1wA 332 :GYGPLKAHPFFESVT Number of specific fragments extracted= 8 number of extra gaps= 0 total=807 Number of alignments=74 # 1h1wA read from 1h1wA/merged-good-all-a2m # found chain 1h1wA in template set Warning: unaligning (T0292)H166 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h1wA)A237 Warning: unaligning (T0292)S169 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h1wA)A237 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h1wA)F242 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h1wA)F242 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1h1wA 77 :KRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHI T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1h1wA 120 :KENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEK T0292 80 :LYIVMEYCEGGDLASVITK 1h1wA 155 :LYFGLSYAKNGELLKYIRK T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1h1wA 174 :IGSFDETCTRFYTAEIVSALEYLHGK T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILN 1h1wA 200 :GIIHRDLKPENILLNEDMHIQITDFGTAKVLS T0292 170 :FA 1h1wA 238 :RA T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1h1wA 243 :VGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1h1wA 301 :FPEKFFPKARDLVEKLLVLDATKRL T0292 259 :SVEEILENPLILEHHHHH 1h1wA 332 :GYGPLKAHPFFESVTWEN Number of specific fragments extracted= 9 number of extra gaps= 0 total=816 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f3mC/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f3mC expands to /projects/compbio/data/pdb/1f3m.pdb.gz 1f3mC:# T0292 read from 1f3mC/merged-good-all-a2m # 1f3mC read from 1f3mC/merged-good-all-a2m # adding 1f3mC to template set # found chain 1f3mC in template set Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f3mC)T423 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f3mC)T423 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 1f3mC 268 :KKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKE T0292 49 :MLVSEVNLLRELKHPNIVRYYDRI 1f3mC 311 :LIINEILVMRENKNPNIVNYLDSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 1f3mC 335 :LVGDELWVVMEYLAGGSLTDVVTETC T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1f3mC 361 :MDEGQIAAVCRECLQALEFLHSNQ T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARIL 1f3mC 385 :VIHRDIKSDNILLGMDGSVKLTDFGFCAQI T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 1f3mC 424 :MVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPEL T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 1f3mC 487 :PEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKP Number of specific fragments extracted= 7 number of extra gaps= 0 total=823 Number of alignments=76 # 1f3mC read from 1f3mC/merged-good-all-a2m # found chain 1f3mC in template set Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f3mC)T423 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f3mC)T423 T0292 5 :DYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1f3mC 269 :KYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQ T0292 43 :TEAE 1f3mC 308 :KKEL T0292 50 :LVSEVNLLRELKHPNIVRYYDRI 1f3mC 312 :IINEILVMRENKNPNIVNYLDSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 1f3mC 335 :LVGDELWVVMEYLAGGSLTDVVTETC T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1f3mC 361 :MDEGQIAAVCRECLQALEFLHSNQ T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARIL 1f3mC 385 :VIHRDIKSDNILLGMDGSVKLTDFGFCAQI T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 1f3mC 424 :MVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPEL T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 1f3mC 487 :PEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKP Number of specific fragments extracted= 8 number of extra gaps= 0 total=831 Number of alignments=77 # 1f3mC read from 1f3mC/merged-good-all-a2m # found chain 1f3mC in template set Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1f3mC)T423 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1f3mC)T423 T0292 5 :DYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1f3mC 269 :KYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQ T0292 44 :E 1f3mC 308 :K T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1f3mC 309 :KELIINEILVMRENKNPNIVNYLDSYLVGDE T0292 80 :LYIVMEYCEGGDLASVITK 1f3mC 340 :LWVVMEYLAGGSLTDVVTE T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1f3mC 359 :TCMDEGQIAAVCRECLQALEFLHSN T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARIL 1f3mC 384 :QVIHRDIKSDNILLGMDGSVKLTDFGFCAQI T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1f3mC 424 :MVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPE T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 1f3mC 486 :NPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKP Number of specific fragments extracted= 8 number of extra gaps= 0 total=839 Number of alignments=78 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bikB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 2bikB/merged-good-all-a2m # 2bikB read from 2bikB/merged-good-all-a2m # found chain 2bikB in training set Warning: unaligning (T0292)S239 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bikB)E262 Warning: unaligning (T0292)E241 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bikB)E262 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMT 2bikB 36 :SQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRIS T0292 44 :EAE 2bikB 81 :PNG T0292 52 :SEVNLLREL 2bikB 88 :MEVVLLKKV T0292 61 :KHPNIVRYYDRI 2bikB 99 :GFSGVIRLLDWF T0292 75 :RTNTTLYIVMEYCEG 2bikB 111 :ERPDSFVLILERPEP T0292 90 :GDLASVITKGTK 2bikB 127 :QDLFDFITERGA T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bikB 139 :LQEELARSFFWQVLEAVRHCHNCG T0292 135 :VLHRDLKPANVFLDGK 2bikB 163 :VLHRDIKDENILIDLN T0292 151 :QNVKLGDFGLARILNHD 2bikB 180 :GELKLIDFGSGALLKDT T0292 170 :FAKAFVGTPYYMSPEQMNRMSYN 2bikB 197 :VYTDFDGTRVYSPPEWIRYHRYH T0292 193 :EKSDIWSLGCLLYELCALMPPFTAFS 2bikB 221 :RSAAVWSLGILLYDMVCGDIPFEHDE T0292 225 :KIREGKF 2bikB 247 :EIIGGQV T0292 233 :RIPYRY 2bikB 254 :FFRQRV T0292 242 :LNEIITRMLNLKDYHRPSVEEILENPLILEH 2bikB 263 :CQHLIRWCLALRPSDRPTFEEIQNHPWMQDV Number of specific fragments extracted= 14 number of extra gaps= 0 total=853 Number of alignments=79 # 2bikB read from 2bikB/merged-good-all-a2m # found chain 2bikB in training set Warning: unaligning (T0292)S239 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bikB)E262 Warning: unaligning (T0292)E241 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bikB)E262 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMT 2bikB 36 :SQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRIS T0292 52 :SEVNLLRELKHP 2bikB 88 :MEVVLLKKVSSG T0292 64 :NIVRYYDRI 2bikB 102 :GVIRLLDWF T0292 75 :RTNTTLYIVMEYCEG 2bikB 111 :ERPDSFVLILERPEP T0292 90 :GDLASVITKGTK 2bikB 127 :QDLFDFITERGA T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bikB 139 :LQEELARSFFWQVLEAVRHCHNCG T0292 135 :VLHRDLKPANVFLD 2bikB 163 :VLHRDIKDENILID T0292 149 :GKQNVKLGDFGLARILNH 2bikB 178 :NRGELKLIDFGSGALLKD T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYN 2bikB 196 :TVYTDFDGTRVYSPPEWIRYHRYH T0292 193 :EKSDIWSLGCLLYELCALMPPFTA 2bikB 221 :RSAAVWSLGILLYDMVCGDIPFEH T0292 219 :QKE 2bikB 245 :DEE T0292 226 :IREGKFR 2bikB 248 :IIGGQVF T0292 234 :IPYRY 2bikB 255 :FRQRV T0292 242 :LNEIITRMLNLKDYHRPSVEEILENPLILEHH 2bikB 263 :CQHLIRWCLALRPSDRPTFEEIQNHPWMQDVL Number of specific fragments extracted= 14 number of extra gaps= 0 total=867 Number of alignments=80 # 2bikB read from 2bikB/merged-good-all-a2m # found chain 2bikB in training set Warning: unaligning (T0292)S239 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bikB)E262 Warning: unaligning (T0292)E241 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bikB)E262 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 2bikB 36 :SQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRI T0292 52 :SEVNLLREL 2bikB 88 :MEVVLLKKV T0292 61 :KHPNIVRYYDRIIDRTN 2bikB 99 :GFSGVIRLLDWFERPDS T0292 80 :LYIVMEYCEG 2bikB 116 :FVLILERPEP T0292 90 :GDLASVITK 2bikB 127 :QDLFDFITE T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 2bikB 136 :RGALQEELARSFFWQVLEAVRHCHNC T0292 134 :TVLHRDLKPANVFL 2bikB 162 :GVLHRDIKDENILI T0292 148 :DGKQNVKLGDFGLARILNHD 2bikB 177 :LNRGELKLIDFGSGALLKDT T0292 170 :FAKAFVGTPYYMSPEQMNRMSYN 2bikB 197 :VYTDFDGTRVYSPPEWIRYHRYH T0292 193 :EKSDIWSLGCLLYELCALMPPFTAF 2bikB 221 :RSAAVWSLGILLYDMVCGDIPFEHD T0292 224 :GKIREGKFR 2bikB 246 :EEIIGGQVF T0292 234 :IPYRY 2bikB 255 :FRQRV T0292 242 :LNEIITRMLNLKDYHRPSVEEILENPLILEHHH 2bikB 263 :CQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLL Number of specific fragments extracted= 13 number of extra gaps= 0 total=880 Number of alignments=81 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a19B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2a19B expands to /projects/compbio/data/pdb/2a19.pdb.gz 2a19B:# T0292 read from 2a19B/merged-good-all-a2m # 2a19B read from 2a19B/merged-good-all-a2m # adding 2a19B to template set # found chain 2a19B in template set Warning: unaligning (T0292)S41 because of BadResidue code BAD_PEPTIDE in next template residue (2a19B)E303 Warning: unaligning (T0292)A45 because of BadResidue code BAD_PEPTIDE at template residue (2a19B)E303 Warning: unaligning (T0292)D74 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2a19B)R356 Warning: unaligning (T0292)R103 because of BadResidue code BAD_PEPTIDE in next template residue (2a19B)E384 Warning: unaligning (T0292)Q104 because of BadResidue code BAD_PEPTIDE at template residue (2a19B)E384 Warning: unaligning (T0292)F170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2a19B)R447 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2a19B)R447 T0292 5 :DYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 2a19B 266 :DFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYN T0292 46 :E 2a19B 304 :K T0292 50 :LVSEVNLLRELKHPNIVRYYDRII 2a19B 305 :AEREVKALAKLDHVNIVHYNGCWD T0292 75 :RTNTTLYIVMEYCEGGDLASVITKG 2a19B 357 :SKTKCLFIQMEFCDKGTLEQWIEKR T0292 102 :E 2a19B 382 :R T0292 105 :YLDEEFVLRVMTQLTLALKECHRRS 2a19B 385 :KLDKVLALELFEQITKGVDYIHSKK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTS 2a19B 410 :LINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGK T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALM 2a19B 448 :SKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVC T0292 214 :FTAFSQKELAGKIREG 2a19B 486 :DTAFETSKFFTDLRDG T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 2a19B 502 :IISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRT Number of specific fragments extracted= 10 number of extra gaps= 2 total=890 Number of alignments=82 # 2a19B read from 2a19B/merged-good-all-a2m # found chain 2a19B in template set Warning: unaligning (T0292)S41 because of BadResidue code BAD_PEPTIDE in next template residue (2a19B)E303 Warning: unaligning (T0292)E44 because of BadResidue code BAD_PEPTIDE at template residue (2a19B)E303 Warning: unaligning (T0292)K101 because of BadResidue code BAD_PEPTIDE in next template residue (2a19B)E384 Warning: unaligning (T0292)E102 because of BadResidue code BAD_PEPTIDE at template residue (2a19B)E384 Warning: unaligning (T0292)A171 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2a19B)R447 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2a19B)R447 Warning: unaligning (T0292)H272 because last residue in template chain is (2a19B)K541 T0292 5 :DYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 2a19B 266 :DFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYN T0292 45 :A 2a19B 304 :K T0292 50 :LVSEVNLLRELKHPNIVRYYDRIID 2a19B 305 :AEREVKALAKLDHVNIVHYNGCWDG T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 2a19B 357 :SKTKCLFIQMEFCDKGTLEQWIEKRR T0292 103 :R 2a19B 385 :K T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2a19B 386 :LDKVLALELFEQITKGVDYIHSKK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTS 2a19B 410 :LINRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGK T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALM 2a19B 448 :SKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVC T0292 217 :FSQKEL 2a19B 486 :DTAFET T0292 223 :AGKIREGK 2a19B 495 :FTDLRDGI T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILE 2a19B 503 :ISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK Number of specific fragments extracted= 11 number of extra gaps= 2 total=901 Number of alignments=83 # 2a19B read from 2a19B/merged-good-all-a2m # found chain 2a19B in template set Warning: unaligning (T0292)S41 because of BadResidue code BAD_PEPTIDE in next template residue (2a19B)E303 Warning: unaligning (T0292)M42 because of BadResidue code BAD_PEPTIDE at template residue (2a19B)E303 Warning: unaligning (T0292)R103 because of BadResidue code BAD_PEPTIDE in next template residue (2a19B)E384 Warning: unaligning (T0292)Q104 because of BadResidue code BAD_PEPTIDE at template residue (2a19B)E384 Warning: unaligning (T0292)A171 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2a19B)R447 Warning: unaligning (T0292)A173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2a19B)R447 T0292 5 :DYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 2a19B 266 :DFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYN T0292 51 :VSEVNLLRELKHPNIVRYYDRIID 2a19B 306 :EREVKALAKLDHVNIVHYNGCWDG T0292 79 :TLYIVMEYCEGGDLASVITK 2a19B 361 :CLFIQMEFCDKGTLEQWIEK T0292 101 :KE 2a19B 381 :RR T0292 105 :YLDEEFVLRVMTQLTLALKECHRR 2a19B 385 :KLDKVLALELFEQITKGVDYIHSK T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 2a19B 409 :KLINRDLKPSNIFLVDTKQVKIGDFGLVTSLKND T0292 169 :SF 2a19B 443 :GK T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALM 2a19B 448 :SKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVC T0292 214 :FTAFSQKELAGKIREGK 2a19B 486 :DTAFETSKFFTDLRDGI T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILEN 2a19B 503 :ISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRT Number of specific fragments extracted= 10 number of extra gaps= 2 total=911 Number of alignments=84 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kobA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kobA expands to /projects/compbio/data/pdb/1kob.pdb.gz 1kobA:# T0292 read from 1kobA/merged-good-all-a2m # 1kobA read from 1kobA/merged-good-all-a2m # adding 1kobA to template set # found chain 1kobA in template set T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 1kobA 50 :YDYYDILEELGSGAFGVVHRCVEKATGRVFVAKFINTP T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1kobA 88 :YPLDKYTVKNEISIMNQLHHPKLINLHDAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTKE 1kobA 118 :EDKYEMVLILEFLSGGELFDRIAAEDYK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1kobA 146 :MSEAEVINYMRQACEGLKHMHEHS T0292 135 :VLHRDLKPANVFLDGKQN 1kobA 170 :IVHLDIKPENIMCETKKA T0292 153 :VKLGDFGLARILNHD 1kobA 190 :VKIIDFGLATKLNPD T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 1kobA 205 :EIVKVTTATAEFAAPEIVDREPVGFYTDMWAIGVLGYVLLSGLSPFAGEDDLETLQNVKRCDWEFDEDA T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1kobA 277 :VSPEAKDFIKNLLQKEPRKRLTVHDALEHPWLKGD T0292 273 :HHHHH 1kobA 314 :NLTSR Number of specific fragments extracted= 9 number of extra gaps= 0 total=920 Number of alignments=85 # 1kobA read from 1kobA/merged-good-all-a2m # found chain 1kobA in template set T0292 2 :RAED 1kobA 48 :SVYD T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 1kobA 53 :YDILEELGSGAFGVVHRCVEKATGRVFVAKFINTP T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1kobA 88 :YPLDKYTVKNEISIMNQLHHPKLINLHDAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTKE 1kobA 118 :EDKYEMVLILEFLSGGELFDRIAAEDYK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1kobA 146 :MSEAEVINYMRQACEGLKHMHEHS T0292 135 :VLHRDLKPANVFL 1kobA 170 :IVHLDIKPENIMC T0292 148 :DGKQNVKLGDFGLARILNHDTSFAK 1kobA 185 :KKASSVKIIDFGLATKLNPDEIVKV T0292 174 :FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 1kobA 210 :TTATAEFAAPEIVDREPVGFYTDMWAIGVLGYVLLSGLSPFAGEDDLETLQNVKRCDWEFDEDA T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1kobA 277 :VSPEAKDFIKNLLQKEPRKRLTVHDALEHPWLKGDHSNLT Number of specific fragments extracted= 9 number of extra gaps= 0 total=929 Number of alignments=86 # 1kobA read from 1kobA/merged-good-all-a2m # found chain 1kobA in template set T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 1kobA 50 :YDYYDILEELGSGAFGVVHRCVEKATGRVFVAKFINTP T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1kobA 88 :YPLDKYTVKNEISIMNQLHHPKLINLHDAFEDKYE T0292 80 :LYIVMEYCEGGDLASVITK 1kobA 123 :MVLILEFLSGGELFDRIAA T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRR 1kobA 142 :EDYKMSEAEVINYMRQACEGLKHMHEH T0292 134 :TVLHRDLKPANVFL 1kobA 169 :SIVHLDIKPENIMC T0292 148 :DGKQNVKLGDFGLARILNHD 1kobA 185 :KKASSVKIIDFGLATKLNPD T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1kobA 205 :EIVKVTTATAEFAAPEIVDREPVGFYTDMWAIGVLGYVLLSGLSPFAGEDDLETLQNVKRCDWEF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHH 1kobA 273 :AFSSVSPEAKDFIKNLLQKEPRKRLTVHDALEHPWLKGDHSN Number of specific fragments extracted= 8 number of extra gaps= 0 total=937 Number of alignments=87 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vzoA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1vzoA/merged-good-all-a2m # 1vzoA read from 1vzoA/merged-good-all-a2m # found chain 1vzoA in training set Warning: unaligning (T0292)D70 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1vzoA)A120 Warning: unaligning (T0292)R71 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1vzoA)A120 Warning: unaligning (T0292)N192 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vzoA)D233 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRR 1vzoA 45 :GIENFELLKVLGTGAYGKVFLVRK T0292 26 :KSDGKILVWKELDY 1vzoA 72 :HDTGKLYAMKVLKK T0292 40 :GSMTE 1vzoA 96 :EHTRT T0292 53 :EVNLLREL 1vzoA 101 :ERQVLEHI T0292 61 :KHPNIVRYY 1vzoA 110 :QSPFLVTLH T0292 72 :I 1vzoA 121 :F T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1vzoA 122 :QTETKLHLILDYINGGELFTHLSQRER T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1vzoA 149 :FTEHEVQIYVGEIVLALEHLHKLG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1vzoA 173 :IIYRDIKLENILLDSNGHVVLTDFGLSKEFVAD T0292 168 :TSFAKAFVGTPYYMSPEQMNR 1vzoA 207 :TERAYDFCGTIEYMAPDIVRG T0292 193 :EKSDIWSLGCLLYELCALMPPF 1vzoA 234 :KAVDWWSLGVLMYELLTGASPF T0292 215 :TAFSQKELAGKIREGKF 1vzoA 260 :EKNSQAEISRRILKSEP T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRP 1vzoA 277 :PYPQEMSALAKDLIQRLLMKDPKKRL T0292 260 :VEEILENPLILEH 1vzoA 309 :ADEIKEHLFFQKI Number of specific fragments extracted= 14 number of extra gaps= 1 total=951 Number of alignments=88 # 1vzoA read from 1vzoA/merged-good-all-a2m # found chain 1vzoA in training set Warning: unaligning (T0292)D70 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1vzoA)A120 Warning: unaligning (T0292)R71 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1vzoA)A120 Warning: unaligning (T0292)N192 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vzoA)D233 Warning: unaligning (T0292)S259 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vzoA)D308 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRR 1vzoA 45 :GIENFELLKVLGTGAYGKVFLVRK T0292 26 :KSDGKILVWKELDY 1vzoA 72 :HDTGKLYAMKVLKK T0292 40 :GSM 1vzoA 96 :EHT T0292 43 :TE 1vzoA 100 :TE T0292 54 :VNLLREL 1vzoA 102 :RQVLEHI T0292 61 :KHPNIVRYY 1vzoA 110 :QSPFLVTLH T0292 72 :I 1vzoA 121 :F T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1vzoA 122 :QTETKLHLILDYINGGELFTHLSQRER T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1vzoA 149 :FTEHEVQIYVGEIVLALEHLHKLG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1vzoA 173 :IIYRDIKLENILLDSNGHVVLTDFGLSKEFVADETER T0292 172 :KAFVGTPYYMSPEQMNR 1vzoA 211 :YDFCGTIEYMAPDIVRG T0292 193 :EKSDIWSLGCLLYELCALMPPF 1vzoA 234 :KAVDWWSLGVLMYELLTGASPF T0292 215 :TAFSQKELAGKIREGKFR 1vzoA 260 :EKNSQAEISRRILKSEPP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1vzoA 278 :YPQEMSALAKDLIQRLLMKDPKKRL T0292 260 :VEEILENPLILEHH 1vzoA 309 :ADEIKEHLFFQKIN T0292 274 :HHH 1vzoA 330 :KVP Number of specific fragments extracted= 16 number of extra gaps= 2 total=967 Number of alignments=89 # 1vzoA read from 1vzoA/merged-good-all-a2m # found chain 1vzoA in training set Warning: unaligning (T0292)D70 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1vzoA)A120 Warning: unaligning (T0292)R71 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1vzoA)A120 Warning: unaligning (T0292)N192 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1vzoA)D233 Warning: unaligning (T0292)S259 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vzoA)D308 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRK 1vzoA 44 :VGIENFELLKVLGTGAYGKVFLVRKI T0292 27 :SDGKILVWKELDY 1vzoA 73 :DTGKLYAMKVLKK T0292 40 :GSM 1vzoA 96 :EHT T0292 43 :TE 1vzoA 100 :TE T0292 54 :VNLLREL 1vzoA 102 :RQVLEHI T0292 61 :KHPNIVRYY 1vzoA 110 :QSPFLVTLH T0292 72 :IIDRTN 1vzoA 121 :FQTETK T0292 80 :LYIVMEYCEGGDLASVITK 1vzoA 127 :LHLILDYINGGELFTHLSQ T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1vzoA 146 :RERFTEHEVQIYVGEIVLALEHLHKL T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1vzoA 172 :GIIYRDIKLENILLDSNGHVVLTDFGLSKEFVAD T0292 168 :TSFAKAFVGTPYYMSPEQMNR 1vzoA 207 :TERAYDFCGTIEYMAPDIVRG T0292 193 :EKSDIWSLGCLLYELCALMPPF 1vzoA 234 :KAVDWWSLGVLMYELLTGASPF T0292 215 :TAFSQKELAGKIREGKFR 1vzoA 260 :EKNSQAEISRRILKSEPP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1vzoA 278 :YPQEMSALAKDLIQRLLMKDPKKRL T0292 260 :VEEILENPLILEHH 1vzoA 309 :ADEIKEHLFFQKIN Number of specific fragments extracted= 15 number of extra gaps= 2 total=982 Number of alignments=90 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wbsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wbsA expands to /projects/compbio/data/pdb/1wbs.pdb.gz 1wbsA:# T0292 read from 1wbsA/merged-good-all-a2m # 1wbsA read from 1wbsA/merged-good-all-a2m # adding 1wbsA to template set # found chain 1wbsA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1wbsA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARS T0292 78 :TTLYIVMEYCE 1wbsA 100 :NDVYLVTHLMG T0292 90 :GDLASVITKGT 1wbsA 111 :ADLNNIVKCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1wbsA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLA 1wbsA 146 :IIHRDLKPSNLAVNEDCELKILDFGLA T0292 165 :NHDTSFAKAFVGTPYYMSPEQMNR 1wbsA 173 :RHTDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1wbsA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILR T0292 230 :KFRRIPYR 1wbsA 261 :SLTQMPKM T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1wbsA 277 :ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQY T0292 276 :HH 1wbsA 321 :DP Number of specific fragments extracted= 10 number of extra gaps= 0 total=992 Number of alignments=91 # 1wbsA read from 1wbsA/merged-good-all-a2m # found chain 1wbsA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 1wbsA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTP T0292 75 :RTN 1wbsA 96 :LEE T0292 78 :TTLYIVMEYCEG 1wbsA 100 :NDVYLVTHLMGA T0292 91 :DLASVITKGT 1wbsA 112 :DLNNIVKCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1wbsA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLAR 1wbsA 146 :IIHRDLKPSNLAVNEDCELKILDFGLAR T0292 166 :HDTSFAKAFVGTPYYMSPEQMNR 1wbsA 174 :HTDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTA 1wbsA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPG T0292 217 :FSQKELAGKIREGKFRRIPYR 1wbsA 250 :ISSESARNYIQSLTQMPKMNF T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1wbsA 277 :ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYH T0292 274 :H 1wbsA 321 :D Number of specific fragments extracted= 11 number of extra gaps= 0 total=1003 Number of alignments=92 # 1wbsA read from 1wbsA/merged-good-all-a2m # found chain 1wbsA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 1wbsA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTP T0292 75 :RTNTTLYIVMEYCEG 1wbsA 97 :EEFNDVYLVTHLMGA T0292 91 :DLASVITK 1wbsA 112 :DLNNIVKC T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1wbsA 120 :QKLTDDHVQFLIYQILRGLKYIHSA T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLA 1wbsA 145 :DIIHRDLKPSNLAVNEDCELKILDFGLA T0292 165 :NHDTSFAKAFVGTPYYMSPEQMNR 1wbsA 173 :RHTDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1wbsA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1wbsA 273 :VFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDD Number of specific fragments extracted= 8 number of extra gaps= 0 total=1011 Number of alignments=93 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1apmE/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1apmE expands to /projects/compbio/data/pdb/1apm.pdb.gz 1apmE:Skipped atom 336, because occupancy 0.460 <= existing 0.540 in 1apmE Skipped atom 338, because occupancy 0.460 <= existing 0.540 in 1apmE Skipped atom 340, because occupancy 0.460 <= existing 0.540 in 1apmE Skipped atom 342, because occupancy 0.460 <= existing 0.540 in 1apmE Skipped atom 344, because occupancy 0.460 <= existing 0.540 in 1apmE Skipped atom 346, because occupancy 0.460 <= existing 0.540 in 1apmE Skipped atom 348, because occupancy 0.460 <= existing 0.540 in 1apmE # T0292 read from 1apmE/merged-good-all-a2m # 1apmE read from 1apmE/merged-good-all-a2m # adding 1apmE to template set # found chain 1apmE in template set T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1apmE 39 :QLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVK T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 1apmE 83 :KQIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1apmE 111 :KDNSNLYMVMEYVAGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1apmE 138 :FAEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1apmE 162 :LIYRDLKPENLLIDQQGYIQVTDFGFAKRVK T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1apmE 193 :GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRP 1apmE 256 :RFPSHFSSDLKDLLRNLLQVDLTKRF T0292 260 :VEEILENPLILEH 1apmE 288 :VNDIKNHKWFATT Number of specific fragments extracted= 8 number of extra gaps= 0 total=1019 Number of alignments=94 # 1apmE read from 1apmE/merged-good-all-a2m # found chain 1apmE in template set T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1apmE 39 :QLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1apmE 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1apmE 111 :KDNSNLYMVMEYVAGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1apmE 138 :FAEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1apmE 162 :LIYRDLKPENLLIDQQGYIQVTDFGFAKRVK T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1apmE 193 :GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1apmE 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 259 :SVEEILENPLILEHH 1apmE 287 :GVNDIKNHKWFATTD Number of specific fragments extracted= 8 number of extra gaps= 0 total=1027 Number of alignments=95 # 1apmE read from 1apmE/merged-good-all-a2m # found chain 1apmE in template set T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1apmE 38 :AQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1apmE 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSN T0292 80 :LYIVMEYCEGGDLASVITK 1apmE 116 :LYMVMEYVAGGEMFSHLRR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1apmE 135 :IGRFAEPHARFYAAQIVLTFEYLHSL T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1apmE 161 :DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGR T0292 171 :AKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1apmE 195 :TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1apmE 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 261 :EEILENPLILEHH 1apmE 289 :NDIKNHKWFATTD Number of specific fragments extracted= 8 number of extra gaps= 0 total=1035 Number of alignments=96 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xjdA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xjdA expands to /projects/compbio/data/pdb/1xjd.pdb.gz 1xjdA:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 1xjdA/merged-good-all-a2m # 1xjdA read from 1xjdA/merged-good-all-a2m # adding 1xjdA to template set # found chain 1xjdA in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1xjdA)I377 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xjdA)F539 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xjdA)F539 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 1xjdA 378 :EDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD T0292 47 :KQMLVSEVNLLREL 1xjdA 422 :VECTMVEKRVLSLA T0292 61 :KHPNIVRYYDRI 1xjdA 437 :EHPFLTHMFCTF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1xjdA 449 :QTKENLFFVMEYLNGGDLMYHIQSCHK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1xjdA 476 :FDLSRATFYAAEIILGLQFLHSKG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1xjdA 500 :IVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1xjdA 540 :CGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNP T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRP 1xjdA 597 :FYPRWLEKEAKDLLVKLFVREPEKRL T0292 263 :ILENPLILEH 1xjdA 628 :IRQHPLFREI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1044 Number of alignments=97 # 1xjdA read from 1xjdA/merged-good-all-a2m # found chain 1xjdA in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1xjdA)I377 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xjdA)F539 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xjdA)F539 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1xjdA 378 :EDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVV T0292 43 :TEAEKQMLVSEVNLLREL 1xjdA 418 :MDDDVECTMVEKRVLSLA T0292 61 :KHPNIVRYYDRI 1xjdA 437 :EHPFLTHMFCTF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1xjdA 449 :QTKENLFFVMEYLNGGDLMYHIQSCHK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1xjdA 476 :FDLSRATFYAAEIILGLQFLHSKG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1xjdA 500 :IVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1xjdA 540 :CGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1xjdA 598 :YPRWLEKEAKDLLVKLFVREPEKRL T0292 259 :S 1xjdA 627 :D T0292 263 :ILENPLILEHH 1xjdA 628 :IRQHPLFREIN T0292 274 :HHH 1xjdA 646 :EID Number of specific fragments extracted= 11 number of extra gaps= 0 total=1055 Number of alignments=98 # 1xjdA read from 1xjdA/merged-good-all-a2m # found chain 1xjdA in template set Warning: unaligning (T0292)A3 because first residue in template chain is (1xjdA)I377 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xjdA)F539 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xjdA)F539 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1xjdA 378 :EDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVV T0292 43 :TEAEKQMLVSEVNLLREL 1xjdA 418 :MDDDVECTMVEKRVLSLA T0292 61 :KHPNIVRYYDRIIDRTN 1xjdA 437 :EHPFLTHMFCTFQTKEN T0292 80 :LYIVMEYCEGGDLASVITK 1xjdA 454 :LFFVMEYLNGGDLMYHIQS T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1xjdA 473 :CHKFDLSRATFYAAEIILGLQFLHSK T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1xjdA 499 :GIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1xjdA 540 :CGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1xjdA 598 :YPRWLEKEAKDLLVKLFVREPEKRL T0292 263 :ILENPLILEHH 1xjdA 628 :IRQHPLFREIN Number of specific fragments extracted= 9 number of extra gaps= 0 total=1064 Number of alignments=99 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yhvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yhvA expands to /projects/compbio/data/pdb/1yhv.pdb.gz 1yhvA:# T0292 read from 1yhvA/merged-good-all-a2m # 1yhvA read from 1yhvA/merged-good-all-a2m # adding 1yhvA to template set # found chain 1yhvA in template set Warning: unaligning (T0292)D167 because of BadResidue code BAD_PEPTIDE in next template residue (1yhvA)Q418 Warning: unaligning (T0292)T168 because of BadResidue code BAD_PEPTIDE at template residue (1yhvA)Q418 Warning: unaligning (T0292)S169 because of BadResidue code BAD_PEPTIDE at template residue (1yhvA)S419 T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 1yhvA 267 :KKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKE T0292 49 :MLVSEVNLLRELKHPNIVRYYDRI 1yhvA 311 :LIINEILVMRENKNPNIVNYLDSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 1yhvA 335 :LVGDELWVVMEYLAGGSLTDVVTETC T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1yhvA 361 :MDEGQIAAVCRECLQALEFLHSNQ T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1yhvA 385 :VIHRDIKSDNILLGMDGSVKLTDFGFCAQITP T0292 170 :FAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 1yhvA 420 :KRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPEL T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 1yhvA 487 :PEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKP Number of specific fragments extracted= 7 number of extra gaps= 1 total=1071 Number of alignments=100 # 1yhvA read from 1yhvA/merged-good-all-a2m # found chain 1yhvA in template set Warning: unaligning (T0292)D167 because of BadResidue code BAD_PEPTIDE in next template residue (1yhvA)Q418 Warning: unaligning (T0292)T168 because of BadResidue code BAD_PEPTIDE at template residue (1yhvA)Q418 Warning: unaligning (T0292)S169 because of BadResidue code BAD_PEPTIDE at template residue (1yhvA)S419 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEA 1yhvA 268 :KKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKK T0292 48 :QMLVSEVNLLRELKHPNIVRYYDRI 1yhvA 310 :ELIINEILVMRENKNPNIVNYLDSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 1yhvA 335 :LVGDELWVVMEYLAGGSLTDVVTETC T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1yhvA 361 :MDEGQIAAVCRECLQALEFLHSNQ T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1yhvA 385 :VIHRDIKSDNILLGMDGSVKLTDFGFCAQITP T0292 170 :FAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 1yhvA 420 :KRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPEL T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 1yhvA 487 :PEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKP Number of specific fragments extracted= 7 number of extra gaps= 1 total=1078 Number of alignments=101 # 1yhvA read from 1yhvA/merged-good-all-a2m # found chain 1yhvA in template set Warning: unaligning (T0292)D167 because of BadResidue code BAD_PEPTIDE in next template residue (1yhvA)Q418 Warning: unaligning (T0292)T168 because of BadResidue code BAD_PEPTIDE at template residue (1yhvA)Q418 Warning: unaligning (T0292)S169 because of BadResidue code BAD_PEPTIDE at template residue (1yhvA)S419 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1yhvA 268 :KKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQ T0292 44 :E 1yhvA 308 :K T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1yhvA 309 :KELIINEILVMRENKNPNIVNYLDSYLVGDE T0292 80 :LYIVMEYCEGGDLASVITK 1yhvA 340 :LWVVMEYLAGGSLTDVVTE T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1yhvA 359 :TCMDEGQIAAVCRECLQALEFLHSN T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1yhvA 384 :QVIHRDIKSDNILLGMDGSVKLTDFGFCAQITP T0292 170 :FAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1yhvA 420 :KRSEMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPE T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 1yhvA 486 :NPEKLSAIFRDFLNRCLDMDVEKRGSAKELLQHQFLKIAKP Number of specific fragments extracted= 8 number of extra gaps= 1 total=1086 Number of alignments=102 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ac3A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2ac3A expands to /projects/compbio/data/pdb/2ac3.pdb.gz 2ac3A:# T0292 read from 2ac3A/merged-good-all-a2m # 2ac3A read from 2ac3A/merged-good-all-a2m # adding 2ac3A to template set # found chain 2ac3A in template set Warning: unaligning (T0292)Y10 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)V89 Warning: unaligning (T0292)T11 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)V89 Warning: unaligning (T0292)S41 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)G120 Warning: unaligning (T0292)M42 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)G120 Warning: unaligning (T0292)T79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ac3A)F155 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ac3A)F155 Warning: unaligning (T0292)R162 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ac3A)C251 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2ac3A)C251 Warning: unaligning (T0292)R232 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)F329 Warning: unaligning (T0292)I234 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)F329 Warning: unaligning (T0292)L270 because last residue in template chain is (2ac3A)Q369 T0292 5 :DYEVL 2ac3A 82 :VYQLQ T0292 12 :IGTGSYGRCQKIRRKSDGKILVWKELDYG 2ac3A 90 :LGEGAHARVQTCINLITSQEYAVKIIEKQ T0292 43 :TEA 2ac3A 121 :HIR T0292 48 :QMLVSEVNLLREL 2ac3A 124 :SRVFREVEMLYQC T0292 61 :KHPNIVRYYDRI 2ac3A 138 :GHRNVLELIEFF T0292 75 :RTNT 2ac3A 150 :EEED T0292 81 :YIVMEYCEGGDLASVITKGTK 2ac3A 156 :YLVFEKMRGGSILSHIHKRRH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2ac3A 177 :FNELEASVVVQDVASALDFLHNKG T0292 135 :VLHRDLKPANVFLDGKQN 2ac3A 201 :IAHRDLKPENILCEHPNQ T0292 153 :VKLGDFGLA 2ac3A 222 :VKICDFDLG T0292 176 :GTPYYMSPEQMNRMS 2ac3A 252 :GSAEYMAPEVVEAFS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFS 2ac3A 272 :YDKRCDLWSLGVILYILLSGYPPFVGRC T0292 219 :QKELAGKIREGKF 2ac3A 315 :QNMLFESIQEGKY T0292 235 :P 2ac3A 330 :P T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLI 2ac3A 335 :AHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWV Number of specific fragments extracted= 15 number of extra gaps= 4 total=1101 Number of alignments=103 # 2ac3A read from 2ac3A/merged-good-all-a2m # found chain 2ac3A in template set Warning: unaligning (T0292)Y10 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)V89 Warning: unaligning (T0292)T11 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)V89 Warning: unaligning (T0292)S41 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)G120 Warning: unaligning (T0292)M42 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)G120 Warning: unaligning (T0292)T79 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ac3A)F155 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ac3A)F155 Warning: unaligning (T0292)R162 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ac3A)C251 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2ac3A)C251 Warning: unaligning (T0292)R233 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)F329 Warning: unaligning (T0292)I234 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)F329 Warning: unaligning (T0292)L270 because last residue in template chain is (2ac3A)Q369 T0292 2 :RAED 2ac3A 78 :RFED T0292 6 :YEVL 2ac3A 83 :YQLQ T0292 12 :IGTGSYGRCQKIRRKSDGKILVWKELDYG 2ac3A 90 :LGEGAHARVQTCINLITSQEYAVKIIEKQ T0292 43 :T 2ac3A 122 :I T0292 47 :KQMLVSEVNLLREL 2ac3A 123 :RSRVFREVEMLYQC T0292 61 :KHPNIVRYYDRI 2ac3A 138 :GHRNVLELIEFF T0292 75 :RTNT 2ac3A 150 :EEED T0292 81 :YIVMEYCEGGDLASVITKGTK 2ac3A 156 :YLVFEKMRGGSILSHIHKRRH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2ac3A 177 :FNELEASVVVQDVASALDFLHNKG T0292 135 :VLHRDLKPANVFL 2ac3A 201 :IAHRDLKPENILC T0292 148 :DGKQ 2ac3A 215 :HPNQ T0292 152 :NVKLGDFGLA 2ac3A 221 :PVKICDFDLG T0292 176 :GTPYYMSPEQMNRMS 2ac3A 252 :GSAEYMAPEVVEAFS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTA 2ac3A 272 :YDKRCDLWSLGVILYILLSGYPPFVG T0292 218 :S 2ac3A 311 :C T0292 219 :QKELAGKIREGKFR 2ac3A 314 :CQNMLFESIQEGKY T0292 235 :P 2ac3A 330 :P T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLI 2ac3A 335 :AHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWV Number of specific fragments extracted= 18 number of extra gaps= 4 total=1119 Number of alignments=104 # 2ac3A read from 2ac3A/merged-good-all-a2m # found chain 2ac3A in template set Warning: unaligning (T0292)S41 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)G120 Warning: unaligning (T0292)M42 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)G120 Warning: unaligning (T0292)N77 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ac3A)F155 Warning: unaligning (T0292)L80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ac3A)F155 Warning: unaligning (T0292)R162 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ac3A)C251 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2ac3A)C251 Warning: unaligning (T0292)R232 because of BadResidue code BAD_PEPTIDE in next template residue (2ac3A)F329 Warning: unaligning (T0292)R233 because of BadResidue code BAD_PEPTIDE at template residue (2ac3A)F329 Warning: unaligning (T0292)L270 because last residue in template chain is (2ac3A)Q369 T0292 12 :IGTGSYGRCQKIRRKSDGKILVWKELDYG 2ac3A 90 :LGEGAHARVQTCINLITSQEYAVKIIEKQ T0292 43 :T 2ac3A 122 :I T0292 47 :KQMLVSEVNLLREL 2ac3A 123 :RSRVFREVEMLYQC T0292 61 :KHPNIVRYYDRIIDRT 2ac3A 138 :GHRNVLELIEFFEEED T0292 81 :YIVMEYCEGGDLASVITK 2ac3A 156 :YLVFEKMRGGSILSHIHK T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 2ac3A 174 :RRHFNELEASVVVQDVASALDFLHNK T0292 134 :TVLHRDLKPANVFL 2ac3A 200 :GIAHRDLKPENILC T0292 148 :DGK 2ac3A 215 :HPN T0292 151 :QNVKLGDFGLA 2ac3A 220 :SPVKICDFDLG T0292 176 :GTPYYMSPEQMNR 2ac3A 252 :GSAEYMAPEVVEA T0292 191 :YNEKSDIWSLGCLLYELCALMPPFT 2ac3A 272 :YDKRCDLWSLGVILYILLSGYPPFV T0292 216 :AFS 2ac3A 300 :GSD T0292 219 :QKELAGKIREGKF 2ac3A 315 :QNMLFESIQEGKY T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLI 2ac3A 333 :DWAHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWV Number of specific fragments extracted= 14 number of extra gaps= 3 total=1133 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tvoA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tvoA expands to /projects/compbio/data/pdb/1tvo.pdb.gz 1tvoA:# T0292 read from 1tvoA/merged-good-all-a2m # 1tvoA read from 1tvoA/merged-good-all-a2m # adding 1tvoA to template set # found chain 1tvoA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGS 1tvoA 23 :PRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 1tvoA 61 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYCE 1tvoA 100 :DVYIVQDLME T0292 90 :GDLASVI 1tvoA 110 :TDLYKLL T0292 98 :KGTK 1tvoA 117 :KTQH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1tvoA 121 :LSNDHICYFLYQILRGLKYIHSAN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDT 1tvoA 145 :VLHRDLKPSNLLLNTTCDLKICDFGLARVADPDH T0292 169 :SFAKAFVGTPYYMSPEQMNR 1tvoA 182 :GFLTEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1tvoA 203 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG T0292 229 :GKFRRI 1tvoA 267 :LPHKNK T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1tvoA 280 :PNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQY Number of specific fragments extracted= 11 number of extra gaps= 0 total=1144 Number of alignments=106 # 1tvoA read from 1tvoA/merged-good-all-a2m # found chain 1tvoA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGS 1tvoA 23 :PRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 1tvoA 61 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYCEG 1tvoA 100 :DVYIVQDLMET T0292 91 :DLASVITKGT 1tvoA 111 :DLYKLLKTQH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1tvoA 121 :LSNDHICYFLYQILRGLKYIHSAN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1tvoA 145 :VLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT T0292 172 :KAFVGTPYYMSPEQMNR 1tvoA 185 :TEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYR 1tvoA 203 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQED T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1tvoA 282 :ADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYY T0292 274 :H 1tvoA 326 :E Number of specific fragments extracted= 10 number of extra gaps= 0 total=1154 Number of alignments=107 # 1tvoA read from 1tvoA/merged-good-all-a2m # found chain 1tvoA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGS 1tvoA 23 :PRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 1tvoA 61 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYCEG 1tvoA 100 :DVYIVQDLMET T0292 91 :DLASVITK 1tvoA 111 :DLYKLLKT T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1tvoA 119 :QHLSNDHICYFLYQILRGLKYIHSA T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1tvoA 144 :NVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD T0292 168 :TSFAKAFVGTPYYMSPEQMNR 1tvoA 181 :TGFLTEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1tvoA 203 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG T0292 229 :GKFRR 1tvoA 245 :GSPSQ T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 1tvoA 278 :LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPS Number of specific fragments extracted= 10 number of extra gaps= 0 total=1164 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ac5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2ac5A expands to /projects/compbio/data/pdb/2ac5.pdb.gz 2ac5A:Skipped atom 1257, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1259, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1261, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1263, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1265, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1267, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1269, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1271, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1273, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1275, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1277, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1279, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1281, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1283, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1285, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1287, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1289, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1291, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1293, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1295, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1297, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1299, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1301, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1303, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1305, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1307, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1309, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1311, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1313, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1315, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1317, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1319, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1321, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1323, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1325, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1327, because occupancy 0.500 <= existing 0.500 in 2ac5A Skipped atom 1329, because occupancy 0.500 <= existing 0.500 in 2ac5A # T0292 read from 2ac5A/merged-good-all-a2m # 2ac5A read from 2ac5A/merged-good-all-a2m # adding 2ac5A to template set # found chain 2ac5A in template set Warning: unaligning (T0292)G159 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ac5A)P250 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2ac5A)P250 Warning: unaligning (T0292)E271 because last residue in template chain is (2ac5A)G370 T0292 3 :AED 2ac5A 79 :FED T0292 6 :YEVLYT 2ac5A 83 :YQLQED T0292 12 :IGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEA 2ac5A 90 :LGEGAHARVQTCINLITSQEYAVKIIEKQPGHIR T0292 48 :QMLVSEVNLLREL 2ac5A 124 :SRVFREVEMLYQC T0292 61 :KHPNIVRYYDRI 2ac5A 138 :GHRNVLELIEFF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 2ac5A 150 :EEEDRFYLVFEKMRGGSILSHIHKRRH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2ac5A 177 :FNELEASVVVQDVASALDFLHNKG T0292 135 :VLHRDLKPANVFLDGKQN 2ac5A 201 :IAHRDLKPENILCEHPNQ T0292 153 :VKLGDF 2ac5A 222 :VKICDF T0292 175 :VGTPYYMSPEQMNRMS 2ac5A 251 :CGSAEYMAPEVVEAFS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTAFS 2ac5A 272 :YDKRCDLWSLGVILYILLSGYPPFVGRC T0292 219 :QKELAGKIREGKFR 2ac5A 315 :QNMLFESIQEGKYE T0292 234 :IP 2ac5A 329 :FP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 2ac5A 335 :AHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQ Number of specific fragments extracted= 14 number of extra gaps= 0 total=1178 Number of alignments=109 # 2ac5A read from 2ac5A/merged-good-all-a2m # found chain 2ac5A in template set Warning: unaligning (T0292)G159 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ac5A)P250 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2ac5A)P250 Warning: unaligning (T0292)E271 because last residue in template chain is (2ac5A)G370 T0292 2 :RAED 2ac5A 78 :RFED T0292 6 :YEVLYT 2ac5A 83 :YQLQED T0292 12 :IGTGSYGRCQKIRRKSDGKILVWKELDYGSM 2ac5A 90 :LGEGAHARVQTCINLITSQEYAVKIIEKQPG T0292 43 :T 2ac5A 122 :I T0292 47 :KQMLVSEVNLLREL 2ac5A 123 :RSRVFREVEMLYQC T0292 61 :KHPNIVRYYDRI 2ac5A 138 :GHRNVLELIEFF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 2ac5A 150 :EEEDRFYLVFEKMRGGSILSHIHKRRH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2ac5A 177 :FNELEASVVVQDVASALDFLHNKG T0292 135 :VLHRDLKPANVFL 2ac5A 201 :IAHRDLKPENILC T0292 148 :DGKQ 2ac5A 215 :HPNQ T0292 152 :NVKLGDF 2ac5A 221 :PVKICDF T0292 175 :VGTPYYMSPEQMNRMS 2ac5A 251 :CGSAEYMAPEVVEAFS T0292 191 :YNEKSDIWSLGCLLYELCALMPPFTA 2ac5A 272 :YDKRCDLWSLGVILYILLSGYPPFVG T0292 218 :S 2ac5A 311 :C T0292 219 :QKELAGKIREGKFRRIP 2ac5A 314 :CQNMLFESIQEGKYEFP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 2ac5A 335 :AHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQ Number of specific fragments extracted= 16 number of extra gaps= 0 total=1194 Number of alignments=110 # 2ac5A read from 2ac5A/merged-good-all-a2m # found chain 2ac5A in template set Warning: unaligning (T0292)G159 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2ac5A)P250 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2ac5A)P250 Warning: unaligning (T0292)E271 because last residue in template chain is (2ac5A)G370 T0292 2 :RAED 2ac5A 78 :RFED T0292 6 :YEVLYT 2ac5A 83 :YQLQED T0292 12 :IGTGSYGRCQKIRRKSDGKILVWKELDYGSM 2ac5A 90 :LGEGAHARVQTCINLITSQEYAVKIIEKQPG T0292 43 :T 2ac5A 122 :I T0292 47 :KQMLVSEVNLLREL 2ac5A 123 :RSRVFREVEMLYQC T0292 61 :KHPNIVRYYDRIIDRTN 2ac5A 138 :GHRNVLELIEFFEEEDR T0292 80 :LYIVMEYCEGGDLASVITK 2ac5A 155 :FYLVFEKMRGGSILSHIHK T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 2ac5A 174 :RRHFNELEASVVVQDVASALDFLHNK T0292 134 :TVLHRDLKPANVFL 2ac5A 200 :GIAHRDLKPENILC T0292 148 :DGK 2ac5A 215 :HPN T0292 151 :QNVKLGDF 2ac5A 220 :SPVKICDF T0292 175 :VGTPYYMSPEQMNR 2ac5A 251 :CGSAEYMAPEVVEA T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFS 2ac5A 270 :SIYDKRCDLWSLGVILYILLSGYPPFVGRC T0292 219 :QKELAGKIREGKFR 2ac5A 315 :QNMLFESIQEGKYE T0292 234 :IP 2ac5A 329 :FP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 2ac5A 335 :AHISCAAKDLISKLLVRDAKQRLSAAQVLQHPWVQ Number of specific fragments extracted= 16 number of extra gaps= 0 total=1210 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 3erk/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 3erk expands to /projects/compbio/data/pdb/3erk.pdb.gz 3erk:Warning: there is no chain 3erk will retry with 3erkA # T0292 read from 3erk/merged-good-all-a2m # 3erk read from 3erk/merged-good-all-a2m # adding 3erk to template set # found chain 3erk in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGS 3erk 21 :PRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 3erk 59 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYCE 3erk 98 :DVYIVQDLME T0292 90 :GDLASVITKG 3erk 108 :TDLYKLLKTQ T0292 101 :K 3erk 118 :H T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 3erk 119 :LSNDHICYFLYQILRGLKYIHSAN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDT 3erk 143 :VLHRDLKPSNLLLNTTCDLKICDFGLARVADPDH T0292 169 :SFAKAFVGTPYYMSPEQMNR 3erk 180 :GFLTEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 3erk 201 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG T0292 229 :GKFRRIP 3erk 266 :PHKNKVP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 3erk 278 :PNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQY Number of specific fragments extracted= 11 number of extra gaps= 0 total=1221 Number of alignments=112 # 3erk read from 3erk/merged-good-all-a2m # found chain 3erk in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGS 3erk 21 :PRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 3erk 59 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYCEG 3erk 98 :DVYIVQDLMET T0292 91 :DLASVITKGT 3erk 109 :DLYKLLKTQH T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 3erk 119 :LSNDHICYFLYQILRGLKYIHSAN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 3erk 143 :VLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT T0292 172 :KAFVGTPYYMSPEQMNR 3erk 183 :TEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPY 3erk 201 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQE T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 3erk 280 :ADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYY T0292 274 :H 3erk 324 :E Number of specific fragments extracted= 10 number of extra gaps= 0 total=1231 Number of alignments=113 # 3erk read from 3erk/merged-good-all-a2m # found chain 3erk in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGS 3erk 21 :PRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFE T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 3erk 59 :HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIE T0292 79 :TLYIVMEYCEG 3erk 98 :DVYIVQDLMET T0292 91 :DLASVITK 3erk 109 :DLYKLLKT T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 3erk 117 :QHLSNDHICYFLYQILRGLKYIHSA T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 3erk 142 :NVLHRDLKPSNLLLNTTCDLKICDFGLARVADPD T0292 168 :TSFAKAFVGTPYYMSPEQMNR 3erk 179 :TGFLTEYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 3erk 201 :KGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 3erk 276 :LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPS Number of specific fragments extracted= 9 number of extra gaps= 0 total=1240 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bvaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2bvaA expands to /projects/compbio/data/pdb/2bva.pdb.gz 2bvaA:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 2bvaA/merged-good-all-a2m # 2bvaA read from 2bvaA/merged-good-all-a2m # adding 2bvaA to template set # found chain 2bvaA in template set Warning: unaligning (T0292)N152 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)V454 Warning: unaligning (T0292)V153 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)V454 Warning: unaligning (T0292)G156 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)D458 Warning: unaligning (T0292)D157 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)D458 Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bvaA)E468 Warning: unaligning (T0292)D167 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bvaA)E468 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bvaA)L475 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bvaA)L475 Warning: unaligning (T0292)T177 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)P479 Warning: unaligning (T0292)P178 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)P479 T0292 51 :VSEVNLLRELKHPNIVRYYDRI 2bvaA 364 :FNEVVIMRDYQHENVVEMYNSY T0292 75 :RTNTTLYIVMEYCEGGDLAS 2bvaA 386 :LVGDELWVVMEFLEGGALTD T0292 96 :ITKGTK 2bvaA 406 :IVTHTR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bvaA 412 :MNEEQIAAVCLAVLQALSVLHAQG T0292 135 :VLHRDLKPANVFLDGKQ 2bvaA 436 :VIHRDIKSDSILLTHDG T0292 154 :KL 2bvaA 455 :KL T0292 158 :FGLARI 2bvaA 459 :FGFCAQ T0292 168 :TSFA 2bvaA 469 :VPRR T0292 175 :VG 2bvaA 476 :VG T0292 179 :YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 2bvaA 480 :YWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRL T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 2bvaA 538 :LHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAG Number of specific fragments extracted= 11 number of extra gaps= 3 total=1251 Number of alignments=115 # 2bvaA read from 2bvaA/merged-good-all-a2m # found chain 2bvaA in template set Warning: unaligning (T0292)N152 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)V454 Warning: unaligning (T0292)V153 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)V454 Warning: unaligning (T0292)G156 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)D458 Warning: unaligning (T0292)D157 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)D458 Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bvaA)E468 Warning: unaligning (T0292)D167 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bvaA)E468 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bvaA)L475 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bvaA)L475 Warning: unaligning (T0292)T177 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)P479 Warning: unaligning (T0292)P178 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)P479 T0292 51 :VSEVNLLRELKHPNIVRYYDRI 2bvaA 364 :FNEVVIMRDYQHENVVEMYNSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 2bvaA 386 :LVGDELWVVMEFLEGGALTDIVTHTR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2bvaA 412 :MNEEQIAAVCLAVLQALSVLHAQG T0292 135 :VLHRDLKPANVFLDGKQ 2bvaA 436 :VIHRDIKSDSILLTHDG T0292 154 :KL 2bvaA 455 :KL T0292 158 :FGLARI 2bvaA 459 :FGFCAQ T0292 168 :TSFA 2bvaA 469 :VPRR T0292 175 :VG 2bvaA 476 :VG T0292 179 :YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 2bvaA 480 :YWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRL T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 2bvaA 538 :LHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAG Number of specific fragments extracted= 10 number of extra gaps= 3 total=1261 Number of alignments=116 # 2bvaA read from 2bvaA/merged-good-all-a2m # found chain 2bvaA in template set Warning: unaligning (T0292)N152 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)V454 Warning: unaligning (T0292)V153 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)V454 Warning: unaligning (T0292)G156 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)D458 Warning: unaligning (T0292)D157 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)D458 Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bvaA)E468 Warning: unaligning (T0292)D167 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bvaA)E468 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2bvaA)L475 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2bvaA)L475 Warning: unaligning (T0292)T177 because of BadResidue code BAD_PEPTIDE in next template residue (2bvaA)P479 Warning: unaligning (T0292)P178 because of BadResidue code BAD_PEPTIDE at template residue (2bvaA)P479 T0292 51 :VSEVNLLRELKHPNIVRYYDRIIDRTN 2bvaA 364 :FNEVVIMRDYQHENVVEMYNSYLVGDE T0292 80 :LYIVMEYCEGGDLASVITK 2bvaA 391 :LWVVMEFLEGGALTDIVTH T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 2bvaA 410 :TRMNEEQIAAVCLAVLQALSVLHAQ T0292 134 :TVLHRDLKPANVFLDGKQ 2bvaA 435 :GVIHRDIKSDSILLTHDG T0292 154 :KL 2bvaA 455 :KL T0292 158 :FGLARI 2bvaA 459 :FGFCAQ T0292 168 :TSFA 2bvaA 469 :VPRR T0292 175 :VG 2bvaA 476 :VG T0292 179 :YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 2bvaA 480 :YWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 2bvaA 537 :NLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGP Number of specific fragments extracted= 10 number of extra gaps= 3 total=1271 Number of alignments=117 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s9jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s9jA expands to /projects/compbio/data/pdb/1s9j.pdb.gz 1s9jA:# T0292 read from 1s9jA/merged-good-all-a2m # 1s9jA read from 1s9jA/merged-good-all-a2m # adding 1s9jA to template set # found chain 1s9jA in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1s9jA)K84 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1s9jA)K84 Warning: unaligning (T0292)A171 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1s9jA)V224 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1s9jA)V224 Warning: unaligning (T0292)T215 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1s9jA)P306 T0292 2 :RAEDYEVLYTIGTGSYGRC 1s9jA 64 :KDDDFEKISELGAGNGGVV T0292 23 :IRRKSDGKILVWKELDYG 1s9jA 85 :VSHKPSGLVMARKLIHLE T0292 42 :MTEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1s9jA 103 :IKPAIRNQIIRELQVLHECNSPYIVGFYGAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1s9jA 134 :YSDGEISICMEHMDGGSLDQVLKKAGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRSD 1s9jA 161 :IPEQILGKVSIAVIKGLTYLREKHK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1s9jA 186 :IMHRDVKPSNILVNSRGEIKLCDFGVSGQLID T0292 169 :SF 1s9jA 218 :SM T0292 176 :GTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPF 1s9jA 225 :GTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPI T0292 216 :AFSQKELAGKIREGKFRRIP 1s9jA 307 :PMAIFELLDYIVNEPPPKLP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1s9jA 328 :GVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIK Number of specific fragments extracted= 10 number of extra gaps= 1 total=1281 Number of alignments=118 # 1s9jA read from 1s9jA/merged-good-all-a2m # found chain 1s9jA in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1s9jA)K84 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1s9jA)K84 Warning: unaligning (T0292)A171 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1s9jA)V224 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1s9jA)V224 T0292 2 :RAEDYEVLYTIGTGSYGRC 1s9jA 64 :KDDDFEKISELGAGNGGVV T0292 23 :IRRKSDGKILVWKELDYGS 1s9jA 85 :VSHKPSGLVMARKLIHLEI T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1s9jA 104 :KPAIRNQIIRELQVLHECNSPYIVGFYGAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1s9jA 134 :YSDGEISICMEHMDGGSLDQVLKKAGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRSD 1s9jA 161 :IPEQILGKVSIAVIKGLTYLREKHK T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1s9jA 186 :IMHRDVKPSNILVNSRGEIKLCDFGVSGQLID T0292 169 :SF 1s9jA 218 :SM T0292 176 :GTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTA 1s9jA 225 :GTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPP T0292 217 :FSQKELAGKIREGKFRRIP 1s9jA 308 :MAIFELLDYIVNEPPPKLP T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1s9jA 328 :GVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIK Number of specific fragments extracted= 10 number of extra gaps= 1 total=1291 Number of alignments=119 # 1s9jA read from 1s9jA/merged-good-all-a2m # found chain 1s9jA in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1s9jA)K84 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1s9jA)K84 Warning: unaligning (T0292)A171 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1s9jA)V224 Warning: unaligning (T0292)V175 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1s9jA)V224 T0292 2 :RAEDYEVLYTIGTGSYGRC 1s9jA 64 :KDDDFEKISELGAGNGGVV T0292 23 :IRRKSDGKILVWKELDYG 1s9jA 85 :VSHKPSGLVMARKLIHLE T0292 42 :MTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1s9jA 103 :IKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGE T0292 80 :LYIVMEYCEGGDLASVITK 1s9jA 139 :ISICMEHMDGGSLDQVLKK T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRRS 1s9jA 158 :AGRIPEQILGKVSIAVIKGLTYLREKH T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1s9jA 185 :KIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDS T0292 170 :F 1s9jA 219 :M T0292 176 :GTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFS 1s9jA 225 :GTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPD T0292 219 :QKELAGKIREGKFRR 1s9jA 310 :IFELLDYIVNEPPPK T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1s9jA 326 :PSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIK Number of specific fragments extracted= 10 number of extra gaps= 1 total=1301 Number of alignments=120 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tkiA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tkiA expands to /projects/compbio/data/pdb/1tki.pdb.gz 1tkiA:# T0292 read from 1tkiA/merged-good-all-a2m # 1tkiA read from 1tkiA/merged-good-all-a2m # adding 1tkiA to template set # found chain 1tkiA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELD 1tkiA 22 :EKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVK T0292 42 :MTEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1tkiA 57 :VKGTDQVLVKKEISILNIARHRNILHLHESF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTKE 1tkiA 88 :ESMEELVMIFEFISGLDIFERINTSAFE T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1tkiA 116 :LNEREIVSYVHQVCEALQFLHSHN T0292 135 :VLHRDLKPANVFLDGKQN 1tkiA 140 :IGHFDIRPENIIYQTRRS T0292 153 :VKLGDFGLARILNHD 1tkiA 160 :IKIIEFGQARQLKPG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 1tkiA 175 :DNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFD T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1tkiA 245 :KEISIEAMDFVDRLLVKERKSRMTASEALQHPWLKQK T0292 274 :H 1tkiA 287 :T Number of specific fragments extracted= 9 number of extra gaps= 0 total=1310 Number of alignments=121 # 1tkiA read from 1tkiA/merged-good-all-a2m # found chain 1tkiA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1tkiA 22 :EKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1tkiA 58 :KGTDQVLVKKEISILNIARHRNILHLHESF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTKE 1tkiA 88 :ESMEELVMIFEFISGLDIFERINTSAFE T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1tkiA 116 :LNEREIVSYVHQVCEALQFLHSHN T0292 135 :VLHRDLKPANVFL 1tkiA 140 :IGHFDIRPENIIY T0292 148 :DGKQNVKLGDFGLARILNHDT 1tkiA 155 :RRSSTIKIIEFGQARQLKPGD T0292 170 :FAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIP 1tkiA 176 :NFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDE T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1tkiA 245 :KEISIEAMDFVDRLLVKERKSRMTASEALQHPWLKQKI T0292 274 :H 1tkiA 286 :S Number of specific fragments extracted= 9 number of extra gaps= 0 total=1319 Number of alignments=122 # 1tkiA read from 1tkiA/merged-good-all-a2m # found chain 1tkiA in template set T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1tkiA 21 :YEKYMIAEDLGRGEFGIVHRCVETSSKKTYMAKFVKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1tkiA 58 :KGTDQVLVKKEISILNIARHRNILHLHESFESMEE T0292 80 :LYIVMEYCEGGDLASVITK 1tkiA 93 :LVMIFEFISGLDIFERINT T0292 102 :ERQYLDEEFVLRVMTQLTLALKECHRR 1tkiA 112 :SAFELNEREIVSYVHQVCEALQFLHSH T0292 134 :TVLHRDLKPANVFL 1tkiA 139 :NIGHFDIRPENIIY T0292 148 :DGKQNVKLGDFGLARILNHD 1tkiA 155 :RRSSTIKIIEFGQARQLKPG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1tkiA 175 :DNFRLLFTAPEYYAPEVHQHDVVSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTF T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILE 1tkiA 245 :KEISIEAMDFVDRLLVKERKSRMTASEALQHPWLKQ Number of specific fragments extracted= 8 number of extra gaps= 0 total=1327 Number of alignments=123 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gfsA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gfsA expands to /projects/compbio/data/pdb/2gfs.pdb.gz 2gfsA:Skipped atom 1228, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1230, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1232, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1234, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1236, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1238, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1240, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1242, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1290, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1294, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1296, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1880, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1882, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1884, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1886, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1888, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1890, because occupancy 0.500 <= existing 0.500 in 2gfsA Skipped atom 1892, because occupancy 0.500 <= existing 0.500 in 2gfsA # T0292 read from 2gfsA/merged-good-all-a2m # 2gfsA read from 2gfsA/merged-good-all-a2m # adding 2gfsA to template set # found chain 2gfsA in template set Warning: unaligning (T0292)D38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfsA)R57 Warning: unaligning (T0292)Y39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfsA)R57 Warning: unaligning (T0292)G40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfsA)P58 Warning: unaligning (T0292)F158 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gfsA)H174 Warning: unaligning (T0292)H166 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfsA)H174 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 2gfsA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL T0292 41 :SMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 2gfsA 59 :FQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARS T0292 78 :TTLYIVMEYC 2gfsA 100 :NDVYLVTHLM T0292 89 :GGDLASVI 2gfsA 110 :GADLNNIV T0292 98 :KGTK 2gfsA 118 :KCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2gfsA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGD 2gfsA 146 :IIHRDLKPSNLAVNEDCELKILD T0292 167 :DTSFAKAFVGTPYYMSPEQMNR 2gfsA 175 :TDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 2gfsA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILR T0292 229 :GKFRRIPYR 2gfsA 260 :QSLTQMPKM T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 2gfsA 277 :ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQY Number of specific fragments extracted= 11 number of extra gaps= 1 total=1338 Number of alignments=124 # 2gfsA read from 2gfsA/merged-good-all-a2m # found chain 2gfsA in template set Warning: unaligning (T0292)D38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfsA)R57 Warning: unaligning (T0292)Y39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfsA)R57 Warning: unaligning (T0292)G40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfsA)P58 Warning: unaligning (T0292)F158 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gfsA)H174 Warning: unaligning (T0292)I163 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfsA)H174 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 2gfsA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL T0292 41 :SMTEAEKQMLVSEVNLLRELKHPNIVRYYDRII 2gfsA 59 :FQSIIHAKRTYRELRLLKHMKHENVIGLLDVFT T0292 74 :DRTN 2gfsA 95 :SLEE T0292 78 :TTLYIVMEYC 2gfsA 100 :NDVYLVTHLM T0292 89 :GGDLASVITKGT 2gfsA 110 :GADLNNIVKCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2gfsA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGD 2gfsA 146 :IIHRDLKPSNLAVNEDCELKILD T0292 167 :DTSFAKAFVGTPYYMSPEQMNR 2gfsA 175 :TDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 2gfsA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGT T0292 234 :IP 2gfsA 242 :PG T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 2gfsA 277 :ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYH Number of specific fragments extracted= 11 number of extra gaps= 1 total=1349 Number of alignments=125 # 2gfsA read from 2gfsA/merged-good-all-a2m # found chain 2gfsA in template set Warning: unaligning (T0292)D38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2gfsA)R57 Warning: unaligning (T0292)Y39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfsA)R57 Warning: unaligning (T0292)G40 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2gfsA)P58 Warning: unaligning (T0292)F158 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2gfsA)H174 Warning: unaligning (T0292)I163 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2gfsA)H174 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKEL 2gfsA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL T0292 41 :SMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 2gfsA 59 :FQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTP T0292 75 :RTNTTLYIVMEYCE 2gfsA 97 :EEFNDVYLVTHLMG T0292 90 :GDLASVITK 2gfsA 111 :ADLNNIVKC T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 2gfsA 120 :QKLTDDHVQFLIYQILRGLKYIHSA T0292 134 :TVLHRDLKPANVFLDGKQNVKLGD 2gfsA 145 :DIIHRDLKPSNLAVNEDCELKILD T0292 164 :LN 2gfsA 175 :TD T0292 169 :SFAKAFVGTPYYMSPEQMNR 2gfsA 177 :DEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 2gfsA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 2gfsA 273 :VFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDD Number of specific fragments extracted= 10 number of extra gaps= 1 total=1359 Number of alignments=126 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r3cA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r3cA expands to /projects/compbio/data/pdb/1r3c.pdb.gz 1r3cA:Skipped atom 2616, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2618, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2620, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2622, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2624, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2626, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2628, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2630, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2632, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2634, because occupancy 0.500 <= existing 0.500 in 1r3cA Skipped atom 2636, because occupancy 0.500 <= existing 0.500 in 1r3cA # T0292 read from 1r3cA/merged-good-all-a2m # 1r3cA read from 1r3cA/merged-good-all-a2m # adding 1r3cA to template set # found chain 1r3cA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1r3cA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARS T0292 78 :TTLYIVMEYCE 1r3cA 100 :NDVYLVTHLMG T0292 90 :GDLASVI 1r3cA 111 :ADLNNIV T0292 98 :KGTK 1r3cA 118 :KCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1r3cA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLA 1r3cA 146 :IIHRDLKPSNLAVNEDSELKILDFGLA T0292 165 :NHDTSFAKAFVGTPYYMSPEQMNR 1r3cA 173 :RHTDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1r3cA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILR T0292 229 :GKFRRIPYR 1r3cA 260 :QSLTQMPKM T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1r3cA 277 :ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQY Number of specific fragments extracted= 10 number of extra gaps= 0 total=1369 Number of alignments=127 # 1r3cA read from 1r3cA/merged-good-all-a2m # found chain 1r3cA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRII 1r3cA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFT T0292 74 :DRTN 1r3cA 95 :SLEE T0292 78 :TTLYIVMEYCEG 1r3cA 100 :NDVYLVTHLMGA T0292 91 :DLASVITKGT 1r3cA 112 :DLNNIVKCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1r3cA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLA 1r3cA 146 :IIHRDLKPSNLAVNEDSELKILDFGLA T0292 165 :NHDTSFAKAFVGTPYYMSPEQMNR 1r3cA 173 :RHTDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTA 1r3cA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPG T0292 217 :FSQKELAGKIREGKFRRIPYR 1r3cA 250 :ISSESARNYIQSLTQMPKMNF T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1r3cA 277 :ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYH Number of specific fragments extracted= 10 number of extra gaps= 0 total=1379 Number of alignments=128 # 1r3cA read from 1r3cA/merged-good-all-a2m # found chain 1r3cA in template set T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 1r3cA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTP T0292 75 :RTNTTLYIVMEYCEG 1r3cA 97 :EEFNDVYLVTHLMGA T0292 91 :DLASVITK 1r3cA 112 :DLNNIVKC T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1r3cA 120 :QKLTDDHVQFLIYQILRGLKYIHSA T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGL 1r3cA 145 :DIIHRDLKPSNLAVNEDSELKILDFGL T0292 164 :LNHDTSFAKAFVGTPYYMSPEQMNR 1r3cA 172 :ARHTDDEMTGYVATRWYRAPEIMLN T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1r3cA 198 :MHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1r3cA 273 :VFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDD Number of specific fragments extracted= 8 number of extra gaps= 0 total=1387 Number of alignments=129 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1omwA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1omwA expands to /projects/compbio/data/pdb/1omw.pdb.gz 1omwA:# T0292 read from 1omwA/merged-good-all-a2m # 1omwA read from 1omwA/merged-good-all-a2m # adding 1omwA to template set # found chain 1omwA in template set Warning: unaligning (T0292)Y6 because of BadResidue code BAD_PEPTIDE in next template residue (1omwA)S192 Warning: unaligning (T0292)E7 because of BadResidue code BAD_PEPTIDE at template residue (1omwA)S192 Warning: unaligning (T0292)G18 because of BadResidue code BAD_PEPTIDE in next template residue (1omwA)E204 Warning: unaligning (T0292)R19 because of BadResidue code BAD_PEPTIDE at template residue (1omwA)E204 Warning: unaligning (T0292)S27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1omwA)T213 Warning: unaligning (T0292)D28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1omwA)T213 T0292 2 :RAED 1omwA 187 :TMND T0292 8 :VLYTIGTGSY 1omwA 193 :VHRIIGRGGF T0292 20 :CQKIRRK 1omwA 205 :VYGCRKA T0292 29 :GKILVWKELDYGSMTEAE 1omwA 214 :GKMYAMKCLDKKRIKMKQ T0292 47 :KQMLVSEVNLLREL 1omwA 233 :ETLALNERIMLSLV T0292 61 :KHPNIVRYYDRI 1omwA 250 :DCPFIVCMSYAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1omwA 262 :HTPDKLSFILDLMNGGDLHYHLSQHGV T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1omwA 289 :FSEADMRFYAAEIILGLEHMHNRF T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1omwA 313 :VVYRDLKPANILLDEHGHVRISDLGLACDFSK T0292 169 :SFAKAFVGTPYYMSPEQMNR 1omwA 345 :KKPHASVGTHGYMAPEVLQK T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPF 1omwA 366 :VAYDSSADWFSLGCMLFKLLRGHSPF T0292 215 :TAFSQKELAGKIREGKF 1omwA 395 :KTKDKHEIDRMTLTMAV T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRP 1omwA 412 :ELPDSFSPELRSLLEGLLQRDVNRRL T0292 260 :VEEILENPLILEH 1omwA 444 :AQEVKESPFFRSL Number of specific fragments extracted= 14 number of extra gaps= 3 total=1401 Number of alignments=130 # 1omwA read from 1omwA/merged-good-all-a2m # found chain 1omwA in template set Warning: unaligning (T0292)Y6 because of BadResidue code BAD_PEPTIDE in next template residue (1omwA)S192 Warning: unaligning (T0292)E7 because of BadResidue code BAD_PEPTIDE at template residue (1omwA)S192 Warning: unaligning (T0292)G18 because of BadResidue code BAD_PEPTIDE in next template residue (1omwA)E204 Warning: unaligning (T0292)R19 because of BadResidue code BAD_PEPTIDE at template residue (1omwA)E204 Warning: unaligning (T0292)S27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1omwA)T213 Warning: unaligning (T0292)D28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1omwA)T213 T0292 3 :AED 1omwA 188 :MND T0292 8 :VLYTIGTGSY 1omwA 193 :VHRIIGRGGF T0292 20 :CQKIRRK 1omwA 205 :VYGCRKA T0292 29 :GKILVWKELDYGSM 1omwA 214 :GKMYAMKCLDKKRI T0292 43 :TEAEKQMLVSEVNLLREL 1omwA 229 :MKQGETLALNERIMLSLV T0292 61 :KHPNIVRYYDRI 1omwA 250 :DCPFIVCMSYAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1omwA 262 :HTPDKLSFILDLMNGGDLHYHLSQHGV T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1omwA 289 :FSEADMRFYAAEIILGLEHMHNRF T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNH 1omwA 313 :VVYRDLKPANILLDEHGHVRISDLGLACDFSK T0292 169 :SFAKAFVGTPYYMSPEQM 1omwA 345 :KKPHASVGTHGYMAPEVL T0292 187 :NRMSYNEKSDIWSLGCLLYELCALMPPFTA 1omwA 364 :KGVAYDSSADWFSLGCMLFKLLRGHSPFRQ T0292 217 :FSQKELAGKIREGKFR 1omwA 397 :KDKHEIDRMTLTMAVE T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1omwA 413 :LPDSFSPELRSLLEGLLQRDVNRRL T0292 259 :SVEEILENPLILEHH 1omwA 443 :GAQEVKESPFFRSLD Number of specific fragments extracted= 14 number of extra gaps= 3 total=1415 Number of alignments=131 # 1omwA read from 1omwA/merged-good-all-a2m # found chain 1omwA in template set Warning: unaligning (T0292)Y6 because of BadResidue code BAD_PEPTIDE in next template residue (1omwA)S192 Warning: unaligning (T0292)E7 because of BadResidue code BAD_PEPTIDE at template residue (1omwA)S192 Warning: unaligning (T0292)G18 because of BadResidue code BAD_PEPTIDE in next template residue (1omwA)E204 Warning: unaligning (T0292)R19 because of BadResidue code BAD_PEPTIDE at template residue (1omwA)E204 Warning: unaligning (T0292)S27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1omwA)T213 Warning: unaligning (T0292)D28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1omwA)T213 T0292 2 :RAED 1omwA 187 :TMND T0292 8 :VLYTIGTGSY 1omwA 193 :VHRIIGRGGF T0292 20 :CQKIRRK 1omwA 205 :VYGCRKA T0292 29 :GKILVWKELDYGSM 1omwA 214 :GKMYAMKCLDKKRI T0292 43 :TEAEKQMLVSEVNLLREL 1omwA 229 :MKQGETLALNERIMLSLV T0292 61 :KHPNIVRYYDRIIDRTN 1omwA 250 :DCPFIVCMSYAFHTPDK T0292 80 :LYIVMEYCEGGDLASVITK 1omwA 267 :LSFILDLMNGGDLHYHLSQ T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1omwA 286 :HGVFSEADMRFYAAEIILGLEHMHNR T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1omwA 312 :FVVYRDLKPANILLDEHGHVRISDLGLACDFSKK T0292 170 :FAKAFVGTPYYMSPEQMNR 1omwA 346 :KPHASVGTHGYMAPEVLQK T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFT 1omwA 366 :VAYDSSADWFSLGCMLFKLLRGHSPFR T0292 216 :AFSQKELAGKIREGKFR 1omwA 396 :TKDKHEIDRMTLTMAVE T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1omwA 413 :LPDSFSPELRSLLEGLLQRDVNRRL T0292 259 :SVEEILENPLILEH 1omwA 443 :GAQEVKESPFFRSL Number of specific fragments extracted= 14 number of extra gaps= 3 total=1429 Number of alignments=132 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o6yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1o6yA expands to /projects/compbio/data/pdb/1o6y.pdb.gz 1o6yA:# T0292 read from 1o6yA/merged-good-all-a2m # 1o6yA read from 1o6yA/merged-good-all-a2m # adding 1o6yA to template set # found chain 1o6yA in template set Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o6yA)A180 Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o6yA)A180 Warning: unaligning (T0292)G224 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1o6yA)Q227 Warning: unaligning (T0292)K225 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1o6yA)Q227 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAE 1o6yA 9 :DRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPS T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRII 1o6yA 53 :YLRFRREAQNAAALNHPAIVAVYDTGE T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1o6yA 83 :PAGPLPYIVMEYVDGVTLRDIVHTEGP T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1o6yA 110 :MTPKRAIEVIADACQALNFSHQNG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1o6yA 134 :IIHRDVKPANIMISATNAVKVMDFGIARA T0292 179 :YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELA 1o6yA 181 :QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVA T0292 226 :IREGKFRRIP 1o6yA 228 :HVREDPIPPS T0292 236 :YRYSDELNEIITRMLNLKDYHRPS 1o6yA 241 :EGLSADLDAVVLKALAKNPENRYQ T0292 260 :VEEILEN 1o6yA 266 :AAEMRAD Number of specific fragments extracted= 9 number of extra gaps= 2 total=1438 Number of alignments=133 # 1o6yA read from 1o6yA/merged-good-all-a2m # found chain 1o6yA in template set Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o6yA)A180 Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o6yA)A180 Warning: unaligning (T0292)G224 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1o6yA)Q227 Warning: unaligning (T0292)K225 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1o6yA)Q227 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1o6yA 9 :DRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLA T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRII 1o6yA 49 :DPSFYLRFRREAQNAAALNHPAIVAVYDTGE T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1o6yA 83 :PAGPLPYIVMEYVDGVTLRDIVHTEGP T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1o6yA 110 :MTPKRAIEVIADACQALNFSHQNG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1o6yA 134 :IIHRDVKPANIMISATNAVKVMDFGIARA T0292 179 :YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELA 1o6yA 181 :QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVA T0292 226 :IREGKFRRIPYR 1o6yA 228 :HVREDPIPPSAR T0292 238 :YSDELNEIITRMLNLKDYHRP 1o6yA 243 :LSADLDAVVLKALAKNPENRY T0292 259 :SVEEILENPL 1o6yA 265 :TAAEMRADLV Number of specific fragments extracted= 9 number of extra gaps= 2 total=1447 Number of alignments=134 # 1o6yA read from 1o6yA/merged-good-all-a2m # found chain 1o6yA in template set Warning: unaligning (T0292)L164 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o6yA)A180 Warning: unaligning (T0292)N165 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o6yA)A180 Warning: unaligning (T0292)G224 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1o6yA)Q227 Warning: unaligning (T0292)K225 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1o6yA)Q227 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1o6yA 9 :DRYELGEILGFGGMSEVHLARDLRLHRDVAVKVLRADLA T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 1o6yA 49 :DPSFYLRFRREAQNAAALNHPAIVAVYDTGEA T0292 75 :RTNTTLYIVMEYCEGGDLASVITK 1o6yA 83 :PAGPLPYIVMEYVDGVTLRDIVHT T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1o6yA 107 :EGPMTPKRAIEVIADACQALNFSHQN T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARI 1o6yA 133 :GIIHRDVKPANIMISATNAVKVMDFGIARA T0292 179 :YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELA 1o6yA 181 :QYLSPEQARGDSVDARSDVYSLGCVLYEVLTGEPPFTGDSPVSVA T0292 226 :IREGKFRR 1o6yA 228 :HVREDPIP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPS 1o6yA 239 :RHEGLSADLDAVVLKALAKNPENRYQ T0292 260 :VEEILEN 1o6yA 266 :AAEMRAD Number of specific fragments extracted= 9 number of extra gaps= 2 total=1456 Number of alignments=135 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cdkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cdkA expands to /projects/compbio/data/pdb/1cdk.pdb.gz 1cdkA:# T0292 read from 1cdkA/merged-good-all-a2m # 1cdkA read from 1cdkA/merged-good-all-a2m # adding 1cdkA to template set # found chain 1cdkA in template set Warning: unaligning (T0292)A93 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)S130 Warning: unaligning (T0292)S94 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)S130 Warning: unaligning (T0292)V95 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)H131 Warning: unaligning (T0292)R138 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)D166 Warning: unaligning (T0292)D139 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)D166 Warning: unaligning (T0292)L164 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)K192 Warning: unaligning (T0292)N165 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)K192 Warning: unaligning (T0292)P178 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)E203 Warning: unaligning (T0292)Y179 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)E203 Warning: unaligning (T0292)Q219 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)I244 Warning: unaligning (T0292)K220 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)I244 Warning: unaligning (T0292)L250 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)Q274 Warning: unaligning (T0292)N251 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)Q274 Warning: unaligning (T0292)D254 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)T278 Warning: unaligning (T0292)Y255 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)T278 Warning: unaligning (T0292)V260 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)V288 Warning: unaligning (T0292)N266 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)K295 Warning: unaligning (T0292)P267 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)K295 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1cdkA 39 :HLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVK T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 1cdkA 83 :KQIEHTLNEKRILQAVNFPFLVKLEYSF T0292 75 :RTNTTLYIVMEYCEGGDL 1cdkA 111 :KDNSNLYMVMEYVPGGEM T0292 96 :ITKGTK 1cdkA 132 :LRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1cdkA 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLH 1cdkA 162 :LIY T0292 140 :LKPANVFLDGKQNVKLGDFGLARI 1cdkA 167 :LKPENLLIDQQGYIQVTDFGFAKR T0292 169 :SFAKAFVGT 1cdkA 193 :GRTWTLCGT T0292 180 :YMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFS 1cdkA 204 :YLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQ T0292 221 :ELAGKIREGKF 1cdkA 245 :QIYEKIVSGKV T0292 233 :RIPYRYSDELNEIITRM 1cdkA 256 :RFPSHFSSDLKDLLRNL T0292 252 :LK 1cdkA 275 :VD T0292 256 :HRP 1cdkA 279 :KRF T0292 261 :EEILE 1cdkA 289 :NDIKN T0292 268 :LILEH 1cdkA 296 :WFATT Number of specific fragments extracted= 15 number of extra gaps= 9 total=1471 Number of alignments=136 # 1cdkA read from 1cdkA/merged-good-all-a2m # found chain 1cdkA in template set Warning: unaligning (T0292)A93 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)S130 Warning: unaligning (T0292)S94 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)S130 Warning: unaligning (T0292)V95 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)H131 Warning: unaligning (T0292)R138 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)D166 Warning: unaligning (T0292)D139 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)D166 Warning: unaligning (T0292)L164 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)K192 Warning: unaligning (T0292)N165 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)K192 Warning: unaligning (T0292)P178 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)E203 Warning: unaligning (T0292)Y179 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)E203 Warning: unaligning (T0292)Q219 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)I244 Warning: unaligning (T0292)K220 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)I244 Warning: unaligning (T0292)L250 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)Q274 Warning: unaligning (T0292)N251 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)Q274 Warning: unaligning (T0292)D254 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)T278 Warning: unaligning (T0292)Y255 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)T278 Warning: unaligning (T0292)S259 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)V288 Warning: unaligning (T0292)V260 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)V288 Warning: unaligning (T0292)N266 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)K295 Warning: unaligning (T0292)P267 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)K295 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1cdkA 39 :HLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1cdkA 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEYSF T0292 75 :RTNTTLYIVMEYCEGGDL 1cdkA 111 :KDNSNLYMVMEYVPGGEM T0292 96 :ITKGTK 1cdkA 132 :LRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1cdkA 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLH 1cdkA 162 :LIY T0292 140 :LKPANVFLDGKQNVKLGDFGLARI 1cdkA 167 :LKPENLLIDQQGYIQVTDFGFAKR T0292 169 :SFAKAFVGT 1cdkA 193 :GRTWTLCGT T0292 180 :YMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFS 1cdkA 204 :YLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQ T0292 221 :ELAGKIREGKFR 1cdkA 245 :QIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRM 1cdkA 257 :FPSHFSSDLKDLLRNL T0292 252 :LK 1cdkA 275 :VD T0292 256 :HRP 1cdkA 279 :KRF T0292 261 :EEILE 1cdkA 289 :NDIKN T0292 268 :LILEHH 1cdkA 296 :WFATTD Number of specific fragments extracted= 15 number of extra gaps= 9 total=1486 Number of alignments=137 # 1cdkA read from 1cdkA/merged-good-all-a2m # found chain 1cdkA in template set Warning: unaligning (T0292)A93 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)S130 Warning: unaligning (T0292)S94 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)S130 Warning: unaligning (T0292)V95 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)H131 Warning: unaligning (T0292)R138 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)D166 Warning: unaligning (T0292)D139 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)D166 Warning: unaligning (T0292)L164 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)K192 Warning: unaligning (T0292)N165 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)K192 Warning: unaligning (T0292)P178 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)E203 Warning: unaligning (T0292)Y179 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)E203 Warning: unaligning (T0292)Q219 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)I244 Warning: unaligning (T0292)K220 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)I244 Warning: unaligning (T0292)L250 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)Q274 Warning: unaligning (T0292)N251 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)Q274 Warning: unaligning (T0292)D254 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)T278 Warning: unaligning (T0292)Y255 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)T278 Warning: unaligning (T0292)N266 because of BadResidue code BAD_PEPTIDE in next template residue (1cdkA)K295 Warning: unaligning (T0292)P267 because of BadResidue code BAD_PEPTIDE at template residue (1cdkA)K295 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1cdkA 38 :AHLDQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1cdkA 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSN T0292 80 :LYIVMEYCEGGDL 1cdkA 116 :LYMVMEYVPGGEM T0292 96 :ITK 1cdkA 132 :LRR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1cdkA 135 :IGRFSEPHARFYAAQIVLTFEYLHSL T0292 134 :TVLH 1cdkA 161 :DLIY T0292 140 :LKPANVFLDGKQNVKLGDFGLARI 1cdkA 167 :LKPENLLIDQQGYIQVTDFGFAKR T0292 166 :HD 1cdkA 193 :GR T0292 171 :AKAFVGT 1cdkA 195 :TWTLCGT T0292 180 :YMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFS 1cdkA 204 :YLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQ T0292 221 :ELAGKIREGKFR 1cdkA 245 :QIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRM 1cdkA 257 :FPSHFSSDLKDLLRNL T0292 252 :LK 1cdkA 275 :VD T0292 256 :HRP 1cdkA 279 :KRF T0292 261 :EEILE 1cdkA 289 :NDIKN T0292 268 :LILEHH 1cdkA 296 :WFATTD Number of specific fragments extracted= 16 number of extra gaps= 8 total=1502 Number of alignments=138 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q8uA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1q8uA expands to /projects/compbio/data/pdb/1q8u.pdb.gz 1q8uA:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Skipped atom 153, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 155, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 157, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1471, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1473, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1475, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1579, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1581, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1583, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1585, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1587, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1589, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1591, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1593, because occupancy 0.500 <= existing 0.500 in 1q8uA Skipped atom 1595, because occupancy 0.500 <= existing 0.500 in 1q8uA Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 1q8uA/merged-good-all-a2m # 1q8uA read from 1q8uA/merged-good-all-a2m # adding 1q8uA to template set # found chain 1q8uA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1q8uA)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1q8uA)L198 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1q8uA 39 :HLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVK T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 1q8uA 83 :KQIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1q8uA 111 :KDNSNLYMVMEYVPGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1q8uA 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1q8uA 162 :LIYRDLKPENLLIDQQGYIQVTDFGFAKRVK T0292 169 :SFA 1q8uA 193 :GRT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1q8uA 199 :CGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRP 1q8uA 256 :RFPSHFSSDLKDLLRNLLQVDLTKRF T0292 260 :VEEILENPLILEH 1q8uA 288 :VNDIKNHKWFATT Number of specific fragments extracted= 9 number of extra gaps= 0 total=1511 Number of alignments=139 # 1q8uA read from 1q8uA/merged-good-all-a2m # found chain 1q8uA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1q8uA)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1q8uA)L198 T0292 2 :RAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1q8uA 39 :HLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1q8uA 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEFSF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1q8uA 111 :KDNSNLYMVMEYVPGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1q8uA 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1q8uA 162 :LIYRDLKPENLLIDQQGYIQVTDFGFAKRVK T0292 169 :SFA 1q8uA 193 :GRT T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1q8uA 199 :CGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1q8uA 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 259 :SVEEILENPLILEHH 1q8uA 287 :GVNDIKNHKWFATTD Number of specific fragments extracted= 9 number of extra gaps= 0 total=1520 Number of alignments=140 # 1q8uA read from 1q8uA/merged-good-all-a2m # found chain 1q8uA in template set Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1q8uA)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1q8uA)L198 T0292 1 :SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1q8uA 38 :AHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1q8uA 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSN T0292 80 :LYIVMEYCEGGDLASVITK 1q8uA 116 :LYMVMEYVPGGEMFSHLRR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1q8uA 135 :IGRFSEPHARFYAAQIVLTFEYLHSL T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1q8uA 161 :DLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGR T0292 171 :A 1q8uA 195 :T T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1q8uA 199 :CGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1q8uA 257 :FPSHFSSDLKDLLRNLLQVDLTKRF T0292 261 :EEILENPLILEH 1q8uA 289 :NDIKNHKWFATT Number of specific fragments extracted= 9 number of extra gaps= 0 total=1529 Number of alignments=141 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zzlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zzlA expands to /projects/compbio/data/pdb/1zzl.pdb.gz 1zzlA:# T0292 read from 1zzlA/merged-good-all-a2m # 1zzlA read from 1zzlA/merged-good-all-a2m # adding 1zzlA to template set # found chain 1zzlA in template set Warning: unaligning (T0292)K30 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)R49 Warning: unaligning (T0292)I31 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)R49 Warning: unaligning (T0292)S94 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)I116 Warning: unaligning (T0292)V95 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)I116 Warning: unaligning (T0292)L164 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zzlA)D176 Warning: unaligning (T0292)N165 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zzlA)D176 Warning: unaligning (T0292)H166 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)E178 Warning: unaligning (T0292)D167 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)E178 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)Q202 Warning: unaligning (T0292)E193 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)Q202 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDG 1zzlA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTG T0292 32 :LVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1zzlA 50 :VAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARS T0292 78 :TTLYIVMEYCEG 1zzlA 100 :NDVYLVTHLMGA T0292 91 :DLA 1zzlA 112 :DLN T0292 96 :I 1zzlA 117 :V T0292 98 :KGTK 1zzlA 118 :KCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1zzlA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1zzlA 146 :IIHRDLKPSNLAVNEDCELKILDFGLARH T0292 168 :TSFA 1zzlA 179 :MTGY T0292 175 :VGTPYYMSPEQMNR 1zzlA 183 :VATRWYRAPEIMLN T0292 189 :MSY 1zzlA 198 :MHY T0292 194 :KSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1zzlA 203 :TVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILR T0292 230 :KFRRIPYR 1zzlA 261 :SLTQMPKM T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1zzlA 278 :NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQY Number of specific fragments extracted= 14 number of extra gaps= 4 total=1543 Number of alignments=142 # 1zzlA read from 1zzlA/merged-good-all-a2m # found chain 1zzlA in template set Warning: unaligning (T0292)K30 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)R49 Warning: unaligning (T0292)I31 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)R49 Warning: unaligning (T0292)S94 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)I116 Warning: unaligning (T0292)V95 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)I116 Warning: unaligning (T0292)D167 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zzlA)D176 Warning: unaligning (T0292)T168 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zzlA)D176 Warning: unaligning (T0292)S169 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)E178 Warning: unaligning (T0292)F170 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)E178 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)Q202 Warning: unaligning (T0292)E193 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)Q202 Warning: unaligning (T0292)G229 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)V239 Warning: unaligning (T0292)K230 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)V239 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDG 1zzlA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTG T0292 32 :LVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRII 1zzlA 50 :VAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFT T0292 74 :DRTN 1zzlA 95 :SLEE T0292 78 :TTLYIVMEYCEG 1zzlA 100 :NDVYLVTHLMGA T0292 91 :DLA 1zzlA 112 :DLN T0292 96 :ITKGT 1zzlA 117 :VKCQK T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1zzlA 122 :LTDDHVQFLIYQILRGLKYIHSAD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARI 1zzlA 146 :IIHRDLKPSNLAVNEDCELKILDFGLARH T0292 171 :AKAFVGTPYYMSPEQMNR 1zzlA 179 :MTGYVATRWYRAPEIMLN T0292 189 :MSY 1zzlA 198 :MHY T0292 194 :KSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1zzlA 203 :TVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILR T0292 231 :FRRI 1zzlA 240 :GTPG T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1zzlA 277 :ANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYH Number of specific fragments extracted= 13 number of extra gaps= 5 total=1556 Number of alignments=143 # 1zzlA read from 1zzlA/merged-good-all-a2m # found chain 1zzlA in template set Warning: unaligning (T0292)K30 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)R49 Warning: unaligning (T0292)I31 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)R49 Warning: unaligning (T0292)S94 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)I116 Warning: unaligning (T0292)V95 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)I116 Warning: unaligning (T0292)L164 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1zzlA)D176 Warning: unaligning (T0292)N165 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1zzlA)D176 Warning: unaligning (T0292)H166 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)E178 Warning: unaligning (T0292)D167 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)E178 Warning: unaligning (T0292)N192 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)Q202 Warning: unaligning (T0292)E193 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)Q202 Warning: unaligning (T0292)G229 because of BadResidue code BAD_PEPTIDE in next template residue (1zzlA)V239 Warning: unaligning (T0292)K230 because of BadResidue code BAD_PEPTIDE at template residue (1zzlA)V239 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDG 1zzlA 22 :ERYQNLSPVGSGAYGSVCAAFDTKTG T0292 32 :LVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 1zzlA 50 :VAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTP T0292 75 :RTNTTLYIVMEYCEG 1zzlA 97 :EEFNDVYLVTHLMGA T0292 91 :DLA 1zzlA 112 :DLN T0292 96 :ITK 1zzlA 117 :VKC T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 1zzlA 120 :QKLTDDHVQFLIYQILRGLKYIHSA T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARI 1zzlA 145 :DIIHRDLKPSNLAVNEDCELKILDFGLARH T0292 171 :AKAFVGTPYYMSPEQMNR 1zzlA 179 :MTGYVATRWYRAPEIMLN T0292 189 :MSY 1zzlA 198 :MHY T0292 194 :KSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1zzlA 203 :TVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILR T0292 231 :FRR 1zzlA 240 :GTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1zzlA 273 :VFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDD Number of specific fragments extracted= 12 number of extra gaps= 5 total=1568 Number of alignments=144 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j1bA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1j1bA/merged-good-all-a2m # 1j1bA read from 1j1bA/merged-good-all-a2m # found chain 1j1bA in training set T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1j1bA 56 :YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFK T0292 52 :SEVNLLRELKHPNIVRYYDRII 1j1bA 96 :RELQIMRKLDHCNIVRLRYFFY T0292 74 :DRTNTTLYIVMEYCE 1j1bA 122 :KKDEVYLNLVLDYVP T0292 90 :GDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRS 1j1bA 137 :ETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFG T0292 135 :VLHRDLKPANVFLDGK 1j1bA 177 :ICHRDIKPQNLLLDPD T0292 151 :QNVKLGDFGLARILNHD 1j1bA 194 :AVLKLCDFGSAKQLVRG T0292 169 :SFAKAFVGTPYYMSPEQMNR 1j1bA 211 :EPNVSYICSRYYRAPELIFG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1j1bA 232 :TDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK T0292 229 :GKFRRI 1j1bA 291 :FKFPQI T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1j1bA 307 :PRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDEL Number of specific fragments extracted= 10 number of extra gaps= 0 total=1578 Number of alignments=145 # 1j1bA read from 1j1bA/merged-good-all-a2m # found chain 1j1bA in training set T0292 1 :SRAED 1j1bA 49 :DRPQE T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1j1bA 56 :YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR T0292 52 :SEVNLLRELKHPNIVRYYDRIID 1j1bA 96 :RELQIMRKLDHCNIVRLRYFFYS T0292 75 :RTNTT 1j1bA 121 :EKKDE T0292 80 :LYIVMEYCEG 1j1bA 128 :LNLVLDYVPE T0292 91 :DLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRS 1j1bA 138 :TVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFG T0292 135 :VLHRDLKPANVFLDGKQ 1j1bA 177 :ICHRDIKPQNLLLDPDT T0292 152 :NVKLGDFGLARILNHD 1j1bA 195 :VLKLCDFGSAKQLVRG T0292 169 :SFAKAFVGTPYYMSPEQMNR 1j1bA 211 :EPNVSYICSRYYRAPELIFG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIRE 1j1bA 232 :TDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIK T0292 238 :YSDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1j1bA 309 :TPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELR Number of specific fragments extracted= 11 number of extra gaps= 0 total=1589 Number of alignments=146 # 1j1bA read from 1j1bA/merged-good-all-a2m # found chain 1j1bA in training set T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1j1bA 56 :YTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKR T0292 52 :SEVNLLRELKHPNIVRYYDRIID 1j1bA 96 :RELQIMRKLDHCNIVRLRYFFYS T0292 75 :RTNTTLYIVMEYCE 1j1bA 123 :KDEVYLNLVLDYVP T0292 90 :GDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRR 1j1bA 137 :ETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSF T0292 134 :TVLHRDLKPANVFLDGK 1j1bA 176 :GICHRDIKPQNLLLDPD T0292 151 :QNVKLGDFGLARILNHD 1j1bA 194 :AVLKLCDFGSAKQLVRG T0292 169 :SFAKAFVGTPYYMSPEQMNR 1j1bA 211 :EPNVSYICSRYYRAPELIFG T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1j1bA 232 :TDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTP T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH 1j1bA 305 :FRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNV Number of specific fragments extracted= 9 number of extra gaps= 0 total=1598 Number of alignments=147 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1phk/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1phk expands to /projects/compbio/data/pdb/1phk.pdb.gz 1phk:Warning: there is no chain 1phk will retry with 1phkA # T0292 read from 1phk/merged-good-all-a2m # 1phk read from 1phk/merged-good-all-a2m # adding 1phk to template set # found chain 1phk in template set T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1phk 16 :YENYEPKEILGRGVSSVVRRCIHKPTCKEYAVKIIDV T0292 40 :GSMTEAE 1phk 56 :GSFSAEE T0292 47 :KQMLVSEVNLLREL 1phk 67 :REATLKEVDILRKV T0292 61 :KHPNIVRYYDRI 1phk 82 :GHPNIIQLKDTY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1phk 94 :ETNTFFFLVFDLMKKGELFDYLTEKVT T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1phk 121 :LSEKETRKIMRALLEVICALHKLN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1phk 145 :IVHRDLKPENILLDDDMNIKLTDFGFSCQLDPG T0292 169 :SFAKAFVGTPYYMSPEQMN 1phk 178 :EKLREVCGTPSYLAPEIIE T0292 188 :RMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY 1phk 203 :HPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQFGSPEW T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1phk 257 :SDTVKDLVSRFLVVQPQKRYTAEEALAHPFFQQY Number of specific fragments extracted= 10 number of extra gaps= 0 total=1608 Number of alignments=148 # 1phk read from 1phk/merged-good-all-a2m # found chain 1phk in template set Warning: unaligning (T0292)H273 because last residue in template chain is (1phk)V291 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1phk 17 :ENYEPKEILGRGVSSVVRRCIHKPTCKEYAVKIIDV T0292 40 :GSMTEAEKQM 1phk 56 :GSFSAEEVQE T0292 50 :LVSEVNLLREL 1phk 70 :TLKEVDILRKV T0292 61 :KHPNIVRYYDRI 1phk 82 :GHPNIIQLKDTY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1phk 94 :ETNTFFFLVFDLMKKGELFDYLTEKVT T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1phk 121 :LSEKETRKIMRALLEVICALHKLN T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1phk 145 :IVHRDLKPENILLDDDMNIKLTDFGFSCQLDPG T0292 169 :SFAKAFVGTPYYMSPEQM 1phk 178 :EKLREVCGTPSYLAPEII T0292 187 :NRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1phk 202 :NHPGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQ T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1phk 251 :PEWDDYSDTVKDLVSRFLVVQPQKRYTAEEALAHPFFQQY Number of specific fragments extracted= 10 number of extra gaps= 0 total=1618 Number of alignments=149 # 1phk read from 1phk/merged-good-all-a2m # found chain 1phk in template set Warning: unaligning (T0292)H273 because last residue in template chain is (1phk)V291 T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1phk 16 :YENYEPKEILGRGVSSVVRRCIHKPTCKEYAVKIIDV T0292 40 :GSMTEA 1phk 56 :GSFSAE T0292 46 :EKQMLVSEVNLLREL 1phk 66 :LREATLKEVDILRKV T0292 61 :KHPNIVRYYDRIIDRTN 1phk 82 :GHPNIIQLKDTYETNTF T0292 80 :LYIVMEYCEGGDLASVITK 1phk 99 :FFLVFDLMKKGELFDYLTE T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1phk 118 :KVTLSEKETRKIMRALLEVICALHKL T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHD 1phk 144 :NIVHRDLKPENILLDDDMNIKLTDFGFSCQLDPG T0292 169 :SFAKAFVGTPYYMSPEQMN 1phk 178 :EKLREVCGTPSYLAPEIIE T0292 189 :MSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1phk 204 :PGYGKEVDMWSTGVIMYTLLAGSPPFWHRKQMLMLRMIMSGNYQF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEH 1phk 252 :EWDDYSDTVKDLVSRFLVVQPQKRYTAEEALAHPFFQQY Number of specific fragments extracted= 10 number of extra gaps= 0 total=1628 Number of alignments=150 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c30A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2c30A expands to /projects/compbio/data/pdb/2c30.pdb.gz 2c30A:Skipped atom 31, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 33, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 35, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 37, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 163, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 167, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 169, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 171, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 173, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 611, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 613, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 615, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 617, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 699, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 701, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 904, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 906, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 908, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1238, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1240, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1242, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1244, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1246, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1248, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1278, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1280, because occupancy 0.350 <= existing 0.650 in 2c30A Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Skipped atom 1523, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1525, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1533, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1535, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1537, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1539, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1541, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1762, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1764, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1820, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 1822, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 1824, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 1826, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 1828, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 1955, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1957, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 1959, because occupancy 0.350 <= existing 0.650 in 2c30A Skipped atom 2309, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 2311, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 2313, because occupancy 0.500 <= existing 0.500 in 2c30A Skipped atom 2315, because occupancy 0.500 <= existing 0.500 in 2c30A # T0292 read from 2c30A/merged-good-all-a2m # 2c30A read from 2c30A/merged-good-all-a2m # adding 2c30A to template set # found chain 2c30A in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c30A)L423 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c30A)L423 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c30A)L561 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c30A)L561 Warning: unaligning (T0292)E228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c30A)S616 Warning: unaligning (T0292)G229 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c30A)S616 Warning: unaligning (T0292)R237 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2c30A)V627 Warning: unaligning (T0292)Y238 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2c30A)V627 T0292 6 :YEVLYTIGTGSYGRC 2c30A 407 :LDSYVKIGEGSTGIV T0292 23 :IRRKSDGKILVWKELDYGSMTEAE 2c30A 424 :AREKHSGRQVAVKMMDLRKQQRRE T0292 49 :MLVSEVNLLRELKHPNIVRYYDRI 2c30A 448 :LLFNEVVIMRDYQHFNVVEMYKSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKG 2c30A 472 :LVGEELWVLMEFLQGGALTDIVSQV T0292 101 :K 2c30A 497 :R T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2c30A 498 :LNEEQIATVCEAVLQALAYLHAQG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 2c30A 522 :VIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIR 2c30A 562 :VGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLR T0292 230 :KFRRI 2c30A 617 :PPPKL T0292 235 :PY 2c30A 624 :SH T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 2c30A 628 :SPVLRDFLERMLVRDPQERATAQELLDHPFLLQTGL Number of specific fragments extracted= 11 number of extra gaps= 3 total=1639 Number of alignments=151 # 2c30A read from 2c30A/merged-good-all-a2m # found chain 2c30A in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c30A)L423 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c30A)L423 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c30A)L561 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c30A)L561 Warning: unaligning (T0292)E228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c30A)S616 Warning: unaligning (T0292)G229 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c30A)S616 Warning: unaligning (T0292)Y238 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2c30A)V627 T0292 6 :YEVLYTIGTGSYGRC 2c30A 407 :LDSYVKIGEGSTGIV T0292 23 :IRRKSDGKILVWKELDYGSMTEA 2c30A 424 :AREKHSGRQVAVKMMDLRKQQRR T0292 48 :QMLVSEVNLLRELKHPNIVRYYDRI 2c30A 447 :ELLFNEVVIMRDYQHFNVVEMYKSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 2c30A 472 :LVGEELWVLMEFLQGGALTDIVSQVR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2c30A 498 :LNEEQIATVCEAVLQALAYLHAQG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 2c30A 522 :VIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIR 2c30A 562 :VGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLR T0292 230 :KFRRIPYR 2c30A 617 :PPPKLKNS T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEHH 2c30A 628 :SPVLRDFLERMLVRDPQERATAQELLDHPFLLQTG Number of specific fragments extracted= 9 number of extra gaps= 3 total=1648 Number of alignments=152 # 2c30A read from 2c30A/merged-good-all-a2m # found chain 2c30A in template set Warning: unaligning (T0292)Q21 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c30A)L423 Warning: unaligning (T0292)K22 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c30A)L423 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c30A)L561 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c30A)L561 Warning: unaligning (T0292)E228 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c30A)S616 Warning: unaligning (T0292)G229 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c30A)S616 Warning: unaligning (T0292)R237 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (2c30A)V627 Warning: unaligning (T0292)Y238 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (2c30A)V627 T0292 6 :YEVLYTIGTGSYGRC 2c30A 407 :LDSYVKIGEGSTGIV T0292 23 :IRRKSDGKILVWKELDYGSMTE 2c30A 424 :AREKHSGRQVAVKMMDLRKQQR T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 2c30A 446 :RELLFNEVVIMRDYQHFNVVEMYKSYLVGEE T0292 80 :LYIVMEYCEGGDLASVITK 2c30A 477 :LWVLMEFLQGGALTDIVSQ T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 2c30A 496 :VRLNEEQIATVCEAVLQALAYLHAQ T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 2c30A 521 :GVIHRDIKSDSILLTLDGRVKLSDFGFCAQISKDVPKR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIR 2c30A 562 :VGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQAMKRLR T0292 230 :KFRR 2c30A 617 :PPPK T0292 234 :IPY 2c30A 623 :NSH T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHH 2c30A 628 :SPVLRDFLERMLVRDPQERATAQELLDHPFLLQTGLPE Number of specific fragments extracted= 10 number of extra gaps= 3 total=1658 Number of alignments=153 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jksA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0292 read from 1jksA/merged-good-all-a2m # 1jksA read from 1jksA/merged-good-all-a2m # found chain 1jksA in training set Warning: unaligning (T0292)K150 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1jksA)V152 Warning: unaligning (T0292)Q151 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1jksA)V152 Warning: unaligning (T0292)E271 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jksA)P291 T0292 2 :RAED 1jksA 8 :NVDD T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1jksA 13 :YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKK T0292 41 :SMTEA 1jksA 50 :KSSRR T0292 46 :EKQMLVSEVNLLRELKHPNIVRYYDRI 1jksA 57 :SREDIEREVSILKEIQHPNVITLHEVY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1jksA 84 :ENKTDVILILELVAGGELFDFLAEKES T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1jksA 111 :LTEEEATEFLKQILNGVYYLHSLQ T0292 135 :VLHRDLKPANVFL 1jksA 135 :IAHFDLKPENIML T0292 148 :DG 1jksA 149 :DR T0292 153 :VKLGDFGLARILNHD 1jksA 157 :IKIIDFGLAHKIDFG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIP 1jksA 172 :NEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFED T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1jksA 242 :SNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIK Number of specific fragments extracted= 11 number of extra gaps= 1 total=1669 Number of alignments=154 # 1jksA read from 1jksA/merged-good-all-a2m # found chain 1jksA in training set Warning: unaligning (T0292)K150 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1jksA)V152 Warning: unaligning (T0292)Q151 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1jksA)V152 Warning: unaligning (T0292)E271 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jksA)P291 T0292 1 :SRAED 1jksA 7 :ENVDD T0292 6 :YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1jksA 13 :YDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKK T0292 40 :GSMTEAE 1jksA 54 :RGVSRED T0292 50 :LVSEVNLLRELKHPNIVRYYDRI 1jksA 61 :IEREVSILKEIQHPNVITLHEVY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1jksA 84 :ENKTDVILILELVAGGELFDFLAEKES T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1jksA 111 :LTEEEATEFLKQILNGVYYLHSLQ T0292 135 :VLHRDLKPANVFL 1jksA 135 :IAHFDLKPENIML T0292 148 :DG 1jksA 149 :DR T0292 152 :NVKLGDFGLARILNHD 1jksA 156 :RIKIIDFGLAHKIDFG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIP 1jksA 172 :NEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFED T0292 236 :YRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1jksA 242 :SNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIK Number of specific fragments extracted= 11 number of extra gaps= 1 total=1680 Number of alignments=155 # 1jksA read from 1jksA/merged-good-all-a2m # found chain 1jksA in training set Warning: unaligning (T0292)D148 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1jksA)V152 Warning: unaligning (T0292)E271 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1jksA)P291 T0292 3 :AEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1jksA 10 :DDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKK T0292 43 :TE 1jksA 57 :SR T0292 48 :QMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1jksA 59 :EDIEREVSILKEIQHPNVITLHEVYENKTD T0292 80 :LYIVMEYCEGGDLASVITK 1jksA 89 :VILILELVAGGELFDFLAE T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1jksA 108 :KESLTEEEATEFLKQILNGVYYLHSL T0292 134 :TVLHRDLKPANVFL 1jksA 134 :QIAHFDLKPENIML T0292 149 :GKQNVKLGDFGLARILNHD 1jksA 153 :PKPRIKIIDFGLAHKIDFG T0292 169 :SFAKAFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 1jksA 172 :NEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEF T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIL 1jksA 240 :YFSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIK Number of specific fragments extracted= 9 number of extra gaps= 1 total=1689 Number of alignments=156 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o6lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1o6lA expands to /projects/compbio/data/pdb/1o6l.pdb.gz 1o6lA:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 1o6lA/merged-good-all-a2m # 1o6lA read from 1o6lA/merged-good-all-a2m # adding 1o6lA to template set # found chain 1o6lA in template set Warning: unaligning (T0292)Y6 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1o6lA)D153 Warning: unaligning (T0292)E7 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1o6lA)D153 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o6lA)F310 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o6lA)F310 T0292 2 :RAED 1o6lA 148 :TMND T0292 8 :VLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1o6lA 154 :YLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIA T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDRI 1o6lA 192 :DEVAHTVTESRVLQNTRHPFLTALKYAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1o6lA 220 :QTHDRLCFVMEYANGGELFFHLSRERV T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1o6lA 247 :FTEERARFYGAEIVSALEYLHSRD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1o6lA 271 :VVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1o6lA 311 :CGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEI T0292 233 :RIPYRYSDELNEIITRMLNLKDYHRPS 1o6lA 368 :RFPRTLSPEAKSLLAGLLKKDPKQRLG T0292 260 :VEEILENPLILEH 1o6lA 400 :AKEVMEHRFFLSI Number of specific fragments extracted= 9 number of extra gaps= 1 total=1698 Number of alignments=157 # 1o6lA read from 1o6lA/merged-good-all-a2m # found chain 1o6lA in template set Warning: unaligning (T0292)Y6 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1o6lA)D153 Warning: unaligning (T0292)E7 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1o6lA)D153 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o6lA)F310 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o6lA)F310 T0292 2 :RAED 1o6lA 148 :TMND T0292 8 :VLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1o6lA 154 :YLKLLGKGTFGKVILVREKATGRYYAMKILRKEVI T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRI 1o6lA 190 :AKDEVAHTVTESRVLQNTRHPFLTALKYAF T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGTK 1o6lA 220 :QTHDRLCFVMEYANGGELFFHLSRERV T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1o6lA 247 :FTEERARFYGAEIVSALEYLHSRD T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1o6lA 271 :VVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1o6lA 311 :CGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1o6lA 369 :FPRTLSPEAKSLLAGLLKKDPKQRL T0292 260 :VEEILENPLILEHH 1o6lA 400 :AKEVMEHRFFLSIN T0292 274 :HH 1o6lA 421 :KL Number of specific fragments extracted= 10 number of extra gaps= 1 total=1708 Number of alignments=158 # 1o6lA read from 1o6lA/merged-good-all-a2m # found chain 1o6lA in template set Warning: unaligning (T0292)Y6 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1o6lA)D153 Warning: unaligning (T0292)E7 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1o6lA)D153 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1o6lA)F310 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1o6lA)F310 T0292 1 :SRAED 1o6lA 147 :VTMND T0292 8 :VLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1o6lA 154 :YLKLLGKGTFGKVILVREKATGRYYAMKILRKEVI T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1o6lA 190 :AKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDR T0292 80 :LYIVMEYCEGGDLASVITK 1o6lA 225 :LCFVMEYANGGELFFHLSR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1o6lA 244 :ERVFTEERARFYGAEIVSALEYLHSR T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 1o6lA 270 :DVVYRDIKLENLMLDKDGHIKITDFGLCKEGISDGATM T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1o6lA 311 :CGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRP 1o6lA 369 :FPRTLSPEAKSLLAGLLKKDPKQRL T0292 260 :VEEILENPLILEHH 1o6lA 400 :AKEVMEHRFFLSIN Number of specific fragments extracted= 9 number of extra gaps= 1 total=1717 Number of alignments=159 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f57A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f57A expands to /projects/compbio/data/pdb/2f57.pdb.gz 2f57A:Skipped atom 720, because occupancy 0.500 <= existing 0.500 in 2f57A Skipped atom 724, because occupancy 0.500 <= existing 0.500 in 2f57A Skipped atom 726, because occupancy 0.500 <= existing 0.500 in 2f57A Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Skipped atom 1969, because occupancy 0.500 <= existing 0.500 in 2f57A Skipped atom 1973, because occupancy 0.500 <= existing 0.500 in 2f57A Skipped atom 1975, because occupancy 0.500 <= existing 0.500 in 2f57A # T0292 read from 2f57A/merged-good-all-a2m # 2f57A read from 2f57A/merged-good-all-a2m # adding 2f57A to template set # found chain 2f57A in template set Warning: unaligning (T0292)G15 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (2f57A)S459 Warning: unaligning (T0292)S16 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (2f57A)S459 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f57A)L603 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f57A)L603 T0292 3 :AEDYEVLYTIGT 2f57A 446 :REYLANFIKIGE T0292 17 :YGRCQKIRRKSDGKILVWKELDYGSMT 2f57A 460 :TGIVCIATEKHTGKQVAVKKMDLRKQQ T0292 46 :EKQMLVSEVNLLRELKHPNIVRYYDRI 2f57A 487 :RRELLFNEVVIMRDYHHDNVVDMYSSY T0292 75 :RTNTTLYIVMEYCEGGDLAS 2f57A 514 :LVGDELWVVMEFLEGGALTD T0292 96 :ITKGTK 2f57A 534 :IVTHTR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2f57A 540 :MNEEQIATVCLSVLRALSYLHNQG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 2f57A 564 :VIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 2f57A 604 :VGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRV T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 2f57A 666 :LHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGP Number of specific fragments extracted= 9 number of extra gaps= 1 total=1726 Number of alignments=160 # 2f57A read from 2f57A/merged-good-all-a2m # found chain 2f57A in template set Warning: unaligning (T0292)G15 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (2f57A)S459 Warning: unaligning (T0292)S16 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (2f57A)S459 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f57A)L603 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f57A)L603 T0292 2 :RAED 2f57A 444 :DPRE T0292 6 :YEVLYTIGT 2f57A 449 :LANFIKIGE T0292 17 :YGRCQKIRRKSDGKILVWKELDYGSMT 2f57A 460 :TGIVCIATEKHTGKQVAVKKMDLRKQQ T0292 46 :EKQMLVSEVNLLRELKHPNIVRYYDRI 2f57A 487 :RRELLFNEVVIMRDYHHDNVVDMYSSY T0292 75 :RTNTTLYIVMEYCEGGDLASVITKGT 2f57A 514 :LVGDELWVVMEFLEGGALTDIVTHTR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 2f57A 540 :MNEEQIATVCLSVLRALSYLHNQG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 2f57A 564 :VIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRI 2f57A 604 :VGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPRV T0292 235 :PYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHH 2f57A 666 :LHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGP Number of specific fragments extracted= 9 number of extra gaps= 1 total=1735 Number of alignments=161 # 2f57A read from 2f57A/merged-good-all-a2m # found chain 2f57A in template set Warning: unaligning (T0292)G15 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (2f57A)S459 Warning: unaligning (T0292)S16 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (2f57A)S459 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f57A)L603 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f57A)L603 T0292 2 :RAEDYEVLYTIGT 2f57A 445 :PREYLANFIKIGE T0292 17 :YGRCQKIRRKSDGKILVWKELDYGSM 2f57A 460 :TGIVCIATEKHTGKQVAVKKMDLRKQ T0292 47 :KQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 2f57A 488 :RELLFNEVVIMRDYHHDNVVDMYSSYLVGDE T0292 80 :LYIVMEYCEGGDLASVITK 2f57A 519 :LWVVMEFLEGGALTDIVTH T0292 104 :QYLDEEFVLRVMTQLTLALKECHRR 2f57A 538 :TRMNEEQIATVCLSVLRALSYLHNQ T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFA 2f57A 563 :GVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR T0292 175 :VGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 2f57A 604 :VGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLPPR T0292 234 :IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHH 2f57A 665 :DLHKVSSVLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPP Number of specific fragments extracted= 8 number of extra gaps= 1 total=1743 Number of alignments=162 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zy4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zy4A expands to /projects/compbio/data/pdb/1zy4.pdb.gz 1zy4A:# T0292 read from 1zy4A/merged-good-all-a2m # 1zy4A read from 1zy4A/merged-good-all-a2m # adding 1zy4A to template set # found chain 1zy4A in template set Warning: unaligning (T0292)H166 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1zy4A)A888 Warning: unaligning (T0292)P178 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zy4A)A888 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1zy4A 597 :SDFEEIAVLGQGAFGQVVKARNALDSRYYAIKKIRH T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTN 1zy4A 633 :TEEKLSTILSEVMLLASLNHQYVVRYYAAWLERRN T0292 78 :TTLYIVMEYCEGGDLASVITKGTKE 1zy4A 782 :STLFIQMEYCENGTLYDLIHSENLN T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1zy4A 807 :QQRDEYWRLFRQILEALSYIHSQG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1zy4A 831 :IIHRDLKPMNIFIDESRNVKIGDFGLAKNVH T0292 179 :YYMSPEQMNRM 1zy4A 889 :MYVATEVLDGT T0292 190 :SYNEKSDIWSLGCLLYELC 1zy4A 901 :HYNEKIDMYSLGIIFFEMI T0292 212 :PPFTA 1zy4A 920 :YPFST T0292 217 :FSQKELAGKIREGKFR 1zy4A 926 :MERVNILKKLRSVSIE T0292 234 :IPYRY 1zy4A 942 :FPPDF T0292 239 :SDELNEIITRMLNLKDYHRPSVEEILENPLILE 1zy4A 951 :MKVEKKIIRLLIDHDPNKRPGARTLLNSGWLPV Number of specific fragments extracted= 11 number of extra gaps= 0 total=1754 Number of alignments=163 # 1zy4A read from 1zy4A/merged-good-all-a2m # found chain 1zy4A in template set Warning: unaligning (T0292)P178 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zy4A)A888 T0292 5 :DYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDY 1zy4A 598 :DFEEIAVLGQGAFGQVVKARNALDSRYYAIKKIRH T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDRIID 1zy4A 633 :TEEKLSTILSEVMLLASLNHQYVVRYYAAWLE T0292 76 :TNTTLYIVMEYCEGGDLASVITKGTKE 1zy4A 780 :KKSTLFIQMEYCENGTLYDLIHSENLN T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1zy4A 807 :QQRDEYWRLFRQILEALSYIHSQG T0292 135 :VLHRDLKPANVFLDGKQNVKLGDFGLARILN 1zy4A 831 :IIHRDLKPMNIFIDESRNVKIGDFGLAKNVH T0292 179 :YYMSPEQMNR 1zy4A 889 :MYVATEVLDG T0292 189 :MSYNEKSDIWSLGCLLYELCA 1zy4A 900 :GHYNEKIDMYSLGIIFFEMIY T0292 212 :PPFTAFSQKELAGKIREGKFR 1zy4A 921 :PFSTGMERVNILKKLRSVSIE T0292 234 :IPYRYS 1zy4A 942 :FPPDFD T0292 240 :DELNEIITRMLNLKDYHRPSVEEILENPLILEHH 1zy4A 952 :KVEKKIIRLLIDHDPNKRPGARTLLNSGWLPVKH Number of specific fragments extracted= 10 number of extra gaps= 0 total=1764 Number of alignments=164 # 1zy4A read from 1zy4A/merged-good-all-a2m # found chain 1zy4A in template set Warning: unaligning (T0292)P178 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1zy4A)A888 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYG 1zy4A 597 :SDFEEIAVLGQGAFGQVVKARNALDSRYYAIKKIRHT T0292 44 :EAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNT 1zy4A 634 :EEKLSTILSEVMLLASLNHQYVVRYYAAWLERRNF T0292 79 :TLYIVMEYCEGGDLASVITKGTKER 1zy4A 783 :TLFIQMEYCENGTLYDLIHSENLNQ T0292 107 :DEEFVLRVMTQLTLALKECHRR 1zy4A 808 :QRDEYWRLFRQILEALSYIHSQ T0292 134 :TVLHRDLKPANVFLDGKQNVKLGDFGLARILN 1zy4A 830 :GIIHRDLKPMNIFIDESRNVKIGDFGLAKNVH T0292 179 :YYMSPEQMNR 1zy4A 889 :MYVATEVLDG T0292 189 :MSYNEKSDIWSLGCLLYELC 1zy4A 900 :GHYNEKIDMYSLGIIFFEMI T0292 211 :MPPFTAFSQKELAGKIREGKFR 1zy4A 920 :YPFSTGMERVNILKKLRSVSIE T0292 234 :IPYRYS 1zy4A 942 :FPPDFD T0292 240 :DELNEIITRMLNLKDYHRPSVEEILENPLIL 1zy4A 952 :KVEKKIIRLLIDHDPNKRPGARTLLNSGWLP Number of specific fragments extracted= 10 number of extra gaps= 0 total=1774 Number of alignments=165 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1cmkE/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1cmkE expands to /projects/compbio/data/pdb/1cmk.pdb.gz 1cmkE:Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms Bad short name: P for alphabet: pdb_atoms Bad short name: O1P for alphabet: pdb_atoms Bad short name: O2P for alphabet: pdb_atoms Bad short name: O3P for alphabet: pdb_atoms # T0292 read from 1cmkE/merged-good-all-a2m # 1cmkE read from 1cmkE/merged-good-all-a2m # adding 1cmkE to template set # found chain 1cmkE in template set Warning: unaligning (T0292)R2 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)L40 Warning: unaligning (T0292)A3 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)L40 Warning: unaligning (T0292)I72 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)K111 Warning: unaligning (T0292)R75 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)K111 Warning: unaligning (T0292)T76 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)N113 Warning: unaligning (T0292)N77 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)N113 Warning: unaligning (T0292)Q151 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1cmkE)Y179 Warning: unaligning (T0292)N152 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1cmkE)Y179 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)L198 Warning: unaligning (T0292)V175 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)G200 Warning: unaligning (T0292)G176 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)G200 Warning: unaligning (T0292)D240 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)D264 Warning: unaligning (T0292)E241 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)D264 Warning: unaligning (T0292)L264 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)N293 Warning: unaligning (T0292)E265 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)N293 Warning: unaligning (T0292)P267 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1cmkE)W296 Warning: unaligning (T0292)L268 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1cmkE)W296 Warning: unaligning (T0292)I269 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)A298 Warning: unaligning (T0292)L270 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)A298 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTE 1cmkE 41 :DQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKVVK T0292 45 :AEKQMLVSEVNLLRELKHPNIVRYYDR 1cmkE 83 :KQIEHTLNEKRILQAVNFPFLVKLEYS T0292 78 :TTLYIVMEYCEGGDLASVITKGTK 1cmkE 114 :SNLYMVMEYVPGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1cmkE 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGK 1cmkE 162 :LIYRDLKPENLLIDQQ T0292 153 :VKLGDFGLARILN 1cmkE 180 :IQVTDFGFAKRVK T0292 169 :SFA 1cmkE 193 :GRT T0292 177 :TPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKF 1cmkE 201 :TPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKV T0292 233 :RIPYRYS 1cmkE 256 :RFPSHFS T0292 242 :LNEIITRMLNLKDYHRP 1cmkE 265 :LKDLLRNLLQVDLTKRF T0292 260 :VEEI 1cmkE 288 :VNDI T0292 266 :N 1cmkE 294 :H T0292 271 :EH 1cmkE 299 :TT Number of specific fragments extracted= 13 number of extra gaps= 6 total=1787 Number of alignments=166 # 1cmkE read from 1cmkE/merged-good-all-a2m # found chain 1cmkE in template set Warning: unaligning (T0292)R2 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)L40 Warning: unaligning (T0292)A3 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)L40 Warning: unaligning (T0292)I72 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)K111 Warning: unaligning (T0292)R75 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)K111 Warning: unaligning (T0292)T76 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)N113 Warning: unaligning (T0292)N77 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)N113 Warning: unaligning (T0292)Q151 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1cmkE)Y179 Warning: unaligning (T0292)N152 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1cmkE)Y179 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)L198 Warning: unaligning (T0292)V175 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)G200 Warning: unaligning (T0292)G176 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)G200 Warning: unaligning (T0292)D240 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)D264 Warning: unaligning (T0292)E241 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)D264 Warning: unaligning (T0292)L264 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)N293 Warning: unaligning (T0292)E265 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)N293 Warning: unaligning (T0292)P267 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1cmkE)W296 Warning: unaligning (T0292)L268 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1cmkE)W296 Warning: unaligning (T0292)I269 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)A298 Warning: unaligning (T0292)L270 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)A298 T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1cmkE 41 :DQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDR 1cmkE 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEYS T0292 78 :TTLYIVMEYCEGGDLASVITKGTK 1cmkE 114 :SNLYMVMEYVPGGEMFSHLRRIGR T0292 106 :LDEEFVLRVMTQLTLALKECHRRS 1cmkE 138 :FSEPHARFYAAQIVLTFEYLHSLD T0292 135 :VLHRDLKPANVFLDGK 1cmkE 162 :LIYRDLKPENLLIDQQ T0292 153 :VKLGDFGLARILN 1cmkE 180 :IQVTDFGFAKRVK T0292 169 :SFA 1cmkE 193 :GRT T0292 177 :TPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1cmkE 201 :TPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYS 1cmkE 257 :FPSHFS T0292 242 :LNEIITRMLNLKDYHRP 1cmkE 265 :LKDLLRNLLQVDLTKRF T0292 259 :SVEEI 1cmkE 287 :GVNDI T0292 266 :N 1cmkE 294 :H T0292 271 :EHH 1cmkE 299 :TTD Number of specific fragments extracted= 13 number of extra gaps= 6 total=1800 Number of alignments=167 # 1cmkE read from 1cmkE/merged-good-all-a2m # found chain 1cmkE in template set Warning: unaligning (T0292)R2 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)L40 Warning: unaligning (T0292)A3 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)L40 Warning: unaligning (T0292)I72 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)K111 Warning: unaligning (T0292)I73 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)K111 Warning: unaligning (T0292)D74 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)N113 Warning: unaligning (T0292)R75 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)N113 Warning: unaligning (T0292)Q151 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1cmkE)Y179 Warning: unaligning (T0292)N152 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1cmkE)Y179 Warning: unaligning (T0292)K172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)L198 Warning: unaligning (T0292)F174 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)L198 Warning: unaligning (T0292)V175 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)G200 Warning: unaligning (T0292)G176 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)G200 Warning: unaligning (T0292)D240 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)D264 Warning: unaligning (T0292)E241 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)D264 Warning: unaligning (T0292)L264 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1cmkE)N293 Warning: unaligning (T0292)E265 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1cmkE)N293 Warning: unaligning (T0292)P267 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1cmkE)W296 Warning: unaligning (T0292)L268 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1cmkE)W296 Warning: unaligning (T0292)I269 because of BadResidue code BAD_PEPTIDE in next template residue (1cmkE)A298 Warning: unaligning (T0292)L270 because of BadResidue code BAD_PEPTIDE at template residue (1cmkE)A298 T0292 1 :S 1cmkE 38 :A T0292 4 :EDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSM 1cmkE 41 :DQFERIKTLGTGSFGRVMLVKHKETGNHFAMKILDKQKV T0292 43 :TEAEKQMLVSEVNLLRELKHPNIVRYYDR 1cmkE 81 :KLKQIEHTLNEKRILQAVNFPFLVKLEYS T0292 76 :TN 1cmkE 114 :SN T0292 80 :LYIVMEYCEGGDLASVITK 1cmkE 116 :LYMVMEYVPGGEMFSHLRR T0292 103 :RQYLDEEFVLRVMTQLTLALKECHRR 1cmkE 135 :IGRFSEPHARFYAAQIVLTFEYLHSL T0292 134 :TVLHRDLKPANVFLDGK 1cmkE 161 :DLIYRDLKPENLLIDQQ T0292 153 :VKLGDFGLARILNHD 1cmkE 180 :IQVTDFGFAKRVKGR T0292 171 :A 1cmkE 195 :T T0292 177 :TPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFR 1cmkE 201 :TPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR T0292 234 :IPYRYS 1cmkE 257 :FPSHFS T0292 242 :LNEIITRMLNLKDYHRP 1cmkE 265 :LKDLLRNLLQVDLTKRF T0292 261 :EEI 1cmkE 289 :NDI T0292 266 :N 1cmkE 294 :H T0292 271 :EH 1cmkE 299 :TT Number of specific fragments extracted= 15 number of extra gaps= 6 total=1815 Number of alignments=168 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0292//projects/compbio/experiments/protein-predict/casp7/T0292/align.constraints_v3.costfcn or /projects/compbio/experiments/protein-predict/casp7/T0292//projects/compbio/experiments/protein-predict/casp7/T0292/align.constraints_v3.costfcn.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/T0292/align.constraints_v3.costfcn # reading script from file /projects/compbio/experiments/protein-predict/casp7/T0292/align.constraints_v3.costfcn # future Constraint commands -> align # future HelixConstraint commands -> align # future StrandConstraint commands -> align # future SheetConstraint commands -> align # future Hbond commands -> align # future SSbond commands -> align # Constraint # added constraint: constraint((T0292)T119.CB, (T0292)I263.CB) [> 3.1803 = 5.3005 < 6.8906] w=1.0000 to align # Constraint # added constraint: constraint((T0292)T119.CB, (T0292)L200.CB) [> 4.1528 = 6.9213 < 8.9977] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L118.CB, (T0292)L200.CB) [> 3.7017 = 6.1695 < 8.0204] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L118.CB, (T0292)L155.CB) [> 4.1565 = 6.9275 < 9.0057] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L118.CB, (T0292)V145.CB) [> 4.0222 = 6.7037 < 8.7148] w=1.0000 to align # Constraint # added constraint: constraint((T0292)M115.CB, (T0292)L204.CB) [> 3.3324 = 5.5539 < 7.2201] w=1.0000 to align # Constraint # added constraint: constraint((T0292)V114.CB, (T0292)L207.CB) [> 3.9627 = 6.6044 < 8.5857] w=1.0000 to align # Constraint # added constraint: constraint((T0292)V111.CB, (T0292)C208.CB) [> 3.4859 = 5.8099 < 7.5529] w=1.0000 to align # Constraint # added constraint: constraint((T0292)V111.CB, (T0292)L207.CB) [> 2.7217 = 4.5361 < 5.8969] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L92.CB, (T0292)L147.CB) [> 3.7940 = 6.3234 < 8.2204] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L92.CB, (T0292)V145.CB) [> 2.5677 = 4.2796 < 5.5634] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L92.CB, (T0292)P142.CB) [> 2.7575 = 4.5957 < 5.9745] w=1.0000 to align # Constraint # added constraint: constraint((T0292)Y68.CB, (T0292)I82.CB) [> 3.9411 = 6.5685 < 8.5391] w=1.0000 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)K154.CB) [> 2.9311 = 4.8851 < 6.3507] w=1.0000 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)L155.CB) [> 3.1334 = 5.2223 < 6.7890] w=1.0000 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)K154.CB) [> 3.7185 = 6.1975 < 8.0568] w=1.0000 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)A121.CB) [> 3.2930 = 5.4883 < 7.1348] w=1.0000 to align # Constraint # added constraint: constraint((T0292)N64.CB, (T0292)A121.CB) [> 2.2438 = 3.7397 < 4.8616] w=1.0000 to align # Constraint # added constraint: constraint((T0292)N64.CB, (T0292)L120.CB) [> 3.3143 = 5.5239 < 7.1811] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L57.CB, (T0292)Y68.CB) [> 2.6352 = 4.3920 < 5.7095] w=1.0000 to align # Constraint # added constraint: constraint((T0292)G201.CA, (T0292)M249.CB) [> 2.3720 = 3.9534 < 5.1394] w=1.0000 to align # Constraint # added constraint: constraint((T0292)G201.CA, (T0292)I246.CB) [> 3.4730 = 5.7883 < 7.5248] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L200.CB, (T0292)M249.CB) [> 3.5922 = 5.9870 < 7.7832] w=1.0000 to align # Constraint # added constraint: constraint((T0292)W198.CB, (T0292)M249.CB) [> 3.8824 = 6.4706 < 8.4118] w=1.0000 to align # Constraint # added constraint: constraint((T0292)I197.CB, (T0292)P258.CB) [> 3.7137 = 6.1896 < 8.0464] w=1.0000 to align # Constraint # added constraint: constraint((T0292)I197.CB, (T0292)M249.CB) [> 3.2913 = 5.4856 < 7.1313] w=1.0000 to align # Constraint # added constraint: constraint((T0292)V145.CB, (T0292)L155.CB) [> 3.6339 = 6.0565 < 7.8734] w=1.0000 to align # Constraint # added constraint: constraint((T0292)V145.CB, (T0292)K154.CB) [> 4.3829 = 7.3047 < 9.4962] w=1.0000 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)S199.CB) [> 4.1309 = 6.8849 < 8.9503] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L140.CB, (T0292)L203.CB) [> 3.8651 = 6.4418 < 8.3743] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L140.CB, (T0292)L200.CB) [> 3.7225 = 6.2042 < 8.0655] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L140.CB, (T0292)S199.CB) [> 2.3161 = 3.8602 < 5.0183] w=1.0000 to align # Constraint # added constraint: constraint((T0292)A121.CB, (T0292)L155.CB) [> 2.8823 = 4.8038 < 6.2449] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L122.CB, (T0292)H137.CB) [> 4.1638 = 6.9396 < 9.0215] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L122.CB, (T0292)D196.CB) [> 3.3270 = 5.5450 < 7.2085] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L122.CB, (T0292)L200.CB) [> 4.0980 = 6.8300 < 8.8790] w=1.0000 to align # Constraint # added constraint: constraint((T0292)C125.CB, (T0292)V135.CB) [> 2.6339 = 4.3898 < 5.7068] w=1.0000 to align # Constraint # added constraint: constraint((T0292)C125.CB, (T0292)L136.CB) [> 4.3665 = 7.2775 < 9.4607] w=1.0000 to align # Constraint # added constraint: constraint((T0292)C125.CB, (T0292)H137.CB) [> 3.6710 = 6.1183 < 7.9538] w=1.0000 to align # Constraint # added constraint: constraint((T0292)H126.CB, (T0292)V135.CB) [> 4.1570 = 6.9284 < 9.0069] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)D196.CB) [> 3.5608 = 5.9346 < 7.7150] w=1.0000 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)L155.CB) [> 4.1662 = 6.9437 < 9.0268] w=1.0000 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)D196.CB) [> 3.1756 = 5.2926 < 6.8804] w=1.0000 to align # Constraint # added constraint: constraint((T0292)L140.CB, (T0292)D196.CB) [> 3.4343 = 5.7239 < 7.4411] w=1.0000 to align # Constraint # added constraint: constraint((T0292)N64.CB, (T0292)L155.CB) [> 3.7262 = 6.2103 < 8.0734] w=0.9939 to align # Constraint # added constraint: constraint((T0292)N64.CB, (T0292)K154.CB) [> 3.4556 = 5.7593 < 7.4871] w=0.9939 to align # Constraint # added constraint: constraint((T0292)N64.CB, (T0292)Q117.CB) [> 2.9969 = 4.9949 < 6.4933] w=0.9939 to align # Constraint # added constraint: constraint((T0292)T119.CB, (T0292)L264.CB) [> 3.3819 = 5.6364 < 7.3274] w=0.9818 to align # Constraint # added constraint: constraint((T0292)A93.CB, (T0292)P142.CB) [> 2.4562 = 4.0937 < 5.3218] w=0.9818 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)S195.CB) [> 3.8636 = 6.4394 < 8.3712] w=0.9818 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)D196.CB) [> 4.3183 = 7.1972 < 9.3564] w=0.9818 to align # Constraint # added constraint: constraint((T0292)K194.CB, (T0292)D254.CB) [> 2.4903 = 4.1504 < 5.3955] w=0.9818 to align # Constraint # added constraint: constraint((T0292)W198.CB, (T0292)L250.CB) [> 3.9234 = 6.5389 < 8.5006] w=0.9818 to align # Constraint # added constraint: constraint((T0292)K35.CB, (T0292)I82.CB) [> 2.6185 = 4.3641 < 5.6734] w=0.9818 to align # Constraint # added constraint: constraint((T0292)K35.CB, (T0292)Y81.CB) [> 4.1736 = 6.9560 < 9.0428] w=0.9818 to align # Constraint # added constraint: constraint((T0292)W34.CB, (T0292)I82.CB) [> 4.2037 = 7.0062 < 9.1081] w=0.9818 to align # Constraint # added constraint: constraint((T0292)W34.CB, (T0292)Y81.CB) [> 3.4222 = 5.7037 < 7.4148] w=0.9818 to align # Constraint # added constraint: constraint((T0292)V33.CB, (T0292)Y86.CB) [> 2.7873 = 4.6454 < 6.0391] w=0.9818 to align # Constraint # added constraint: constraint((T0292)L32.CB, (T0292)Y86.CB) [> 3.2208 = 5.3680 < 6.9784] w=0.9818 to align # Constraint # added constraint: constraint((T0292)L32.CB, (T0292)Y69.CB) [> 3.8649 = 6.4416 < 8.3740] w=0.9818 to align # Constraint # added constraint: constraint((T0292)I23.CB, (T0292)W34.CB) [> 2.8570 = 4.7617 < 6.1902] w=0.9818 to align # Constraint # added constraint: constraint((T0292)I23.CB, (T0292)L32.CB) [> 3.0652 = 5.1087 < 6.6413] w=0.9818 to align # Constraint # added constraint: constraint((T0292)C20.CB, (T0292)K35.CB) [> 3.0585 = 5.0975 < 6.6268] w=0.9818 to align # Constraint # added constraint: constraint((T0292)C20.CB, (T0292)W34.CB) [> 4.1812 = 6.9686 < 9.0592] w=0.9818 to align # Constraint # added constraint: constraint((T0292)C20.CB, (T0292)V33.CB) [> 3.5020 = 5.8368 < 7.5878] w=0.9818 to align # Constraint # added constraint: constraint((T0292)R71.CB, (T0292)I82.CB) [> 3.2353 = 5.3922 < 7.0099] w=0.9818 to align # Constraint # added constraint: constraint((T0292)R71.CB, (T0292)Y81.CB) [> 4.0020 = 6.6700 < 8.6710] w=0.9818 to align # Constraint # added constraint: constraint((T0292)R58.CB, (T0292)Y68.CB) [> 3.5132 = 5.8553 < 7.6119] w=0.9818 to align # Constraint # added constraint: constraint((T0292)P142.CB, (T0292)E206.CB) [> 3.8250 = 6.3750 < 8.2875] w=0.9818 to align # Constraint # added constraint: constraint((T0292)P142.CB, (T0292)L203.CB) [> 3.7352 = 6.2253 < 8.0929] w=0.9818 to align # Constraint # added constraint: constraint((T0292)Y69.CB, (T0292)V83.CB) [> 2.8090 = 4.6816 < 6.0861] w=0.9818 to align # Constraint # added constraint: constraint((T0292)Y68.CB, (T0292)V83.CB) [> 4.3974 = 7.3290 < 9.5277] w=0.9818 to align # Constraint # added constraint: constraint((T0292)R67.CB, (T0292)E85.CB) [> 2.8777 = 4.7962 < 6.2351] w=0.9818 to align # Constraint # added constraint: constraint((T0292)M249.CB, (T0292)P258.CB) [> 3.3844 = 5.6407 < 7.3329] w=0.9818 to align # Constraint # added constraint: constraint((T0292)L204.CB, (T0292)M249.CB) [> 4.2128 = 7.0214 < 9.1278] w=0.9818 to align # Constraint # added constraint: constraint((T0292)L204.CB, (T0292)I246.CB) [> 3.4565 = 5.7609 < 7.4892] w=0.9818 to align # Constraint # added constraint: constraint((T0292)W198.CB, (T0292)R257.CB) [> 4.0252 = 6.7087 < 8.7213] w=0.9818 to align # Constraint # added constraint: constraint((T0292)I197.CB, (T0292)R257.CB) [> 3.1706 = 5.2842 < 6.8695] w=0.9818 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)L155.CB) [> 4.0376 = 6.7294 < 8.7482] w=0.9818 to align # Constraint # added constraint: constraint((T0292)N144.CB, (T0292)L155.CB) [> 3.9095 = 6.5159 < 8.4706] w=0.9818 to align # Constraint # added constraint: constraint((T0292)E36.CB, (T0292)Y81.CB) [> 3.2827 = 5.4712 < 7.1126] w=0.9818 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)G156.CA) [> 4.1921 = 6.9869 < 9.0830] w=0.9818 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)G156.CA) [> 2.7249 = 4.5416 < 5.9040] w=0.9818 to align # Constraint # added constraint: constraint((T0292)V114.CB, (T0292)V153.CB) [> 3.3890 = 5.6484 < 7.3429] w=0.9818 to align # Constraint # added constraint: constraint((T0292)Q117.CB, (T0292)V153.CB) [> 2.5989 = 4.3314 < 5.6308] w=0.9818 to align # Constraint # added constraint: constraint((T0292)L118.CB, (T0292)V153.CB) [> 3.7859 = 6.3098 < 8.2028] w=0.9818 to align # Constraint # added constraint: constraint((T0292)F146.CB, (T0292)G156.CA) [> 3.8268 = 6.3780 < 8.2914] w=0.9818 to align # Constraint # added constraint: constraint((T0292)Y205.CB, (T0292)I246.CB) [> 3.4971 = 5.8285 < 7.5771] w=0.9818 to align # Constraint # added constraint: constraint((T0292)H126.CB, (T0292)L136.CB) [> 4.2760 = 7.1266 < 9.2647] w=0.9818 to align # Constraint # added constraint: constraint((T0292)D91.CB, (T0292)A143.CB) [> 3.2844 = 5.4740 < 7.1162] w=0.9818 to align # Constraint # added constraint: constraint((T0292)N64.CB, (T0292)V153.CB) [> 3.5277 = 5.8795 < 7.6434] w=0.9757 to align # Constraint # added constraint: constraint((T0292)C87.CB, (T0292)K154.CB) [> 3.5566 = 5.9276 < 7.7059] w=0.9687 to align # Constraint # added constraint: constraint((T0292)C87.CB, (T0292)F146.CB) [> 2.4887 = 4.1478 < 5.3922] w=0.9687 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)L203.CB) [> 4.0608 = 6.7680 < 8.7984] w=0.9635 to align # Constraint # added constraint: constraint((T0292)I31.CB, (T0292)Y86.CB) [> 2.8440 = 4.7400 < 6.1620] w=0.9635 to align # Constraint # added constraint: constraint((T0292)I72.CB, (T0292)Y81.CB) [> 2.7626 = 4.6044 < 5.9857] w=0.9635 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)E85.CB) [> 3.3538 = 5.5897 < 7.2667] w=0.9635 to align # Constraint # added constraint: constraint((T0292)G201.CA, (T0292)L250.CB) [> 3.4247 = 5.7078 < 7.4202] w=0.9635 to align # Constraint # added constraint: constraint((T0292)Q185.CB, (T0292)S195.CB) [> 3.5658 = 5.9431 < 7.7260] w=0.9635 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)S199.CB) [> 4.1657 = 6.9428 < 9.0257] w=0.9635 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)W198.CB) [> 2.2568 = 3.7614 < 4.8898] w=0.9635 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)S195.CB) [> 2.6452 = 4.4087 < 5.7313] w=0.9635 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)K194.CB) [> 4.2989 = 7.1648 < 9.3143] w=0.9635 to align # Constraint # added constraint: constraint((T0292)Y180.CB, (T0292)C202.CB) [> 2.9387 = 4.8978 < 6.3672] w=0.9635 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)M84.CB) [> 3.3340 = 5.5567 < 7.2237] w=0.9635 to align # Constraint # added constraint: constraint((T0292)R67.CB, (T0292)M84.CB) [> 4.1189 = 6.8648 < 8.9242] w=0.9635 to align # Constraint # added constraint: constraint((T0292)Y68.CB, (T0292)M84.CB) [> 3.6911 = 6.1518 < 7.9974] w=0.9635 to align # Constraint # added constraint: constraint((T0292)Y69.CB, (T0292)M84.CB) [> 4.0154 = 6.6923 < 8.7000] w=0.9635 to align # Constraint # added constraint: constraint((T0292)D70.CB, (T0292)V83.CB) [> 2.4455 = 4.0759 < 5.2986] w=0.9635 to align # Constraint # added constraint: constraint((T0292)R71.CB, (T0292)V83.CB) [> 4.1324 = 6.8874 < 8.9536] w=0.9635 to align # Constraint # added constraint: constraint((T0292)L32.CB, (T0292)E85.CB) [> 4.0992 = 6.8320 < 8.8816] w=0.9635 to align # Constraint # added constraint: constraint((T0292)V33.CB, (T0292)E85.CB) [> 4.1491 = 6.9151 < 8.9896] w=0.9635 to align # Constraint # added constraint: constraint((T0292)L32.CB, (T0292)V83.CB) [> 3.0828 = 5.1379 < 6.6793] w=0.9635 to align # Constraint # added constraint: constraint((T0292)W34.CB, (T0292)V83.CB) [> 3.2300 = 5.3834 < 6.9984] w=0.9635 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)S195.CB) [> 3.9514 = 6.5856 < 8.5613] w=0.9635 to align # Constraint # added constraint: constraint((T0292)N144.CB, (T0292)G156.CA) [> 3.1202 = 5.2003 < 6.7603] w=0.9635 to align # Constraint # added constraint: constraint((T0292)V145.CB, (T0292)G156.CA) [> 4.3913 = 7.3188 < 9.5144] w=0.9635 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)F146.CB) [> 3.9342 = 6.5571 < 8.5242] w=0.9635 to align # Constraint # added constraint: constraint((T0292)I245.CB, (T0292)N266.CB) [> 3.1612 = 5.2687 < 6.8493] w=0.9574 to align # Constraint # added constraint: constraint((T0292)V8.CB, (T0292)I23.CB) [> 3.4982 = 5.8303 < 7.5794] w=0.9574 to align # Constraint # added constraint: constraint((T0292)V54.CB, (T0292)I82.CB) [> 4.0641 = 6.7736 < 8.8056] w=0.9574 to align # Constraint # added constraint: constraint((T0292)I96.CB, (T0292)L207.CB) [> 3.9410 = 6.5684 < 8.5389] w=0.9513 to align # Constraint # added constraint: constraint((T0292)L204.CB, (T0292)I245.CB) [> 4.2827 = 7.1378 < 9.2792] w=0.9505 to align # Constraint # added constraint: constraint((T0292)L118.CB, (T0292)L203.CB) [> 4.2606 = 7.1009 < 9.2312] w=0.9453 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)E193.CB) [> 3.2313 = 5.3855 < 7.0012] w=0.9453 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)D157.CB) [> 3.7287 = 6.2145 < 8.0788] w=0.9453 to align # Constraint # added constraint: constraint((T0292)C202.CB, (T0292)P213.CB) [> 3.4952 = 5.8254 < 7.5730] w=0.9453 to align # Constraint # added constraint: constraint((T0292)V111.CB, (T0292)L204.CB) [> 4.0534 = 6.7556 < 8.7823] w=0.9453 to align # Constraint # added constraint: constraint((T0292)P183.CB, (T0292)L252.CB) [> 3.2884 = 5.4807 < 7.1249] w=0.9453 to align # Constraint # added constraint: constraint((T0292)M115.CB, (T0292)L200.CB) [> 4.3303 = 7.2171 < 9.3823] w=0.9453 to align # Constraint # added constraint: constraint((T0292)P183.CB, (T0292)W198.CB) [> 4.4900 = 7.4833 < 9.7283] w=0.9453 to align # Constraint # added constraint: constraint((T0292)Y180.CB, (T0292)S199.CB) [> 2.6849 = 4.4749 < 5.8174] w=0.9453 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)Y180.CB) [> 2.9337 = 4.8896 < 6.3564] w=0.9453 to align # Constraint # added constraint: constraint((T0292)L140.CB, (T0292)Y180.CB) [> 3.7889 = 6.3148 < 8.2093] w=0.9453 to align # Constraint # added constraint: constraint((T0292)L32.CB, (T0292)M84.CB) [> 3.8313 = 6.3855 < 8.3012] w=0.9453 to align # Constraint # added constraint: constraint((T0292)V33.CB, (T0292)M84.CB) [> 2.6433 = 4.4055 < 5.7271] w=0.9453 to align # Constraint # added constraint: constraint((T0292)K35.CB, (T0292)M84.CB) [> 3.9670 = 6.6116 < 8.5951] w=0.9453 to align # Constraint # added constraint: constraint((T0292)V33.CB, (T0292)V83.CB) [> 4.4245 = 7.3742 < 9.5865] w=0.9453 to align # Constraint # added constraint: constraint((T0292)H62.CB, (T0292)E124.CB) [> 2.7977 = 4.6628 < 6.0617] w=0.9453 to align # Constraint # added constraint: constraint((T0292)C208.CB, (T0292)L242.CB) [> 3.8906 = 6.4843 < 8.4296] w=0.9453 to align # Constraint # added constraint: constraint((T0292)N144.CB, (T0292)D157.CB) [> 2.7645 = 4.6075 < 5.9897] w=0.9453 to align # Constraint # added constraint: constraint((T0292)K123.CB, (T0292)V260.CB) [> 2.5984 = 4.3307 < 5.6299] w=0.9386 to align # Constraint # added constraint: constraint((T0292)T119.CB, (T0292)V260.CB) [> 3.3332 = 5.5554 < 7.2220] w=0.9386 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)F158.CB) [> 3.8400 = 6.4000 < 8.3200] w=0.9270 to align # Constraint # added constraint: constraint((T0292)E184.CB, (T0292)S195.CB) [> 4.0848 = 6.8080 < 8.8503] w=0.9270 to align # Constraint # added constraint: constraint((T0292)E184.CB, (T0292)D254.CB) [> 3.4205 = 5.7009 < 7.4112] w=0.9270 to align # Constraint # added constraint: constraint((T0292)Y180.CB, (T0292)L203.CB) [> 4.2570 = 7.0951 < 9.2236] w=0.9270 to align # Constraint # added constraint: constraint((T0292)I23.CB, (T0292)V33.CB) [> 4.3579 = 7.2632 < 9.4421] w=0.9270 to align # Constraint # added constraint: constraint((T0292)I12.CB, (T0292)V33.CB) [> 3.9772 = 6.6286 < 8.6172] w=0.9270 to align # Constraint # added constraint: constraint((T0292)Y69.CB, (T0292)E85.CB) [> 4.0828 = 6.8047 < 8.8462] w=0.9270 to align # Constraint # added constraint: constraint((T0292)R19.CB, (T0292)E36.CB) [> 3.1743 = 5.2905 < 6.8777] w=0.9270 to align # Constraint # added constraint: constraint((T0292)E7.CB, (T0292)R24.CB) [> 2.8532 = 4.7553 < 6.1819] w=0.9149 to align # Constraint # added constraint: constraint((T0292)E7.CB, (T0292)I23.CB) [> 3.8024 = 6.3373 < 8.2385] w=0.9149 to align # Constraint # added constraint: constraint((T0292)Y6.CB, (T0292)I23.CB) [> 2.6436 = 4.4060 < 5.7277] w=0.9149 to align # Constraint # added constraint: constraint((T0292)C87.CB, (T0292)L147.CB) [> 3.9894 = 6.6491 < 8.6438] w=0.9140 to align # Constraint # added constraint: constraint((T0292)T11.CB, (T0292)C20.CB) [> 4.2904 = 7.1506 < 9.2958] w=0.9088 to align # Constraint # added constraint: constraint((T0292)Y179.CB, (T0292)C202.CB) [> 4.0540 = 6.7567 < 8.7837] w=0.9088 to align # Constraint # added constraint: constraint((T0292)A93.CB, (T0292)A143.CB) [> 2.8007 = 4.6679 < 6.0682] w=0.9088 to align # Constraint # added constraint: constraint((T0292)Q21.CB, (T0292)V33.CB) [> 4.4094 = 7.3491 < 9.5538] w=0.9088 to align # Constraint # added constraint: constraint((T0292)Q21.CB, (T0292)W34.CB) [> 3.0250 = 5.0417 < 6.5542] w=0.9088 to align # Constraint # added constraint: constraint((T0292)Q21.CB, (T0292)E36.CB) [> 4.2564 = 7.0940 < 9.2221] w=0.9088 to align # Constraint # added constraint: constraint((T0292)K22.CB, (T0292)V33.CB) [> 3.8354 = 6.3923 < 8.3100] w=0.9088 to align # Constraint # added constraint: constraint((T0292)I197.CB, (T0292)I263.CB) [> 4.3025 = 7.1708 < 9.3220] w=0.9088 to align # Constraint # added constraint: constraint((T0292)H126.CB, (T0292)V260.CB) [> 3.6195 = 6.0325 < 7.8423] w=0.9082 to align # Constraint # added constraint: constraint((T0292)L56.CB, (T0292)V135.CB) [> 3.8568 = 6.4280 < 8.3564] w=0.9079 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)E124.CB) [> 4.1755 = 6.9591 < 9.0469] w=0.9070 to align # Constraint # added constraint: constraint((T0292)L140.CB, (T0292)L155.CB) [> 4.4853 = 7.4755 < 9.7182] w=0.9070 to align # Constraint # added constraint: constraint((T0292)I96.CB, (T0292)P142.CB) [> 3.6071 = 6.0119 < 7.8155] w=0.9027 to align # Constraint # added constraint: constraint((T0292)L60.CB, (T0292)C125.CB) [> 4.1523 = 6.9205 < 8.9966] w=0.9027 to align # Constraint # added constraint: constraint((T0292)L37.CB, (T0292)L80.CB) [> 2.7885 = 4.6475 < 6.0417] w=0.9018 to align # Constraint # added constraint: constraint((T0292)E36.CB, (T0292)L80.CB) [> 4.3647 = 7.2746 < 9.4569] w=0.8966 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)C87.CB) [> 4.0769 = 6.7948 < 8.8333] w=0.8957 to align # Constraint # added constraint: constraint((T0292)C20.CB, (T0292)E36.CB) [> 4.5454 = 7.5756 < 9.8483] w=0.8905 to align # Constraint # added constraint: constraint((T0292)V95.CB, (T0292)L147.CB) [> 3.7903 = 6.3172 < 8.2124] w=0.8905 to align # Constraint # added constraint: constraint((T0292)L112.CB, (T0292)I269.CB) [> 3.9214 = 6.5356 < 8.4963] w=0.8905 to align # Constraint # added constraint: constraint((T0292)Y179.CB, (T0292)F214.CB) [> 3.6678 = 6.1130 < 7.9469] w=0.8905 to align # Constraint # added constraint: constraint((T0292)C202.CB, (T0292)L250.CB) [> 4.3698 = 7.2829 < 9.4678] w=0.8905 to align # Constraint # added constraint: constraint((T0292)I96.CB, (T0292)L106.CB) [> 4.1378 = 6.8963 < 8.9652] w=0.8905 to align # Constraint # added constraint: constraint((T0292)G18.CA, (T0292)K35.CB) [> 4.0527 = 6.7544 < 8.7808] w=0.8905 to align # Constraint # added constraint: constraint((T0292)P183.CB, (T0292)I226.CB) [> 3.3489 = 5.5816 < 7.2561] w=0.8845 to align # Constraint # added constraint: constraint((T0292)F214.CB, (T0292)K225.CB) [> 2.8449 = 4.7415 < 6.1639] w=0.8845 to align # Constraint # added constraint: constraint((T0292)L122.CB, (T0292)V260.CB) [> 3.0623 = 5.1038 < 6.6349] w=0.8838 to align # Constraint # added constraint: constraint((T0292)I96.CB, (T0292)E206.CB) [> 4.0488 = 6.7481 < 8.7725] w=0.8784 to align # Constraint # added constraint: constraint((T0292)T116.CB, (T0292)I269.CB) [> 3.4994 = 5.8324 < 7.5821] w=0.8784 to align # Constraint # added constraint: constraint((T0292)L9.CB, (T0292)K22.CB) [> 2.9008 = 4.8347 < 6.2851] w=0.8784 to align # Constraint # added constraint: constraint((T0292)R71.CB, (T0292)L80.CB) [> 4.1951 = 6.9918 < 9.0894] w=0.8784 to align # Constraint # added constraint: constraint((T0292)L106.CB, (T0292)L207.CB) [> 3.0895 = 5.1492 < 6.6939] w=0.8723 to align # Constraint # added constraint: constraint((T0292)G18.CA, (T0292)E36.CB) [> 3.5176 = 5.8626 < 7.6214] w=0.8723 to align # Constraint # added constraint: constraint((T0292)W34.CB, (T0292)M84.CB) [> 4.3983 = 7.3305 < 9.5296] w=0.8723 to align # Constraint # added constraint: constraint((T0292)K22.CB, (T0292)I31.CB) [> 3.9555 = 6.5926 < 8.5703] w=0.8723 to align # Constraint # added constraint: constraint((T0292)L92.CB, (T0292)V153.CB) [> 4.2428 = 7.0713 < 9.1927] w=0.8723 to align # Constraint # added constraint: constraint((T0292)I12.CB, (T0292)Q21.CB) [> 3.8034 = 6.3390 < 8.2407] w=0.8723 to align # Constraint # added constraint: constraint((T0292)I12.CB, (T0292)K22.CB) [> 3.2710 = 5.4517 < 7.0872] w=0.8723 to align # Constraint # added constraint: constraint((T0292)Y10.CB, (T0292)Q21.CB) [> 3.9679 = 6.6132 < 8.5971] w=0.8723 to align # Constraint # added constraint: constraint((T0292)T11.CB, (T0292)Q21.CB) [> 3.3216 = 5.5359 < 7.1967] w=0.8723 to align # Constraint # added constraint: constraint((T0292)D5.CB, (T0292)K26.CB) [> 3.4219 = 5.7031 < 7.4140] w=0.8662 to align # Constraint # added constraint: constraint((T0292)L9.CB, (T0292)Q21.CB) [> 3.5582 = 5.9303 < 7.7094] w=0.8662 to align # Constraint # added constraint: constraint((T0292)Q117.CB, (T0292)N152.CB) [> 4.0552 = 6.7586 < 8.7862] w=0.8601 to align # Constraint # added constraint: constraint((T0292)L60.CB, (T0292)R128.CB) [> 4.0518 = 6.7530 < 8.7789] w=0.8601 to align # Constraint # added constraint: constraint((T0292)L112.CB, (T0292)L268.CB) [> 3.9669 = 6.6115 < 8.5950] w=0.8601 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)L37.CB) [> 3.4807 = 5.8012 < 7.5415] w=0.8592 to align # Constraint # added constraint: constraint((T0292)G18.CA, (T0292)L37.CB) [> 3.2102 = 5.3503 < 6.9554] w=0.8592 to align # Constraint # added constraint: constraint((T0292)D70.CB, (T0292)I82.CB) [> 4.6064 = 7.6774 < 9.9806] w=0.8592 to align # Constraint # added constraint: constraint((T0292)L242.CB, (T0292)L268.CB) [> 3.3037 = 5.5061 < 7.1579] w=0.8541 to align # Constraint # added constraint: constraint((T0292)Y179.CB, (T0292)P212.CB) [> 3.0463 = 5.0771 < 6.6003] w=0.8540 to align # Constraint # added constraint: constraint((T0292)M186.CB, (T0292)A223.CB) [> 3.2284 = 5.3807 < 6.9949] w=0.8540 to align # Constraint # added constraint: constraint((T0292)M115.CB, (T0292)L207.CB) [> 4.3181 = 7.1969 < 9.3560] w=0.8540 to align # Constraint # added constraint: constraint((T0292)G90.CA, (T0292)L147.CB) [> 3.2630 = 5.4383 < 7.0698] w=0.8480 to align # Constraint # added constraint: constraint((T0292)V54.CB, (T0292)Y68.CB) [> 4.3509 = 7.2515 < 9.4269] w=0.8419 to align # Constraint # added constraint: constraint((T0292)Y6.CB, (T0292)L32.CB) [> 4.2620 = 7.1033 < 9.2343] w=0.8419 to align # Constraint # added constraint: constraint((T0292)I72.CB, (T0292)V83.CB) [> 4.4972 = 7.4953 < 9.7440] w=0.8407 to align # Constraint # added constraint: constraint((T0292)K22.CB, (T0292)L32.CB) [> 4.5683 = 7.6138 < 9.8979] w=0.8358 to align # Constraint # added constraint: constraint((T0292)G89.CA, (T0292)L147.CB) [> 2.8906 = 4.8176 < 6.2629] w=0.8349 to align # Constraint # added constraint: constraint((T0292)G89.CA, (T0292)F146.CB) [> 4.0596 = 6.7660 < 8.7957] w=0.8349 to align # Constraint # added constraint: constraint((T0292)E108.CB, (T0292)S239.CB) [> 3.5838 = 5.9730 < 7.7649] w=0.8288 to align # Constraint # added constraint: constraint((T0292)E241.CB, (T0292)P267.CB) [> 3.1692 = 5.2821 < 6.8667] w=0.8236 to align # Constraint # added constraint: constraint((T0292)E108.CB, (T0292)L242.CB) [> 3.7372 = 6.2287 < 8.0974] w=0.8228 to align # Constraint # added constraint: constraint((T0292)L118.CB, (T0292)L140.CB) [> 4.4657 = 7.4427 < 9.6756] w=0.8228 to align # Constraint # added constraint: constraint((T0292)R19.CB, (T0292)K35.CB) [> 4.4323 = 7.3871 < 9.6032] w=0.8176 to align # Constraint # added constraint: constraint((T0292)E53.CB, (T0292)G159.CA) [> 2.9567 = 4.9277 < 6.4061] w=0.8176 to align # Constraint # added constraint: constraint((T0292)Y179.CB, (T0292)L222.CB) [> 3.9570 = 6.5950 < 8.5735] w=0.8176 to align # Constraint # added constraint: constraint((T0292)K22.CB, (T0292)W34.CB) [> 4.6221 = 7.7035 < 10.0146] w=0.8176 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)C125.CB) [> 4.3184 = 7.1974 < 9.3566] w=0.8157 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)S199.CB) [> 4.6221 = 7.7036 < 10.0147] w=0.8157 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)T177.CB) [> 3.4567 = 5.7612 < 7.4896] w=0.8115 to align # Constraint # added constraint: constraint((T0292)E244.CB, (T0292)N266.CB) [> 4.5884 = 7.6473 < 9.9415] w=0.8115 to align # Constraint # added constraint: constraint((T0292)L37.CB, (T0292)I82.CB) [> 4.3331 = 7.2218 < 9.3883] w=0.8045 to align # Constraint # added constraint: constraint((T0292)L204.CB, (T0292)L242.CB) [> 4.3980 = 7.3299 < 9.5289] w=0.8045 to align # Constraint # added constraint: constraint((T0292)F146.CB, (T0292)L155.CB) [> 4.6118 = 7.6863 < 9.9922] w=0.7994 to align # Constraint # added constraint: constraint((T0292)L92.CB, (T0292)F146.CB) [> 4.3970 = 7.3283 < 9.5268] w=0.7993 to align # Constraint # added constraint: constraint((T0292)R248.CB, (T0292)N266.CB) [> 4.4692 = 7.4486 < 9.6832] w=0.7993 to align # Constraint # added constraint: constraint((T0292)I245.CB, (T0292)P258.CB) [> 4.4946 = 7.4910 < 9.7383] w=0.7993 to align # Constraint # added constraint: constraint((T0292)C87.CB, (T0292)D148.CB) [> 3.1904 = 5.3173 < 6.9125] w=0.7984 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)D254.CB) [> 4.2571 = 7.0952 < 9.2238] w=0.7975 to align # Constraint # added constraint: constraint((T0292)L37.CB, (T0292)L50.CB) [> 3.6938 = 6.1563 < 8.0032] w=0.7923 to align # Constraint # added constraint: constraint((T0292)G18.CA, (T0292)D38.CB) [> 3.7768 = 6.2947 < 8.1831] w=0.7863 to align # Constraint # added constraint: constraint((T0292)V33.CB, (T0292)C87.CB) [> 4.3642 = 7.2736 < 9.4557] w=0.7863 to align # Constraint # added constraint: constraint((T0292)N192.CB, (T0292)D254.CB) [> 3.8389 = 6.3981 < 8.3176] w=0.7844 to align # Constraint # added constraint: constraint((T0292)M181.CB, (T0292)S199.CB) [> 4.4067 = 7.3444 < 9.5478] w=0.7811 to align # Constraint # added constraint: constraint((T0292)L57.CB, (T0292)F158.CB) [> 3.4896 = 5.8159 < 7.5607] w=0.7811 to align # Constraint # added constraint: constraint((T0292)G89.CA, (T0292)D148.CB) [> 3.8877 = 6.4795 < 8.4233] w=0.7802 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)Y191.CB) [> 4.1673 = 6.9456 < 9.0293] w=0.7802 to align # Constraint # added constraint: constraint((T0292)L50.CB, (T0292)L80.CB) [> 3.7934 = 6.3224 < 8.2191] w=0.7802 to align # Constraint # added constraint: constraint((T0292)S195.CB, (T0292)D254.CB) [> 4.3522 = 7.2537 < 9.4298] w=0.7793 to align # Constraint # added constraint: constraint((T0292)L122.CB, (T0292)L155.CB) [> 4.4682 = 7.4470 < 9.6811] w=0.7793 to align # Constraint # added constraint: constraint((T0292)I197.CB, (T0292)S259.CB) [> 4.1484 = 6.9140 < 8.9881] w=0.7732 to align # Constraint # added constraint: constraint((T0292)L122.CB, (T0292)L140.CB) [> 4.4974 = 7.4956 < 9.7443] w=0.7662 to align # Constraint # added constraint: constraint((T0292)M181.CB, (T0292)S195.CB) [> 4.5430 = 7.5716 < 9.8431] w=0.7629 to align # Constraint # added constraint: constraint((T0292)V114.CB, (T0292)V145.CB) [> 4.4986 = 7.4977 < 9.7470] w=0.7628 to align # Constraint # added constraint: constraint((T0292)E88.CB, (T0292)D148.CB) [> 3.9172 = 6.5287 < 8.4873] w=0.7619 to align # Constraint # added constraint: constraint((T0292)V145.CB, (T0292)L203.CB) [> 4.4665 = 7.4443 < 9.6775] w=0.7610 to align # Constraint # added constraint: constraint((T0292)K123.CB, (T0292)L264.CB) [> 3.9093 = 6.5155 < 8.4701] w=0.7610 to align # Constraint # added constraint: constraint((T0292)I197.CB, (T0292)V260.CB) [> 3.9760 = 6.6267 < 8.6147] w=0.7610 to align # Constraint # added constraint: constraint((T0292)T116.CB, (T0292)L264.CB) [> 4.1880 = 6.9801 < 9.0741] w=0.7610 to align # Constraint # added constraint: constraint((T0292)L56.CB, (T0292)F158.CB) [> 3.1120 = 5.1867 < 6.7427] w=0.7498 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)R162.CB) [> 3.9210 = 6.5351 < 8.4956] w=0.7446 to align # Constraint # added constraint: constraint((T0292)P178.CB, (T0292)L222.CB) [> 3.2477 = 5.4129 < 7.0367] w=0.7446 to align # Constraint # added constraint: constraint((T0292)P63.CB, (T0292)N152.CB) [> 4.3777 = 7.2961 < 9.4850] w=0.7385 to align # Constraint # added constraint: constraint((T0292)I96.CB, (T0292)L210.CB) [> 4.0197 = 6.6995 < 8.7093] w=0.7325 to align # Constraint # added constraint: constraint((T0292)A121.CB, (T0292)V153.CB) [> 4.3976 = 7.3294 < 9.5282] w=0.7316 to align # Constraint # added constraint: constraint((T0292)E88.CB, (T0292)G149.CA) [> 3.4787 = 5.7978 < 7.5372] w=0.7316 to align # Constraint # added constraint: constraint((T0292)P183.CB, (T0292)R227.CB) [> 3.3615 = 5.6025 < 7.2833] w=0.7315 to align # Constraint # added constraint: constraint((T0292)E53.CB, (T0292)F158.CB) [> 3.1343 = 5.2239 < 6.7910] w=0.7315 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)G159.CA) [> 4.0636 = 6.7727 < 8.8045] w=0.7315 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)A161.CB) [> 3.6088 = 6.0146 < 7.8190] w=0.7263 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)A161.CB) [> 3.3293 = 5.5488 < 7.2134] w=0.7263 to align # Constraint # added constraint: constraint((T0292)Y180.CB, (T0292)W198.CB) [> 4.5970 = 7.6616 < 9.9601] w=0.7203 to align # Constraint # added constraint: constraint((T0292)L9.CB, (T0292)R24.CB) [> 3.9296 = 6.5494 < 8.5142] w=0.7142 to align # Constraint # added constraint: constraint((T0292)Y205.CB, (T0292)L250.CB) [> 4.4764 = 7.4607 < 9.6989] w=0.7133 to align # Constraint # added constraint: constraint((T0292)L37.CB, (T0292)Y81.CB) [> 4.5279 = 7.5465 < 9.8104] w=0.7133 to align # Constraint # added constraint: constraint((T0292)I23.CB, (T0292)V83.CB) [> 4.3803 = 7.3006 < 9.4908] w=0.7081 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)R162.CB) [> 3.3050 = 5.5083 < 7.1608] w=0.7081 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)A161.CB) [> 3.9602 = 6.6004 < 8.5805] w=0.7081 to align # Constraint # added constraint: constraint((T0292)H62.CB, (T0292)L120.CB) [> 4.5667 = 7.6112 < 9.8946] w=0.7063 to align # Constraint # added constraint: constraint((T0292)Y6.CB, (T0292)V83.CB) [> 4.3269 = 7.2115 < 9.3749] w=0.7011 to align # Constraint # added constraint: constraint((T0292)L106.CB, (T0292)C208.CB) [> 4.1312 = 6.8854 < 8.9510] w=0.6951 to align # Constraint # added constraint: constraint((T0292)L200.CB, (T0292)I263.CB) [> 4.4448 = 7.4080 < 9.6304] w=0.6932 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)Y180.CB) [> 4.5648 = 7.6079 < 9.8903] w=0.6899 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)Y179.CB) [> 4.4358 = 7.3930 < 9.6109] w=0.6899 to align # Constraint # added constraint: constraint((T0292)E85.CB, (T0292)K154.CB) [> 4.4032 = 7.3387 < 9.5403] w=0.6899 to align # Constraint # added constraint: constraint((T0292)T11.CB, (T0292)K22.CB) [> 4.6405 = 7.7341 < 10.0544] w=0.6899 to align # Constraint # added constraint: constraint((T0292)N64.CB, (T0292)N152.CB) [> 4.2193 = 7.0321 < 9.1418] w=0.6838 to align # Constraint # added constraint: constraint((T0292)E36.CB, (T0292)T79.CB) [> 3.3999 = 5.6666 < 7.3665] w=0.6788 to align # Constraint # added constraint: constraint((T0292)M115.CB, (T0292)L203.CB) [> 4.4568 = 7.4279 < 9.6563] w=0.6768 to align # Constraint # added constraint: constraint((T0292)M186.CB, (T0292)I226.CB) [> 3.6928 = 6.1547 < 8.0011] w=0.6716 to align # Constraint # added constraint: constraint((T0292)E108.CB, (T0292)C208.CB) [> 4.0575 = 6.7626 < 8.7913] w=0.6716 to align # Constraint # added constraint: constraint((T0292)E184.CB, (T0292)K194.CB) [> 4.4903 = 7.4839 < 9.7290] w=0.6716 to align # Constraint # added constraint: constraint((T0292)L57.CB, (T0292)I82.CB) [> 4.3500 = 7.2500 < 9.4250] w=0.6708 to align # Constraint # added constraint: constraint((T0292)M181.CB, (T0292)W198.CB) [> 4.6241 = 7.7067 < 10.0188] w=0.6698 to align # Constraint # added constraint: constraint((T0292)L60.CB, (T0292)V135.CB) [> 4.1767 = 6.9612 < 9.0495] w=0.6698 to align # Constraint # added constraint: constraint((T0292)V8.CB, (T0292)Q21.CB) [> 3.1506 = 5.2510 < 6.8263] w=0.6655 to align # Constraint # added constraint: constraint((T0292)L56.CB, (T0292)A161.CB) [> 3.1426 = 5.2377 < 6.8090] w=0.6586 to align # Constraint # added constraint: constraint((T0292)V111.CB, (T0292)L242.CB) [> 4.3673 = 7.2788 < 9.4624] w=0.6568 to align # Constraint # added constraint: constraint((T0292)E59.CB, (T0292)R128.CB) [> 3.9607 = 6.6012 < 8.5815] w=0.6567 to align # Constraint # added constraint: constraint((T0292)F231.CB, (T0292)L250.CB) [> 3.5208 = 5.8681 < 7.6285] w=0.6464 to align # Constraint # added constraint: constraint((T0292)L37.CB, (T0292)T79.CB) [> 4.0002 = 6.6670 < 8.6671] w=0.6458 to align # Constraint # added constraint: constraint((T0292)M115.CB, (T0292)I269.CB) [> 4.2742 = 7.1237 < 9.2608] w=0.6446 to align # Constraint # added constraint: constraint((T0292)V135.CB, (T0292)A161.CB) [> 3.4102 = 5.6836 < 7.3887] w=0.6403 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)L160.CB) [> 2.7689 = 4.6147 < 5.9992] w=0.6403 to align # Constraint # added constraint: constraint((T0292)V135.CB, (T0292)I163.CB) [> 3.5210 = 5.8683 < 7.6288] w=0.6342 to align # Constraint # added constraint: constraint((T0292)D196.CB, (T0292)V260.CB) [> 4.4998 = 7.4997 < 9.7496] w=0.6333 to align # Constraint # added constraint: constraint((T0292)E53.CB, (T0292)I82.CB) [> 4.4728 = 7.4547 < 9.6911] w=0.6282 to align # Constraint # added constraint: constraint((T0292)M186.CB, (T0292)R227.CB) [> 3.3839 = 5.6399 < 7.3319] w=0.6099 to align # Constraint # added constraint: constraint((T0292)M181.CB, (T0292)I226.CB) [> 4.0413 = 6.7356 < 8.7563] w=0.6038 to align # Constraint # added constraint: constraint((T0292)W198.CB, (T0292)D254.CB) [> 4.6358 = 7.7263 < 10.0442] w=0.6020 to align # Constraint # added constraint: constraint((T0292)S52.CB, (T0292)G159.CA) [> 3.9447 = 6.5744 < 8.5468] w=0.5917 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)D38.CB) [> 3.6946 = 6.1577 < 8.0051] w=0.5856 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)L160.CB) [> 4.4195 = 7.3658 < 9.5756] w=0.5856 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)A161.CB) [> 4.3112 = 7.1853 < 9.3409] w=0.5804 to align # Constraint # added constraint: constraint((T0292)E193.CB, (T0292)V260.CB) [> 4.4227 = 7.3712 < 9.5825] w=0.5786 to align # Constraint # added constraint: constraint((T0292)Y191.CB, (T0292)D254.CB) [> 4.0929 = 6.8216 < 8.8680] w=0.5656 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)T177.CB) [> 3.8344 = 6.3906 < 8.3078] w=0.5613 to align # Constraint # added constraint: constraint((T0292)V8.CB, (T0292)W34.CB) [> 4.1963 = 6.9938 < 9.0920] w=0.5561 to align # Constraint # added constraint: constraint((T0292)T215.CB, (T0292)K225.CB) [> 4.4333 = 7.3888 < 9.6054] w=0.5482 to align # Constraint # added constraint: constraint((T0292)K35.CB, (T0292)V83.CB) [> 4.6866 = 7.8110 < 10.1543] w=0.5439 to align # Constraint # added constraint: constraint((T0292)D38.CB, (T0292)T79.CB) [> 3.6058 = 6.0096 < 7.8125] w=0.5424 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)S199.CB) [> 4.6356 = 7.7260 < 10.0438] w=0.5421 to align # Constraint # added constraint: constraint((T0292)L160.CB, (T0292)G176.CA) [> 3.5558 = 5.9263 < 7.7042] w=0.5309 to align # Constraint # added constraint: constraint((T0292)F110.CB, (T0292)L207.CB) [> 4.6126 = 7.6877 < 9.9939] w=0.5309 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)G176.CA) [> 3.0360 = 5.0600 < 6.5780] w=0.5248 to align # Constraint # added constraint: constraint((T0292)R25.CB, (T0292)V83.CB) [> 4.4586 = 7.4310 < 9.6604] w=0.5248 to align # Constraint # added constraint: constraint((T0292)I234.CB, (T0292)N243.CB) [> 3.3899 = 5.6498 < 7.3447] w=0.5187 to align # Constraint # added constraint: constraint((T0292)R227.CB, (T0292)L252.CB) [> 4.5016 = 7.5027 < 9.7535] w=0.5187 to align # Constraint # added constraint: constraint((T0292)G229.CA, (T0292)L252.CB) [> 3.6442 = 6.0737 < 7.8958] w=0.5187 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)G176.CA) [> 3.6149 = 6.0248 < 7.8323] w=0.5126 to align # Constraint # added constraint: constraint((T0292)A93.CB, (T0292)V145.CB) [> 4.6639 = 7.7732 < 10.1052] w=0.5126 to align # Constraint # added constraint: constraint((T0292)L57.CB, (T0292)V66.CB) [> 4.3928 = 7.3214 < 9.5178] w=0.5108 to align # Constraint # added constraint: constraint((T0292)V135.CB, (T0292)F158.CB) [> 4.2898 = 7.1497 < 9.2945] w=0.5056 to align # Constraint # added constraint: constraint((T0292)P63.CB, (T0292)K154.CB) [> 4.6382 = 7.7302 < 10.0493] w=0.5056 to align # Constraint # added constraint: constraint((T0292)A209.CB, (T0292)I234.CB) [> 4.0440 = 6.7399 < 8.7619] w=0.5030 to align # Constraint # added constraint: constraint((T0292)A209.CB, (T0292)Y238.CB) [> 4.3282 = 7.2137 < 9.3778] w=0.5005 to align # Constraint # added constraint: constraint((T0292)M49.CB, (T0292)G159.CA) [> 3.3759 = 5.6266 < 7.3145] w=0.4944 to align # Constraint # added constraint: constraint((T0292)L92.CB, (T0292)L203.CB) [> 4.4576 = 7.4293 < 9.6581] w=0.4874 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)L164.CB) [> 3.4365 = 5.7274 < 7.4457] w=0.4822 to align # Constraint # added constraint: constraint((T0292)P142.CB, (T0292)L207.CB) [> 4.4672 = 7.4454 < 9.6790] w=0.4762 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)I226.CB) [> 4.5770 = 7.6283 < 9.9167] w=0.4761 to align # Constraint # added constraint: constraint((T0292)G201.CA, (T0292)I245.CB) [> 4.6002 = 7.6669 < 9.9670] w=0.4743 to align # Constraint # added constraint: constraint((T0292)L57.CB, (T0292)R67.CB) [> 4.4635 = 7.4392 < 9.6709] w=0.4743 to align # Constraint # added constraint: constraint((T0292)P213.CB, (T0292)F231.CB) [> 2.7346 = 4.5576 < 5.9249] w=0.4579 to align # Constraint # added constraint: constraint((T0292)Y39.CB, (T0292)T79.CB) [> 3.8998 = 6.4996 < 8.4495] w=0.4573 to align # Constraint # added constraint: constraint((T0292)A143.CB, (T0292)D157.CB) [> 4.6957 = 7.8262 < 10.1741] w=0.4561 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)C202.CB) [> 4.5515 = 7.5859 < 9.8616] w=0.4561 to align # Constraint # added constraint: constraint((T0292)V54.CB, (T0292)L80.CB) [> 4.4548 = 7.4246 < 9.6520] w=0.4527 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)Y191.CB) [> 4.1738 = 6.9564 < 9.0433] w=0.4500 to align # Constraint # added constraint: constraint((T0292)P178.CB, (T0292)A223.CB) [> 3.8682 = 6.4470 < 8.3811] w=0.4457 to align # Constraint # added constraint: constraint((T0292)Y39.CB, (T0292)T78.CB) [> 3.5014 = 5.8357 < 7.5864] w=0.4451 to align # Constraint # added constraint: constraint((T0292)C87.CB, (T0292)G149.CA) [> 4.4468 = 7.4113 < 9.6347] w=0.4439 to align # Constraint # added constraint: constraint((T0292)L160.CB, (T0292)V175.CB) [> 3.1209 = 5.2015 < 6.7619] w=0.4397 to align # Constraint # added constraint: constraint((T0292)R248.CB, (T0292)E262.CB) [> 4.5618 = 7.6030 < 9.8839] w=0.4397 to align # Constraint # added constraint: constraint((T0292)D70.CB, (T0292)Y81.CB) [> 4.5519 = 7.5866 < 9.8625] w=0.4397 to align # Constraint # added constraint: constraint((T0292)M181.CB, (T0292)A223.CB) [> 4.3633 = 7.2722 < 9.4539] w=0.4396 to align # Constraint # added constraint: constraint((T0292)M49.CB, (T0292)L160.CB) [> 4.0847 = 6.8077 < 8.8501] w=0.4336 to align # Constraint # added constraint: constraint((T0292)Y205.CB, (T0292)F231.CB) [> 4.4552 = 7.4254 < 9.6530] w=0.4257 to align # Constraint # added constraint: constraint((T0292)V95.CB, (T0292)L106.CB) [> 4.3889 = 7.3149 < 9.5094] w=0.4205 to align # Constraint # added constraint: constraint((T0292)V135.CB, (T0292)L164.CB) [> 4.3060 = 7.1767 < 9.3297] w=0.4074 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)V175.CB) [> 3.4075 = 5.6792 < 7.3829] w=0.3849 to align # Constraint # added constraint: constraint((T0292)I234.CB, (T0292)I246.CB) [> 4.1912 = 6.9854 < 9.0810] w=0.3849 to align # Constraint # added constraint: constraint((T0292)V175.CB, (T0292)Q185.CB) [> 4.1716 = 6.9527 < 9.0385] w=0.3849 to align # Constraint # added constraint: constraint((T0292)P63.CB, (T0292)A121.CB) [> 4.6727 = 7.7879 < 10.1242] w=0.3840 to align # Constraint # added constraint: constraint((T0292)E36.CB, (T0292)I82.CB) [> 4.6959 = 7.8265 < 10.1744] w=0.3831 to align # Constraint # added constraint: constraint((T0292)A3.CB, (T0292)Y81.CB) [> 4.0776 = 6.7960 < 8.8348] w=0.3667 to align # Constraint # added constraint: constraint((T0292)C208.CB, (T0292)I246.CB) [> 4.5362 = 7.5604 < 9.8285] w=0.3649 to align # Constraint # added constraint: constraint((T0292)Y68.CB, (T0292)E85.CB) [> 4.5985 = 7.6641 < 9.9634] w=0.3597 to align # Constraint # added constraint: constraint((T0292)G176.CA, (T0292)Q185.CB) [> 4.4999 = 7.4999 < 9.7499] w=0.3485 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)V175.CB) [> 4.3762 = 7.2936 < 9.4817] w=0.3485 to align # Constraint # added constraint: constraint((T0292)D139.CB, (T0292)F158.CB) [> 4.5132 = 7.5220 < 9.7786] w=0.3466 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)Q185.CB) [> 4.4295 = 7.3825 < 9.5973] w=0.3414 to align # Constraint # added constraint: constraint((T0292)R25.CB, (T0292)Y69.CB) [> 4.4385 = 7.3975 < 9.6167] w=0.3405 to align # Constraint # added constraint: constraint((T0292)A3.CB, (T0292)I72.CB) [> 3.8664 = 6.4440 < 8.3772] w=0.3363 to align # Constraint # added constraint: constraint((T0292)L32.CB, (T0292)D70.CB) [> 4.6622 = 7.7704 < 10.1015] w=0.3302 to align # Constraint # added constraint: constraint((T0292)G201.CA, (T0292)P213.CB) [> 4.6376 = 7.7293 < 10.0481] w=0.3284 to align # Constraint # added constraint: constraint((T0292)F174.CB, (T0292)Q185.CB) [> 3.6342 = 6.0570 < 7.8741] w=0.3284 to align # Constraint # added constraint: constraint((T0292)L9.CB, (T0292)I31.CB) [> 4.5427 = 7.5713 < 9.8426] w=0.3232 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)I163.CB) [> 4.5830 = 7.6383 < 9.9297] w=0.3223 to align # Constraint # added constraint: constraint((T0292)L56.CB, (T0292)G159.CA) [> 4.2582 = 7.0970 < 9.2261] w=0.3223 to align # Constraint # added constraint: constraint((T0292)Y105.CB, (T0292)L210.CB) [> 2.8826 = 4.8043 < 6.2456] w=0.3195 to align # Constraint # added constraint: constraint((T0292)F110.CB, (T0292)Q151.CB) [> 4.0765 = 6.7941 < 8.8324] w=0.3110 to align # Constraint # added constraint: constraint((T0292)H126.CB, (T0292)E261.CB) [> 4.6843 = 7.8071 < 10.1492] w=0.3049 to align # Constraint # added constraint: constraint((T0292)P183.CB, (T0292)A223.CB) [> 4.0120 = 6.6867 < 8.6927] w=0.3049 to align # Constraint # added constraint: constraint((T0292)L136.CB, (T0292)A171.CB) [> 4.2904 = 7.1506 < 9.2958] w=0.2998 to align # Constraint # added constraint: constraint((T0292)I245.CB, (T0292)P267.CB) [> 4.6365 = 7.7276 < 10.0459] w=0.2937 to align # Constraint # added constraint: constraint((T0292)V114.CB, (T0292)L147.CB) [> 4.5111 = 7.5185 < 9.7741] w=0.2928 to align # Constraint # added constraint: constraint((T0292)L200.CB, (T0292)V260.CB) [> 4.5837 = 7.6394 < 9.9313] w=0.2919 to align # Constraint # added constraint: constraint((T0292)F231.CB, (T0292)T247.CB) [> 4.1464 = 6.9107 < 8.9839] w=0.2876 to align # Constraint # added constraint: constraint((T0292)R113.CB, (T0292)V153.CB) [> 4.5637 = 7.6062 < 9.8880] w=0.2867 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)K35.CB) [> 4.2416 = 7.0694 < 9.1902] w=0.2867 to align # Constraint # added constraint: constraint((T0292)I72.CB, (T0292)I82.CB) [> 4.6883 = 7.8137 < 10.1579] w=0.2806 to align # Constraint # added constraint: constraint((T0292)M186.CB, (T0292)L222.CB) [> 3.9011 = 6.5018 < 8.4523] w=0.2806 to align # Constraint # added constraint: constraint((T0292)V33.CB, (T0292)V66.CB) [> 4.6346 = 7.7244 < 10.0417] w=0.2737 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)L50.CB) [> 4.3418 = 7.2363 < 9.4072] w=0.2694 to align # Constraint # added constraint: constraint((T0292)N187.CB, (T0292)A223.CB) [> 4.4002 = 7.3337 < 9.5338] w=0.2624 to align # Constraint # added constraint: constraint((T0292)I31.CB, (T0292)E88.CB) [> 4.2543 = 7.0904 < 9.2175] w=0.2554 to align # Constraint # added constraint: constraint((T0292)C20.CB, (T0292)M84.CB) [> 4.6398 = 7.7330 < 10.0529] w=0.2554 to align # Constraint # added constraint: constraint((T0292)M84.CB, (T0292)G156.CA) [> 4.5729 = 7.6215 < 9.9080] w=0.2520 to align # Constraint # added constraint: constraint((T0292)Q21.CB, (T0292)K35.CB) [> 4.6316 = 7.7194 < 10.0352] w=0.2502 to align # Constraint # added constraint: constraint((T0292)K30.CB, (T0292)Y86.CB) [> 4.5069 = 7.5115 < 9.7650] w=0.2493 to align # Constraint # added constraint: constraint((T0292)E36.CB, (T0292)N77.CB) [> 3.4642 = 5.7737 < 7.5058] w=0.2482 to align # Constraint # added constraint: constraint((T0292)V8.CB, (T0292)R24.CB) [> 3.3531 = 5.5885 < 7.2650] w=0.2432 to align # Constraint # added constraint: constraint((T0292)I23.CB, (T0292)Y86.CB) [> 4.7112 = 7.8519 < 10.2075] w=0.2372 to align # Constraint # added constraint: constraint((T0292)E53.CB, (T0292)D157.CB) [> 4.5613 = 7.6022 < 9.8828] w=0.2372 to align # Constraint # added constraint: constraint((T0292)Y205.CB, (T0292)I234.CB) [> 4.1609 = 6.9347 < 9.0152] w=0.2354 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)D157.CB) [> 4.3614 = 7.2691 < 9.4498] w=0.2320 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)F158.CB) [> 4.0689 = 6.7815 < 8.8159] w=0.2319 to align # Constraint # added constraint: constraint((T0292)V66.CB, (T0292)D157.CB) [> 4.4682 = 7.4470 < 9.6811] w=0.2319 to align # Constraint # added constraint: constraint((T0292)K30.CB, (T0292)Y69.CB) [> 4.5073 = 7.5121 < 9.7658] w=0.2311 to align # Constraint # added constraint: constraint((T0292)V114.CB, (T0292)Q151.CB) [> 4.1253 = 6.8755 < 8.9381] w=0.2311 to align # Constraint # added constraint: constraint((T0292)Y10.CB, (T0292)I23.CB) [> 4.5268 = 7.5447 < 9.8082] w=0.2189 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)G159.CA) [> 3.9156 = 6.5259 < 8.4837] w=0.2137 to align # Constraint # added constraint: constraint((T0292)T134.CB, (T0292)I163.CB) [> 3.5699 = 5.9499 < 7.7348] w=0.2134 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)S199.CB) [> 4.6700 = 7.7833 < 10.1183] w=0.2007 to align # Constraint # added constraint: constraint((T0292)F174.CB, (T0292)M186.CB) [> 4.3127 = 7.1878 < 9.3441] w=0.2007 to align # Constraint # added constraint: constraint((T0292)L57.CB, (T0292)M84.CB) [> 4.5049 = 7.5082 < 9.7606] w=0.2007 to align # Constraint # added constraint: constraint((T0292)V51.CB, (T0292)L80.CB) [> 4.4317 = 7.3862 < 9.6020] w=0.1929 to align # Constraint # added constraint: constraint((T0292)L140.CB, (T0292)C202.CB) [> 4.6069 = 7.6783 < 9.9817] w=0.1843 to align # Constraint # added constraint: constraint((T0292)Y105.CB, (T0292)A209.CB) [> 3.7357 = 6.2261 < 8.0939] w=0.1830 to align # Constraint # added constraint: constraint((T0292)T134.CB, (T0292)L164.CB) [> 3.1920 = 5.3200 < 6.9161] w=0.1830 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)E206.CB) [> 4.5638 = 7.6063 < 9.8882] w=0.1824 to align # Constraint # added constraint: constraint((T0292)M115.CB, (T0292)I263.CB) [> 4.4143 = 7.3572 < 9.5644] w=0.1824 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)G159.CA) [> 4.1465 = 6.9108 < 8.9841] w=0.1824 to align # Constraint # added constraint: constraint((T0292)C87.CB, (T0292)N152.CB) [> 4.5560 = 7.5934 < 9.8714] w=0.1824 to align # Constraint # added constraint: constraint((T0292)A143.CB, (T0292)T177.CB) [> 4.6691 = 7.7818 < 10.1163] w=0.1703 to align # Constraint # added constraint: constraint((T0292)P178.CB, (T0292)I226.CB) [> 4.3310 = 7.2183 < 9.3838] w=0.1702 to align # Constraint # added constraint: constraint((T0292)L50.CB, (T0292)I82.CB) [> 4.2562 = 7.0937 < 9.2218] w=0.1702 to align # Constraint # added constraint: constraint((T0292)Y179.CB, (T0292)E206.CB) [> 4.6109 = 7.6848 < 9.9902] w=0.1660 to align # Constraint # added constraint: constraint((T0292)P183.CB, (T0292)D254.CB) [> 4.6876 = 7.8126 < 10.1564] w=0.1642 to align # Constraint # added constraint: constraint((T0292)T97.CB, (T0292)L210.CB) [> 3.6859 = 6.1432 < 7.9861] w=0.1642 to align # Constraint # added constraint: constraint((T0292)V135.CB, (T0292)G159.CA) [> 3.4843 = 5.8072 < 7.5493] w=0.1590 to align # Constraint # added constraint: constraint((T0292)Y205.CB, (T0292)P235.CB) [> 3.8703 = 6.4505 < 8.3856] w=0.1564 to align # Constraint # added constraint: constraint((T0292)M189.CB, (T0292)D254.CB) [> 4.6602 = 7.7670 < 10.0971] w=0.1564 to align # Constraint # added constraint: constraint((T0292)N55.CB, (T0292)I163.CB) [> 4.4141 = 7.3569 < 9.5640] w=0.1460 to align # Constraint # added constraint: constraint((T0292)L112.CB, (T0292)L270.CB) [> 4.2275 = 7.0458 < 9.1596] w=0.1460 to align # Constraint # added constraint: constraint((T0292)H137.CB, (T0292)G156.CA) [> 4.6761 = 7.7936 < 10.1316] w=0.1459 to align # Constraint # added constraint: constraint((T0292)K30.CB, (T0292)E85.CB) [> 4.1860 = 6.9766 < 9.0696] w=0.1459 to align # Constraint # added constraint: constraint((T0292)K141.CB, (T0292)G176.CA) [> 4.3876 = 7.3126 < 9.5064] w=0.1459 to align # Constraint # added constraint: constraint((T0292)I12.CB, (T0292)Y86.CB) [> 4.6833 = 7.8055 < 10.1472] w=0.1459 to align # Constraint # added constraint: constraint((T0292)Y39.CB, (T0292)I73.CB) [> 4.2964 = 7.1607 < 9.3089] w=0.1405 to align # Constraint # added constraint: constraint((T0292)A209.CB, (T0292)R237.CB) [> 3.4677 = 5.7795 < 7.5133] w=0.1364 to align # Constraint # added constraint: constraint((T0292)T134.CB, (T0292)N165.CB) [> 3.3335 = 5.5558 < 7.2226] w=0.1344 to align # Constraint # added constraint: constraint((T0292)V51.CB, (T0292)R71.CB) [> 4.1860 = 6.9766 < 9.0696] w=0.1321 to align # Constraint # added constraint: constraint((T0292)R19.CB, (T0292)L37.CB) [> 4.5955 = 7.6592 < 9.9569] w=0.1277 to align # Constraint # added constraint: constraint((T0292)I31.CB, (T0292)E85.CB) [> 4.5410 = 7.5684 < 9.8389] w=0.1277 to align # Constraint # added constraint: constraint((T0292)P142.CB, (T0292)Y180.CB) [> 4.6713 = 7.7855 < 10.1212] w=0.1277 to align # Constraint # added constraint: constraint((T0292)I197.CB, (T0292)D254.CB) [> 4.6239 = 7.7066 < 10.0185] w=0.1095 to align # Constraint # added constraint: constraint((T0292)N144.CB, (T0292)F158.CB) [> 4.3894 = 7.3157 < 9.5104] w=0.1095 to align # Constraint # added constraint: constraint((T0292)G15.CA, (T0292)A143.CB) [> 4.3180 = 7.1967 < 9.3557] w=0.1043 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)D157.CB) [> 3.9797 = 6.6328 < 8.6226] w=0.1043 to align # Constraint # added constraint: constraint((T0292)A173.CB, (T0292)R188.CB) [> 3.7372 = 6.2287 < 8.0973] w=0.1034 to align # Constraint # added constraint: constraint((T0292)P178.CB, (T0292)F214.CB) [> 4.5346 = 7.5576 < 9.8249] w=0.1033 to align # Constraint # added constraint: constraint((T0292)G89.CA, (T0292)K150.CB) [> 3.9549 = 6.5914 < 8.5689] w=0.1033 to align # Constraint # added constraint: constraint((T0292)P213.CB, (T0292)I226.CB) [> 4.4399 = 7.3998 < 9.6198] w=0.0973 to align # Constraint # added constraint: constraint((T0292)C208.CB, (T0292)S239.CB) [> 4.1813 = 6.9688 < 9.0595] w=0.0973 to align # Constraint # added constraint: constraint((T0292)P235.CB, (T0292)I246.CB) [> 4.1543 = 6.9238 < 9.0010] w=0.0956 to align # Constraint # added constraint: constraint((T0292)Y6.CB, (T0292)Y81.CB) [> 4.4662 = 7.4437 < 9.6768] w=0.0912 to align # Constraint # added constraint: constraint((T0292)Q185.CB, (T0292)W198.CB) [> 4.6880 = 7.8133 < 10.1573] w=0.0912 to align # Constraint # added constraint: constraint((T0292)Y68.CB, (T0292)F158.CB) [> 4.5800 = 7.6334 < 9.9234] w=0.0912 to align # Constraint # added constraint: constraint((T0292)R138.CB, (T0292)F174.CB) [> 3.8142 = 6.3571 < 8.2642] w=0.0912 to align # Constraint # added constraint: constraint((T0292)L160.CB, (T0292)F174.CB) [> 3.7583 = 6.2639 < 8.1431] w=0.0912 to align # Constraint # added constraint: constraint((T0292)S16.CB, (T0292)D157.CB) [> 3.8966 = 6.4943 < 8.4425] w=0.0860 to align # Constraint # added constraint: constraint((T0292)P178.CB, (T0292)T215.CB) [> 4.5545 = 7.5908 < 9.8681] w=0.0851 to align # Constraint # added constraint: constraint((T0292)F174.CB, (T0292)Y191.CB) [> 3.9161 = 6.5269 < 8.4850] w=0.0730 to align # Constraint # added constraint: constraint((T0292)Y205.CB, (T0292)Y238.CB) [> 4.4983 = 7.4971 < 9.7463] w=0.0730 to align # Constraint # added constraint: constraint((T0292)L37.CB, (T0292)L160.CB) [> 4.4868 = 7.4780 < 9.7214] w=0.0730 to align # Constraint # added constraint: constraint((T0292)G15.CA, (T0292)F170.CB) [> 4.0731 = 6.7886 < 8.8251] w=0.0678 to align # Constraint # added constraint: constraint((T0292)V54.CB, (T0292)I163.CB) [> 3.0708 = 5.1181 < 6.6535] w=0.0678 to align # Constraint # added constraint: constraint((T0292)F174.CB, (T0292)R188.CB) [> 4.1903 = 6.9838 < 9.0790] w=0.0669 to align # Constraint # added constraint: constraint((T0292)L160.CB, (T0292)A173.CB) [> 4.3360 = 7.2267 < 9.3948] w=0.0669 to align # Constraint # added constraint: constraint((T0292)G18.CA, (T0292)F170.CB) [> 4.3313 = 7.2189 < 9.3846] w=0.0617 to align # Constraint # added constraint: constraint((T0292)E53.CB, (T0292)Y68.CB) [> 4.3770 = 7.2951 < 9.4836] w=0.0608 to align # Constraint # added constraint: constraint((T0292)G18.CA, (T0292)A171.CB) [> 2.8570 = 4.7617 < 6.1902] w=0.0556 to align # Constraint # added constraint: constraint((T0292)G15.CA, (T0292)D157.CB) [> 3.8723 = 6.4539 < 8.3900] w=0.0547 to align # Constraint # added constraint: constraint((T0292)K61.CB, (T0292)E124.CB) [> 4.4759 = 7.4598 < 9.6977] w=0.0547 to align # Constraint # added constraint: constraint((T0292)C208.CB, (T0292)N243.CB) [> 4.6884 = 7.8140 < 10.1582] w=0.0547 to align # Constraint # added constraint: constraint((T0292)W34.CB, (T0292)I72.CB) [> 4.7006 = 7.8343 < 10.1846] w=0.0547 to align # Constraint # added constraint: constraint((T0292)G40.CA, (T0292)L80.CB) [> 3.8910 = 6.4849 < 8.4304] w=0.0547 to align # Constraint # added constraint: constraint((T0292)L210.CB, (T0292)I234.CB) [> 4.2969 = 7.1614 < 9.3098] w=0.0547 to align # Constraint # added constraint: constraint((T0292)V175.CB, (T0292)M186.CB) [> 4.3843 = 7.3071 < 9.4992] w=0.0547 to align # Constraint # added constraint: constraint((T0292)G15.CA, (T0292)A171.CB) [> 4.5368 = 7.5613 < 9.8298] w=0.0495 to align # Constraint # added constraint: constraint((T0292)S16.CB, (T0292)A161.CB) [> 3.7732 = 6.2887 < 8.1754] w=0.0495 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)A161.CB) [> 4.2852 = 7.1419 < 9.2845] w=0.0486 to align # Constraint # added constraint: constraint((T0292)H166.CB, (T0292)G176.CA) [> 4.7002 = 7.8336 < 10.1837] w=0.0374 to align # Constraint # added constraint: constraint((T0292)I96.CB, (T0292)V114.CB) [> 4.7660 = 7.9434 < 10.3264] w=0.0365 to align # Constraint # added constraint: constraint((T0292)T134.CB, (T0292)H166.CB) [> 3.6140 = 6.0234 < 7.8304] w=0.0365 to align # Constraint # added constraint: constraint((T0292)I65.CB, (T0292)D157.CB) [> 4.7605 = 7.9342 < 10.3144] w=0.0365 to align # Constraint # added constraint: constraint((T0292)V95.CB, (T0292)F110.CB) [> 4.6335 = 7.7225 < 10.0393] w=0.0365 to align # Constraint # added constraint: constraint((T0292)N144.CB, (T0292)L160.CB) [> 4.5081 = 7.5135 < 9.7675] w=0.0365 to align # Constraint # added constraint: constraint((T0292)G176.CA, (T0292)S199.CB) [> 4.3549 = 7.2581 < 9.4355] w=0.0365 to align # Constraint # added constraint: constraint((T0292)P142.CB, (T0292)P212.CB) [> 4.5349 = 7.5581 < 9.8255] w=0.0365 to align # Constraint # added constraint: constraint((T0292)V114.CB, (T0292)L204.CB) [> 4.5550 = 7.5917 < 9.8692] w=0.0365 to align # Constraint # added constraint: constraint((T0292)L50.CB, (T0292)Y81.CB) [> 4.6684 = 7.7807 < 10.1149] w=0.0365 to align # Constraint # added constraint: constraint((T0292)A121.CB, (T0292)V145.CB) [> 4.6556 = 7.7593 < 10.0872] w=0.0365 to align # Constraint # added constraint: constraint((T0292)Y180.CB, (T0292)E206.CB) [> 4.5883 = 7.6472 < 9.9414] w=0.0365 to align # Constraint # added constraint: constraint((T0292)S190.CB, (T0292)D254.CB) [> 4.6476 = 7.7461 < 10.0699] w=0.0365 to align # Constraint # added constraint: constraint((T0292)G15.CA, (T0292)G159.CA) [> 3.8726 = 6.4544 < 8.3907] w=0.0365 to align # Constraint # added constraint: constraint((T0292)E206.CB, (T0292)A223.CB) [> 4.7577 = 7.9295 < 10.3084] w=0.0365 to align # Constraint # added constraint: constraint((T0292)C20.CB, (T0292)L160.CB) [> 4.2574 = 7.0956 < 9.2243] w=0.0365 to align # Constraint # added constraint: constraint((T0292)N144.CB, (T0292)G159.CA) [> 4.6398 = 7.7330 < 10.0530] w=0.0365 to align # Constraint # added constraint: constraint((T0292)F170.CB, (T0292)N187.CB) [> 3.4908 = 5.8180 < 7.5634] w=0.0365 to align # Constraint # added constraint: constraint((T0292)L60.CB, (T0292)G159.CA) [> 4.5596 = 7.5994 < 9.8792] w=0.0365 to align # Constraint # added constraint: constraint((T0292)S16.CB, (T0292)N144.CB) [> 4.0017 = 6.6695 < 8.6704] w=0.0313 to align # Constraint # added constraint: constraint((T0292)R19.CB, (T0292)A171.CB) [> 4.4131 = 7.3552 < 9.5617] w=0.0313 to align # Constraint # added constraint: constraint((T0292)G15.CA, (T0292)F174.CB) [> 4.6293 = 7.7155 < 10.0301] w=0.0313 to align # Constraint # added constraint: constraint((T0292)P142.CB, (T0292)L210.CB) [> 3.7852 = 6.3086 < 8.2012] w=0.0304 to align # Constraint # added constraint: constraint((T0292)A171.CB, (T0292)M181.CB) [> 4.6884 = 7.8141 < 10.1583] w=0.0304 to align # Constraint # added constraint: constraint((T0292)R25.CB, (T0292)W34.CB) [> 4.7009 = 7.8348 < 10.1852] w=0.0243 to align # Constraint # added constraint: constraint((T0292)I96.CB, (T0292)M211.CB) [> 3.9267 = 6.5444 < 8.5077] w=0.0243 to align # Constraint # added constraint: constraint((T0292)A3.CB, (T0292)R75.CB) [> 3.8986 = 6.4977 < 8.4470] w=0.0243 to align # Constraint # added constraint: constraint((T0292)K35.CB, (T0292)G159.CA) [> 4.2256 = 7.0427 < 9.1555] w=0.0182 to align # Constraint # added constraint: constraint((T0292)G13.CA, (T0292)R162.CB) [> 4.5946 = 7.6576 < 9.9549] w=0.0182 to align # Constraint # added constraint: constraint((T0292)S27.CB, (T0292)Y69.CB) [> 4.6804 = 7.8007 < 10.1409] w=0.0182 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)G156.CA) [> 4.4475 = 7.4125 < 9.6362] w=0.0182 to align # Constraint # added constraint: constraint((T0292)S16.CB, (T0292)G156.CA) [> 3.4469 = 5.7448 < 7.4682] w=0.0182 to align # Constraint # added constraint: constraint((T0292)S16.CB, (T0292)F146.CB) [> 3.6021 = 6.0034 < 7.8044] w=0.0182 to align # Constraint # added constraint: constraint((T0292)V8.CB, (T0292)C20.CB) [> 4.7250 = 7.8750 < 10.2375] w=0.0182 to align # Constraint # added constraint: constraint((T0292)E7.CB, (T0292)C20.CB) [> 4.3752 = 7.2919 < 9.4795] w=0.0182 to align # Constraint # added constraint: constraint((T0292)Y6.CB, (T0292)C20.CB) [> 3.3290 = 5.5483 < 7.2129] w=0.0182 to align # Constraint # added constraint: constraint((T0292)D5.CB, (T0292)Q21.CB) [> 3.9279 = 6.5465 < 8.5105] w=0.0182 to align # Constraint # added constraint: constraint((T0292)Y68.CB, (T0292)G159.CA) [> 4.7209 = 7.8682 < 10.2287] w=0.0182 to align # Constraint # added constraint: constraint((T0292)T177.CB, (T0292)S199.CB) [> 4.7903 = 7.9839 < 10.3791] w=0.0182 to align # Constraint # added constraint: constraint((T0292)F146.CB, (T0292)L160.CB) [> 4.5015 = 7.5025 < 9.7533] w=0.0182 to align # Constraint # added constraint: constraint((T0292)N144.CB, (T0292)A161.CB) [> 3.5915 = 5.9858 < 7.7816] w=0.0182 to align # Constraint # added constraint: constraint((T0292)C125.CB, (T0292)T134.CB) [> 4.1332 = 6.8887 < 8.9554] w=0.0182 to align # Constraint # added constraint: constraint((T0292)A143.CB, (T0292)V175.CB) [> 4.5173 = 7.5289 < 9.7875] w=0.0182 to align # Constraint # added constraint: constraint((T0292)V95.CB, (T0292)L210.CB) [> 4.6986 = 7.8310 < 10.1803] w=0.0182 to align # Constraint # added constraint: constraint((T0292)Y180.CB, (T0292)G201.CA) [> 4.7405 = 7.9009 < 10.2712] w=0.0182 to align # Constraint # added constraint: constraint((T0292)C20.CB, (T0292)I163.CB) [> 4.6378 = 7.7296 < 10.0485] w=0.0182 to align # Constraint # added constraint: constraint((T0292)M84.CB, (T0292)A161.CB) [> 3.8925 = 6.4875 < 8.4337] w=0.0182 to align # Constraint # added constraint: constraint((T0292)T177.CB, (T0292)F214.CB) [> 3.1067 = 5.1778 < 6.7312] w=0.0182 to align # Constraint # added constraint: constraint((T0292)R2.CB, (T0292)Y81.CB) [> 3.5147 = 5.8579 < 7.6153] w=0.0182 to align # Constraint # added constraint: constraint((T0292)G201.CA, (T0292)I263.CB) [> 4.7504 = 7.9173 < 10.2924] w=0.0182 to align # Constraint # added constraint: constraint((T0292)L60.CB, (T0292)L160.CB) [> 4.4538 = 7.4231 < 9.6500] w=0.0182 to align # Constraint # added constraint: constraint((T0292)V135.CB, (T0292)L160.CB) [> 3.7520 = 6.2533 < 8.1293] w=0.0182 to align # Constraint # added constraint: constraint((T0292)I12.CB, (T0292)A143.CB) [> 4.2508 = 7.0847 < 9.2100] w=0.0182 to align # Constraint # added constraint: constraint((T0292)T119.CB, (T0292)I197.CB) [> 4.7459 = 7.9099 < 10.2828] w=0.0182 to align # Constraint # added constraint: constraint((T0292)M181.CB, (T0292)C202.CB) [> 4.6712 = 7.7854 < 10.1210] w=0.0182 to align # Constraint # added constraint: constraint((T0292)S182.CB, (T0292)C202.CB) [> 4.7018 = 7.8363 < 10.1872] w=0.0182 to align # Constraint # added constraint: constraint((T0292)Q185.CB, (T0292)S199.CB) [> 4.7106 = 7.8510 < 10.2063] w=0.0182 to align # Constraint # added constraint: constraint((T0292)Y205.CB, (T0292)L242.CB) [> 4.1434 = 6.9056 < 8.9773] w=0.0182 to align # Constraint # added constraint: constraint((T0292)G13.CA, (T0292)F158.CB) [> 4.3140 = 7.1900 < 9.3470] w=0.0182 to align # Constraint # added constraint: constraint((T0292)L106.CB, (T0292)A209.CB) [> 4.4524 = 7.4206 < 9.6468] w=0.0182 to align # Constraint # added constraint: constraint((T0292)A209.CB, (T0292)L222.CB) [> 4.2556 = 7.0927 < 9.2205] w=0.0182 to align # Constraint # added constraint: constraint((T0292)Y17.CB, (T0292)F174.CB) [> 4.1134 = 6.8557 < 8.9125] w=0.0182 to align # Constraint # added constraint: constraint((T0292)G13.CA, (T0292)L160.CB) [> 4.1570 = 6.9283 < 9.0068] w=0.0182 to align # Constraint # added constraint: constraint((T0292)R19.CB, (T0292)L160.CB) [> 4.5519 = 7.5866 < 9.8625] w=0.0182 to align # Constraint # added constraint: constraint((T0292)G15.CA, (T0292)N144.CB) [> 4.6330 = 7.7217 < 10.0383] w=0.0131 to align # Constraint # added constraint: constraint((T0292)G132.CA, (T0292)E193.CB) [> 4.2589 = 7.0982 < 9.2277] w=0.0122 to align # Constraint # added constraint: constraint((T0292)V175.CB, (T0292)P213.CB) [> 4.5783 = 7.6306 < 9.9197] w=0.0122 to align # Constraint # added constraint: constraint((T0292)Y86.CB, (T0292)G149.CA) [> 4.4564 = 7.4273 < 9.6555] w=0.0122 to align # Constraint # added constraint: constraint((T0292)D196.CB, (T0292)S259.CB) [> 4.6147 = 7.6912 < 9.9986] w=0.0061 to align # Constraint # added constraint: constraint((T0292)L164.CB, (T0292)T177.CB) [> 4.6413 = 7.7355 < 10.0562] w=0.0061 to align # Constraint # added constraint: constraint((T0292)L164.CB, (T0292)P178.CB) [> 2.6556 = 4.4260 < 5.7538] w=0.0061 to align # Constraint # added constraint: constraint((T0292)K172.CB, (T0292)M181.CB) [> 3.9256 = 6.5427 < 8.5056] w=0.0061 to align # Constraint # added constraint: constraint((T0292)L50.CB, (T0292)I73.CB) [> 4.6680 = 7.7800 < 10.1140] w=0.0061 to align # Constraint # added constraint: constraint((T0292)T168.CB, (T0292)D254.CB) [> 3.0657 = 5.1094 < 6.6423] w=0.0061 to align # Constraint # added constraint: constraint((T0292)L56.CB, (T0292)T134.CB) [> 4.7532 = 7.9220 < 10.2986] w=0.0061 to align # Constraint # added constraint: constraint((T0292)M211.CB, (T0292)Y238.CB) [> 3.8677 = 6.4461 < 8.3800] w=0.0061 to align # SetCost created cost = # ( 1.0000 * align ) # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/constraints_v3/T0292/ # command:# reading script from file servers-clean.under # Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0292/decoys/ # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_POPULUS_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_POPULUS_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_RECOM_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_RECOM_TS5 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS1 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS2 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS3 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS4 # ReadConformPDB reading from PDB file servers/3D-JIGSAW_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation 3D-JIGSAW_TS5 # ReadConformPDB reading from PDB file servers/3Dpro_TS1.pdb.gz looking for model 1 # Found a chain break before 232 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS1 # ReadConformPDB reading from PDB file servers/3Dpro_TS2.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS2 # ReadConformPDB reading from PDB file servers/3Dpro_TS3.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS3 # ReadConformPDB reading from PDB file servers/3Dpro_TS4.pdb.gz looking for model 1 # Found a chain break before 152 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS4 # ReadConformPDB reading from PDB file servers/3Dpro_TS5.pdb.gz looking for model 1 # Found a chain break before 266 # copying to AlignedFragments data structure # naming current conformation 3Dpro_TS5 # ReadConformPDB reading from PDB file servers/ABIpro_TS1.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS1 # ReadConformPDB reading from PDB file servers/ABIpro_TS2.pdb.gz looking for model 1 # Found a chain break before 197 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS2 # ReadConformPDB reading from PDB file servers/ABIpro_TS3.pdb.gz looking for model 1 # Found a chain break before 266 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS3 # ReadConformPDB reading from PDB file servers/ABIpro_TS4.pdb.gz looking for model 1 # Found a chain break before 251 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS4 # ReadConformPDB reading from PDB file servers/ABIpro_TS5.pdb.gz looking for model 1 # Found a chain break before 160 # copying to AlignedFragments data structure # naming current conformation ABIpro_TS5 # ReadConformPDB reading from PDB file servers/BayesHH_TS1.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation BayesHH_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS1.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS1 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS2.pdb.gz looking for model 1 # Found a chain break before 235 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS2 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS3.pdb.gz looking for model 1 # Found a chain break before 229 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS3 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS4.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS4 # ReadConformPDB reading from PDB file servers/Bilab-ENABLE_TS5.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation Bilab-ENABLE_TS5 # ReadConformPDB reading from PDB file servers/CIRCLE_TS1.pdb.gz looking for model 1 # Found a chain break before 264 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS1 # ReadConformPDB reading from PDB file servers/CIRCLE_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS2 # ReadConformPDB reading from PDB file servers/CIRCLE_TS3.pdb.gz looking for model 1 # Found a chain break before 264 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS3 # ReadConformPDB reading from PDB file servers/CIRCLE_TS4.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation CIRCLE_TS4 # ReadConformPDB reading from PDB file servers/CIRCLE_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation CIRCLE_TS5 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS1 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS2.pdb.gz looking for model 1 # Found a chain break before 236 # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS2 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS3 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation CaspIta-FOX_TS4 # ReadConformPDB reading from PDB file servers/CaspIta-FOX_TS5.pdb.gz looking for model 1 WARNING: atoms too close: (T0292)A223.C and (T0292)G224.N only 0.000 apart, marking (T0292)G224.N as missing WARNING: atoms too close: (T0292)G224.N and (T0292)G224.CA only 0.000 apart, marking (T0292)G224.CA as missing WARNING: atoms too close: (T0292)A223.C and (T0292)G224.CA only 0.000 apart, marking (T0292)G224.CA as missing WARNING: atoms too close: (T0292)G224.CA and (T0292)G224.O only 0.000 apart, marking (T0292)G224.O as missing WARNING: atoms too close: (T0292)G224.N and (T0292)G224.O only 0.000 apart, marking (T0292)G224.O as missing WARNING: atoms too close: (T0292)A223.C and (T0292)G224.O only 0.000 apart, marking (T0292)G224.O as missing WARNING: atoms too close: (T0292)G224.O and (T0292)G224.C only 0.000 apart, marking (T0292)G224.C as missing WARNING: atoms too close: (T0292)G224.CA and (T0292)G224.C only 0.000 apart, marking (T0292)G224.C as missing WARNING: atoms too close: (T0292)G224.N and (T0292)G224.C only 0.000 apart, marking (T0292)G224.C as missing WARNING: atoms too close: (T0292)A223.C and (T0292)G224.C only 0.000 apart, marking (T0292)G224.C as missing # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation CaspIta-FOX_TS5 # ReadConformPDB reading from PDB file servers/Distill_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Distill_TS1 # ReadConformPDB reading from PDB file servers/Distill_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Distill_TS2 # ReadConformPDB reading from PDB file servers/Distill_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Distill_TS3 # ReadConformPDB reading from PDB file servers/Distill_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Distill_TS4 # ReadConformPDB reading from PDB file servers/Distill_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Distill_TS5 # ReadConformPDB reading from PDB file servers/FAMSD_TS1.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS1 # ReadConformPDB reading from PDB file servers/FAMSD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FAMSD_TS2 # ReadConformPDB reading from PDB file servers/FAMSD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FAMSD_TS3 # ReadConformPDB reading from PDB file servers/FAMSD_TS4.pdb.gz looking for model 1 # Found a chain break before 267 # copying to AlignedFragments data structure # naming current conformation FAMSD_TS4 # ReadConformPDB reading from PDB file servers/FAMSD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FAMSD_TS5 # ReadConformPDB reading from PDB file servers/FAMS_TS1.pdb.gz looking for model 1 # Found a chain break before 264 # copying to AlignedFragments data structure # naming current conformation FAMS_TS1 # ReadConformPDB reading from PDB file servers/FAMS_TS2.pdb.gz looking for model 1 # Found a chain break before 264 # copying to AlignedFragments data structure # naming current conformation FAMS_TS2 # ReadConformPDB reading from PDB file servers/FAMS_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FAMS_TS3 # ReadConformPDB reading from PDB file servers/FAMS_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FAMS_TS4 # ReadConformPDB reading from PDB file servers/FAMS_TS5.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation FAMS_TS5 # ReadConformPDB reading from PDB file servers/FOLDpro_TS1.pdb.gz looking for model 1 # Found a chain break before 232 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS1 # ReadConformPDB reading from PDB file servers/FOLDpro_TS2.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS2 # ReadConformPDB reading from PDB file servers/FOLDpro_TS3.pdb.gz looking for model 1 # Found a chain break before 203 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS3 # ReadConformPDB reading from PDB file servers/FOLDpro_TS4.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS4 # ReadConformPDB reading from PDB file servers/FOLDpro_TS5.pdb.gz looking for model 1 # Found a chain break before 235 # copying to AlignedFragments data structure # naming current conformation FOLDpro_TS5 # ReadConformPDB reading from PDB file servers/FORTE1_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE1_AL1 # ReadConformPDB reading from PDB file servers/FORTE1_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE1_AL2 # ReadConformPDB reading from PDB file servers/FORTE1_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE1_AL3 # ReadConformPDB reading from PDB file servers/FORTE1_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE1_AL4 # ReadConformPDB reading from PDB file servers/FORTE1_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE1_AL5 # ReadConformPDB reading from PDB file servers/FORTE2_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE2_AL1 # ReadConformPDB reading from PDB file servers/FORTE2_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE2_AL2 # ReadConformPDB reading from PDB file servers/FORTE2_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE2_AL3 # ReadConformPDB reading from PDB file servers/FORTE2_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE2_AL4 # ReadConformPDB reading from PDB file servers/FORTE2_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FORTE2_AL5 # ReadConformPDB reading from PDB file servers/FPSOLVER-SERVER_TS1.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation FPSOLVER-SERVER_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS1.pdb.gz looking for model 1 # Found a chain break before 208 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS1 # ReadConformPDB reading from PDB file servers/FUGMOD_TS2.pdb.gz looking for model 1 # Found a chain break before 260 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS2 # ReadConformPDB reading from PDB file servers/FUGMOD_TS3.pdb.gz looking for model 1 # Found a chain break before 163 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS3 # ReadConformPDB reading from PDB file servers/FUGMOD_TS4.pdb.gz looking for model 1 # Found a chain break before 134 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS4 # ReadConformPDB reading from PDB file servers/FUGMOD_TS5.pdb.gz looking for model 1 # Found a chain break before 259 # copying to AlignedFragments data structure # naming current conformation FUGMOD_TS5 # ReadConformPDB reading from PDB file servers/FUGUE_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUGUE_AL1 # ReadConformPDB reading from PDB file servers/FUGUE_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUGUE_AL2 # ReadConformPDB reading from PDB file servers/FUGUE_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUGUE_AL3 # ReadConformPDB reading from PDB file servers/FUGUE_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUGUE_AL4 # ReadConformPDB reading from PDB file servers/FUGUE_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUGUE_AL5 # ReadConformPDB reading from PDB file servers/FUNCTION_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS1 # ReadConformPDB reading from PDB file servers/FUNCTION_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS2 # ReadConformPDB reading from PDB file servers/FUNCTION_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS3 # ReadConformPDB reading from PDB file servers/FUNCTION_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS4 # ReadConformPDB reading from PDB file servers/FUNCTION_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation FUNCTION_TS5 # ReadConformPDB reading from PDB file servers/Frankenstein_TS1.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS1 # ReadConformPDB reading from PDB file servers/Frankenstein_TS2.pdb.gz looking for model 1 # Found a chain break before 233 # copying to AlignedFragments data structure # naming current conformation Frankenstein_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS1.pdb.gz looking for model 1 # Found a chain break before 170 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS1 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS2.pdb.gz looking for model 1 # Found a chain break before 259 # copying to AlignedFragments data structure # naming current conformation GeneSilicoMetaServer_TS2 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS3 # ReadConformPDB reading from PDB file servers/GeneSilicoMetaServer_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation GeneSilicoMetaServer_TS5 # ReadConformPDB reading from PDB file servers/HHpred1_TS1.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation HHpred1_TS1 # ReadConformPDB reading from PDB file servers/HHpred2_TS1.pdb.gz looking for model 1 # Found a chain break before 232 # copying to AlignedFragments data structure # naming current conformation HHpred2_TS1 # ReadConformPDB reading from PDB file servers/HHpred3_TS1.pdb.gz looking for model 1 # Found a chain break before 232 # copying to AlignedFragments data structure # naming current conformation HHpred3_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS1 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS2 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS3 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS4 # ReadConformPDB reading from PDB file servers/Huber-Torda-Server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Huber-Torda-Server_TS5 # ReadConformPDB reading from PDB file servers/LOOPP_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation LOOPP_TS1 # ReadConformPDB reading from PDB file servers/LOOPP_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation LOOPP_TS2 # ReadConformPDB reading from PDB file servers/LOOPP_TS3.pdb.gz looking for model 1 # Found a chain break before 173 # copying to AlignedFragments data structure # naming current conformation LOOPP_TS3 # ReadConformPDB reading from PDB file servers/LOOPP_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation LOOPP_TS4 # ReadConformPDB reading from PDB file servers/LOOPP_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation LOOPP_TS5 # ReadConformPDB reading from PDB file servers/MIG_FROST_AL1.pdb.gz looking for model 1 Error: Reading chain '' from PDB file servers/MIG_FROST_AL1.pdb.gz failed---no such chain. # naming current conformation MIG_FROST_AL1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS1.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS1 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS2.pdb.gz looking for model 1 # Found a chain break before 233 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS2 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS3.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS3 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS4.pdb.gz looking for model 1 # Found a chain break before 218 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS4 # ReadConformPDB reading from PDB file servers/Ma-OPUS-server_TS5.pdb.gz looking for model 1 # Found a chain break before 188 # copying to AlignedFragments data structure # naming current conformation Ma-OPUS-server_TS5 # ReadConformPDB reading from PDB file servers/MetaTasser_TS1.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS1 # ReadConformPDB reading from PDB file servers/MetaTasser_TS2.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS2 # ReadConformPDB reading from PDB file servers/MetaTasser_TS3.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS3 # ReadConformPDB reading from PDB file servers/MetaTasser_TS4.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS4 # ReadConformPDB reading from PDB file servers/MetaTasser_TS5.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation MetaTasser_TS5 # ReadConformPDB reading from PDB file servers/NN_PUT_lab_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation NN_PUT_lab_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS1.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS2.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS3.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS4.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO-AB_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO-AB_TS5 # ReadConformPDB reading from PDB file servers/PROTINFO_TS1.pdb.gz looking for model 1 # Found a chain break before 191 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS1 # ReadConformPDB reading from PDB file servers/PROTINFO_TS2.pdb.gz looking for model 1 # Found a chain break before 149 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS2 # ReadConformPDB reading from PDB file servers/PROTINFO_TS3.pdb.gz looking for model 1 # Found a chain break before 234 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS3 # ReadConformPDB reading from PDB file servers/PROTINFO_TS4.pdb.gz looking for model 1 # Found a chain break before 236 # copying to AlignedFragments data structure # naming current conformation PROTINFO_TS4 # ReadConformPDB reading from PDB file servers/PROTINFO_TS5.pdb.gz looking for model 1 # naming current conformation PROTINFO_TS5 # ReadConformPDB reading from PDB file servers/Pcons6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Pcons6_TS1 # ReadConformPDB reading from PDB file servers/Pcons6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Pcons6_TS2 # ReadConformPDB reading from PDB file servers/Pcons6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Pcons6_TS3 # ReadConformPDB reading from PDB file servers/Pcons6_TS4.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS4 # ReadConformPDB reading from PDB file servers/Pcons6_TS5.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation Pcons6_TS5 # ReadConformPDB reading from PDB file servers/Phyre-1_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Phyre-1_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS1 # ReadConformPDB reading from PDB file servers/Phyre-2_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS2 # ReadConformPDB reading from PDB file servers/Phyre-2_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS3 # ReadConformPDB reading from PDB file servers/Phyre-2_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS4 # ReadConformPDB reading from PDB file servers/Phyre-2_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Phyre-2_TS5 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS1 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS2 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation Pmodeller6_TS3 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS4 # ReadConformPDB reading from PDB file servers/Pmodeller6_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation Pmodeller6_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS1.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS2.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS3.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS4.pdb.gz looking for model 1 # Found a chain break before 259 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR-ACE_TS5.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation RAPTOR-ACE_TS5 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS1.pdb.gz looking for model 1 # Found a chain break before 23 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS1 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS2.pdb.gz looking for model 1 # Found a chain break before 275 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS2 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS3.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS3 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS4.pdb.gz looking for model 1 # Found a chain break before 275 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS4 # ReadConformPDB reading from PDB file servers/RAPTORESS_TS5.pdb.gz looking for model 1 # Found a chain break before 271 # copying to AlignedFragments data structure # naming current conformation RAPTORESS_TS5 # ReadConformPDB reading from PDB file servers/RAPTOR_TS1.pdb.gz looking for model 1 # Found a chain break before 236 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS1 # ReadConformPDB reading from PDB file servers/RAPTOR_TS2.pdb.gz looking for model 1 # Found a chain break before 137 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS2 # ReadConformPDB reading from PDB file servers/RAPTOR_TS3.pdb.gz looking for model 1 # Found a chain break before 179 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS3 # ReadConformPDB reading from PDB file servers/RAPTOR_TS4.pdb.gz looking for model 1 # Found a chain break before 219 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS4 # ReadConformPDB reading from PDB file servers/RAPTOR_TS5.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation RAPTOR_TS5 # ReadConformPDB reading from PDB file servers/ROBETTA_TS1.pdb.gz looking for model 1 # Found a chain break before 167 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS1 # ReadConformPDB reading from PDB file servers/ROBETTA_TS2.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS2 # ReadConformPDB reading from PDB file servers/ROBETTA_TS3.pdb.gz looking for model 1 # Found a chain break before 174 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS3 # ReadConformPDB reading from PDB file servers/ROBETTA_TS4.pdb.gz looking for model 1 # Found a chain break before 164 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS4 # ReadConformPDB reading from PDB file servers/ROBETTA_TS5.pdb.gz looking for model 1 # Found a chain break before 138 # copying to AlignedFragments data structure # naming current conformation ROBETTA_TS5 # ReadConformPDB reading from PDB file servers/ROKKY_TS1.pdb.gz looking for model 1 # Found a chain break before 146 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS1 # ReadConformPDB reading from PDB file servers/ROKKY_TS2.pdb.gz looking for model 1 # Found a chain break before 249 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS2 # ReadConformPDB reading from PDB file servers/ROKKY_TS3.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS3 # ReadConformPDB reading from PDB file servers/ROKKY_TS4.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS4 # ReadConformPDB reading from PDB file servers/ROKKY_TS5.pdb.gz looking for model 1 # Found a chain break before 258 # copying to AlignedFragments data structure # naming current conformation ROKKY_TS5 # ReadConformPDB reading from PDB file servers/SAM-T02_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL1 # ReadConformPDB reading from PDB file servers/SAM-T02_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL2 # ReadConformPDB reading from PDB file servers/SAM-T02_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL3 # ReadConformPDB reading from PDB file servers/SAM-T02_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL4 # ReadConformPDB reading from PDB file servers/SAM-T02_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T02_AL5 # ReadConformPDB reading from PDB file servers/SAM-T99_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL1 # ReadConformPDB reading from PDB file servers/SAM-T99_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL2 # ReadConformPDB reading from PDB file servers/SAM-T99_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL3 # ReadConformPDB reading from PDB file servers/SAM-T99_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL4 # ReadConformPDB reading from PDB file servers/SAM-T99_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM-T99_AL5 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS1.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation SAM_T06_server_TS1 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS2 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS3 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS4 # ReadConformPDB reading from PDB file servers/SAM_T06_server_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation SAM_T06_server_TS5 # ReadConformPDB reading from PDB file servers/SP3_TS1.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation SP3_TS1 # ReadConformPDB reading from PDB file servers/SP3_TS2.pdb.gz looking for model 1 # naming current conformation SP3_TS2 # ReadConformPDB reading from PDB file servers/SP3_TS3.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation SP3_TS3 # ReadConformPDB reading from PDB file servers/SP3_TS4.pdb.gz looking for model 1 # Found a chain break before 129 # copying to AlignedFragments data structure # naming current conformation SP3_TS4 # ReadConformPDB reading from PDB file servers/SP3_TS5.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation SP3_TS5 # ReadConformPDB reading from PDB file servers/SP4_TS1.pdb.gz looking for model 1 # naming current conformation SP4_TS1 # ReadConformPDB reading from PDB file servers/SP4_TS2.pdb.gz looking for model 1 # Found a chain break before 234 # copying to AlignedFragments data structure # naming current conformation SP4_TS2 # ReadConformPDB reading from PDB file servers/SP4_TS3.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation SP4_TS3 # ReadConformPDB reading from PDB file servers/SP4_TS4.pdb.gz looking for model 1 # Found a chain break before 236 # copying to AlignedFragments data structure # naming current conformation SP4_TS4 # ReadConformPDB reading from PDB file servers/SP4_TS5.pdb.gz looking for model 1 # Found a chain break before 188 # copying to AlignedFragments data structure # naming current conformation SP4_TS5 # ReadConformPDB reading from PDB file servers/SPARKS2_TS1.pdb.gz looking for model 1 # Found a chain break before 273 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS1 # ReadConformPDB reading from PDB file servers/SPARKS2_TS2.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS2 # ReadConformPDB reading from PDB file servers/SPARKS2_TS3.pdb.gz looking for model 1 # Found a chain break before 209 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS3 # ReadConformPDB reading from PDB file servers/SPARKS2_TS4.pdb.gz looking for model 1 # Found a chain break before 215 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS4 # ReadConformPDB reading from PDB file servers/SPARKS2_TS5.pdb.gz looking for model 1 # Found a chain break before 270 # copying to AlignedFragments data structure # naming current conformation SPARKS2_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS2 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS3 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS4 # ReadConformPDB reading from PDB file servers/UNI-EID_bnmx_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_bnmx_TS5 # ReadConformPDB reading from PDB file servers/UNI-EID_expm_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation UNI-EID_expm_TS1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL1 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL2 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL3 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL4 # ReadConformPDB reading from PDB file servers/UNI-EID_sfst_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation UNI-EID_sfst_AL5 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS1.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS1 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS2.pdb.gz looking for model 1 # Found a chain break before 274 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS2 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS3.pdb.gz looking for model 1 # Found a chain break before 228 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS3 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS4.pdb.gz looking for model 1 # Found a chain break before 272 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS4 # ReadConformPDB reading from PDB file servers/Zhang-Server_TS5.pdb.gz looking for model 1 # Found a chain break before 163 # copying to AlignedFragments data structure # naming current conformation Zhang-Server_TS5 # ReadConformPDB reading from PDB file servers/beautshot_TS1.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation beautshot_TS1 # ReadConformPDB reading from PDB file servers/beautshotbase_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation beautshotbase_TS1 # ReadConformPDB reading from PDB file servers/forecast-s_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation forecast-s_AL1 # ReadConformPDB reading from PDB file servers/forecast-s_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation forecast-s_AL2 # ReadConformPDB reading from PDB file servers/forecast-s_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation forecast-s_AL3 # ReadConformPDB reading from PDB file servers/forecast-s_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation forecast-s_AL4 # ReadConformPDB reading from PDB file servers/forecast-s_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation forecast-s_AL5 # ReadConformPDB reading from PDB file servers/gtg_AL1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation gtg_AL1 # ReadConformPDB reading from PDB file servers/gtg_AL2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation gtg_AL2 # ReadConformPDB reading from PDB file servers/gtg_AL3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation gtg_AL3 # ReadConformPDB reading from PDB file servers/gtg_AL4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation gtg_AL4 # ReadConformPDB reading from PDB file servers/gtg_AL5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation gtg_AL5 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS1.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS2.pdb.gz looking for model 1 # Found a chain break before 233 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS3.pdb.gz looking for model 1 # Found a chain break before 24 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS4.pdb.gz looking for model 1 # Found a chain break before 260 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv.2_TS5.pdb.gz looking for model 1 # Found a chain break before 221 # copying to AlignedFragments data structure # naming current conformation karypis.srv.2_TS5 # ReadConformPDB reading from PDB file servers/karypis.srv.4_TS1.pdb.gz looking for model 1 WARNING: atoms too close: (T0292)G90.O and (T0292)D91.N only 0.000 apart, marking (T0292)D91.N as missing WARNING: atoms too close: (T0292)L92.O and (T0292)A93.N only 0.000 apart, marking (T0292)A93.N as missing WARNING: atoms too close: (T0292)S199.O and (T0292)L200.N only 0.000 apart, marking (T0292)L200.N as missing # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # copying to AlignedFragments data structure # naming current conformation karypis.srv.4_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS1 # ReadConformPDB reading from PDB file servers/karypis.srv_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation karypis.srv_TS2 # ReadConformPDB reading from PDB file servers/karypis.srv_TS3.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS3 # ReadConformPDB reading from PDB file servers/karypis.srv_TS4.pdb.gz looking for model 1 # Found a chain break before 254 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS4 # ReadConformPDB reading from PDB file servers/karypis.srv_TS5.pdb.gz looking for model 1 # Found a chain break before 157 # copying to AlignedFragments data structure # naming current conformation karypis.srv_TS5 # ReadConformPDB reading from PDB file servers/keasar-server_TS1.pdb.gz looking for model 1 # Found a chain break before 185 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS1 # ReadConformPDB reading from PDB file servers/keasar-server_TS2.pdb.gz looking for model 1 # Found a chain break before 185 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS2 # ReadConformPDB reading from PDB file servers/keasar-server_TS3.pdb.gz looking for model 1 # Found a chain break before 234 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS3 # ReadConformPDB reading from PDB file servers/keasar-server_TS4.pdb.gz looking for model 1 # Found a chain break before 269 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS4 # ReadConformPDB reading from PDB file servers/keasar-server_TS5.pdb.gz looking for model 1 # Found a chain break before 135 # copying to AlignedFragments data structure # naming current conformation keasar-server_TS5 # ReadConformPDB reading from PDB file servers/mGen-3D_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation mGen-3D_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS1.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation nFOLD_TS1 # ReadConformPDB reading from PDB file servers/nFOLD_TS2.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation nFOLD_TS2 # ReadConformPDB reading from PDB file servers/nFOLD_TS3.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation nFOLD_TS3 # ReadConformPDB reading from PDB file servers/nFOLD_TS4.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation nFOLD_TS4 # ReadConformPDB reading from PDB file servers/nFOLD_TS5.pdb.gz looking for model 1 # WARNING: incomplete conformation T0292 can't currently be optimized by undertaker # naming current conformation nFOLD_TS5 # ReadConformPDB reading from PDB file servers/shub_TS1.pdb.gz looking for model 1 # Found a chain break before 276 # copying to AlignedFragments data structure # naming current conformation shub_TS1 # command:Using radius: 8.0000 Using models AND alignments for constraints model score -0.4899 model score -0.1963 model score -0.5106 model score -0.4880 model score -0.4656 model score -0.5272 model score -0.5425 model score -0.5319 model score -0.5358 model score -0.5352 model score -0.5440 model score -0.5501 model score -0.5342 model score -0.5284 model score -0.5210 model score -0.7091 model score -0.4936 model score 1.0493 model score 0.2581 model score -0.4164 model score 1.5553 model score 1.5159 model score 1.6242 model score 1.4451 model score 1.7802 model score -0.6916 model score -0.5715 model score -0.5867 model score -0.4498 model score -0.6497 model score -0.6907 model score -0.7131 model score -0.6978 model score -0.5792 model score -0.6650 model score -0.5081 model score -0.4354 model score -0.6371 model score -0.6290 model score -0.2658 model score -0.4619 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2770 model score -0.6861 model score -0.6581 model score -0.5081 model score -0.5893 model score -0.6890 model score -0.5792 model score -0.7131 model score -0.6978 model score -0.6581 model score -0.6650 model score -0.7109 model score 0.4938 model score 1.9903 model score 1.5248 model score -0.3646 model score 1.2770 model score 1.2771 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2770 model score 1.2771 model score 2.2060 model score -0.5245 model score -0.0620 model score -0.6446 model score -0.6052 model score -0.6685 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2770 model score -0.4935 model score -0.5026 model score -0.4859 model score -0.4512 model score -0.4825 model score -0.7096 model score -0.7853 model score -0.7017 model score -0.7074 model score -0.7133 model score -0.6897 model score -0.7115 model score -0.6826 model score -0.6826 model score -0.6925 model score -0.6107 model score -0.6871 model score -0.6159 model score -0.2505 model score -0.1625 model score -0.4434 model score -0.6368 model score -0.6562 model score -0.6003 model score -0.6774 model score -0.4907 model score -0.5026 model score -0.6027 model score -0.4904 model score -0.3008 model score -0.1677 model score -0.2137 model score -0.3206 model score -0.0917 model score -0.5272 model score -0.3050 model score -0.3179 model score -0.3331 model score -0.2788 model score -0.3553 model score -0.6747 model score -0.5858 model score -0.6178 model score -0.1139 model score -0.3421 model score -0.7057 model score -0.6854 model score -0.6236 model score -0.6897 model score -0.6541 model score -0.2034 model score -0.6608 model score -0.6907 model score -0.6989 model score -0.6940 model score -0.6920 model score -0.5915 model score -0.5915 model score -0.5944 model score -0.6541 model score -0.6398 model score -0.7140 model score -0.7374 model score -0.7255 model score -0.7024 model score -0.7022 model score -0.5235 model score -0.4008 model score -0.5853 model score -0.5461 model score -0.6234 model score -0.7166 model score -0.7096 model score -0.6125 model score -0.6114 model score -0.5656 model score -0.6145 model score -0.5231 model score -0.6989 model score -0.7045 model score -0.5238 model score -0.4498 model score -0.7079 model score -0.4272 model score -0.4362 model score -0.4322 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.7102 model score 0.0664 model score -0.3871 model score -0.6958 model score -0.6760 model score -0.7374 model score -0.6235 model score -0.6298 model score -0.5943 model score -0.6854 model score -0.6277 model score -0.6312 model score -0.6930 model score -0.5882 model score -0.7321 model score -0.6959 model score -0.7412 model score -0.6211 model score -0.6304 model score -0.6789 model score 1.2771 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.6213 model score 1.2771 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2771 model score -0.7165 model score -0.5743 model score -0.5249 model score -0.7139 model score -0.7471 model score -0.6581 model score -0.7337 model score 1.2770 model score 1.2771 model score 1.2770 model score 1.2770 model score 1.2771 model score 1.2771 model score 1.2771 model score 1.2770 model score 1.2770 model score 1.2771 model score -0.7295 model score -0.5126 model score 1.9912 model score 2.0867 model score 2.1233 model score 2.3735 model score -0.7289 model score -0.4728 model score -0.6011 model score -0.5822 model score -0.6313 model score -0.6708 model score -0.6520 model score -0.6267 model score -0.5594 model score -0.5559 model score -0.7257 model score -0.7366 model score -0.0729 model score -0.6360 model score -0.3997 model score -0.7241 model score -0.6322 USE_META, weight: 0.9158 cost: -0.4899 min: -0.7853 max: 2.3735 USE_META, weight: 0.8322 cost: -0.1963 min: -0.7853 max: 2.3735 USE_META, weight: 0.9217 cost: -0.5106 min: -0.7853 max: 2.3735 USE_META, weight: 0.9153 cost: -0.4880 min: -0.7853 max: 2.3735 USE_META, weight: 0.9089 cost: -0.4656 min: -0.7853 max: 2.3735 USE_META, weight: 0.9265 cost: -0.5272 min: -0.7853 max: 2.3735 USE_META, weight: 0.9308 cost: -0.5425 min: -0.7853 max: 2.3735 USE_META, weight: 0.9278 cost: -0.5319 min: -0.7853 max: 2.3735 USE_META, weight: 0.9289 cost: -0.5358 min: -0.7853 max: 2.3735 USE_META, weight: 0.9288 cost: -0.5352 min: -0.7853 max: 2.3735 USE_META, weight: 0.9313 cost: -0.5440 min: -0.7853 max: 2.3735 USE_META, weight: 0.9330 cost: -0.5501 min: -0.7853 max: 2.3735 USE_META, weight: 0.9285 cost: -0.5342 min: -0.7853 max: 2.3735 USE_META, weight: 0.9268 cost: -0.5284 min: -0.7853 max: 2.3735 USE_META, weight: 0.9247 cost: -0.5210 min: -0.7853 max: 2.3735 USE_META, weight: 0.9783 cost: -0.7091 min: -0.7853 max: 2.3735 USE_META, weight: 0.9169 cost: -0.4936 min: -0.7853 max: 2.3735 USE_META, weight: 0.4773 cost: 1.0493 min: -0.7853 max: 2.3735 USE_META, weight: 0.7027 cost: 0.2581 min: -0.7853 max: 2.3735 USE_META, weight: 0.8949 cost: -0.4164 min: -0.7853 max: 2.3735 USE_META, weight: 0.3331 cost: 1.5553 min: -0.7853 max: 2.3735 USE_META, weight: 0.3443 cost: 1.5159 min: -0.7853 max: 2.3735 USE_META, weight: 0.3135 cost: 1.6242 min: -0.7853 max: 2.3735 USE_META, weight: 0.3645 cost: 1.4451 min: -0.7853 max: 2.3735 USE_META, weight: 0.2691 cost: 1.7802 min: -0.7853 max: 2.3735 USE_META, weight: 0.9733 cost: -0.6916 min: -0.7853 max: 2.3735 USE_META, weight: 0.9391 cost: -0.5715 min: -0.7853 max: 2.3735 USE_META, weight: 0.9434 cost: -0.5867 min: -0.7853 max: 2.3735 USE_META, weight: 0.9044 cost: -0.4498 min: -0.7853 max: 2.3735 USE_META, weight: 0.9614 cost: -0.6497 min: -0.7853 max: 2.3735 USE_META, weight: 0.9731 cost: -0.6907 min: -0.7853 max: 2.3735 USE_META, weight: 0.9794 cost: -0.7131 min: -0.7853 max: 2.3735 USE_META, weight: 0.9751 cost: -0.6978 min: -0.7853 max: 2.3735 USE_META, weight: 0.9413 cost: -0.5792 min: -0.7853 max: 2.3735 USE_META, weight: 0.9657 cost: -0.6650 min: -0.7853 max: 2.3735 USE_META, weight: 0.9210 cost: -0.5081 min: -0.7853 max: 2.3735 USE_META, weight: 0.9003 cost: -0.4354 min: -0.7853 max: 2.3735 USE_META, weight: 0.9578 cost: -0.6371 min: -0.7853 max: 2.3735 USE_META, weight: 0.9555 cost: -0.6290 min: -0.7853 max: 2.3735 USE_META, weight: 0.8520 cost: -0.2658 min: -0.7853 max: 2.3735 USE_META, weight: 0.9079 cost: -0.4619 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.9718 cost: -0.6861 min: -0.7853 max: 2.3735 USE_META, weight: 0.9638 cost: -0.6581 min: -0.7853 max: 2.3735 USE_META, weight: 0.9210 cost: -0.5081 min: -0.7853 max: 2.3735 USE_META, weight: 0.9442 cost: -0.5893 min: -0.7853 max: 2.3735 USE_META, weight: 0.9726 cost: -0.6890 min: -0.7853 max: 2.3735 USE_META, weight: 0.9413 cost: -0.5792 min: -0.7853 max: 2.3735 USE_META, weight: 0.9794 cost: -0.7131 min: -0.7853 max: 2.3735 USE_META, weight: 0.9751 cost: -0.6978 min: -0.7853 max: 2.3735 USE_META, weight: 0.9638 cost: -0.6581 min: -0.7853 max: 2.3735 USE_META, weight: 0.9657 cost: -0.6650 min: -0.7853 max: 2.3735 USE_META, weight: 0.9788 cost: -0.7109 min: -0.7853 max: 2.3735 USE_META, weight: 0.6356 cost: 0.4938 min: -0.7853 max: 2.3735 USE_META, weight: 0.2092 cost: 1.9903 min: -0.7853 max: 2.3735 USE_META, weight: 0.3418 cost: 1.5248 min: -0.7853 max: 2.3735 USE_META, weight: 0.8802 cost: -0.3646 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.1477 cost: 2.2060 min: -0.7853 max: 2.3735 USE_META, weight: 0.9257 cost: -0.5245 min: -0.7853 max: 2.3735 USE_META, weight: 0.7939 cost: -0.0620 min: -0.7853 max: 2.3735 USE_META, weight: 0.9599 cost: -0.6446 min: -0.7853 max: 2.3735 USE_META, weight: 0.9487 cost: -0.6052 min: -0.7853 max: 2.3735 USE_META, weight: 0.9667 cost: -0.6685 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.9169 cost: -0.4935 min: -0.7853 max: 2.3735 USE_META, weight: 0.9195 cost: -0.5026 min: -0.7853 max: 2.3735 USE_META, weight: 0.9147 cost: -0.4859 min: -0.7853 max: 2.3735 USE_META, weight: 0.9048 cost: -0.4512 min: -0.7853 max: 2.3735 USE_META, weight: 0.9137 cost: -0.4825 min: -0.7853 max: 2.3735 USE_META, weight: 0.9784 cost: -0.7096 min: -0.7853 max: 2.3735 USE_META, weight: 1.0000 cost: -0.7853 min: -0.7853 max: 2.3735 USE_META, weight: 0.9762 cost: -0.7017 min: -0.7853 max: 2.3735 USE_META, weight: 0.9778 cost: -0.7074 min: -0.7853 max: 2.3735 USE_META, weight: 0.9795 cost: -0.7133 min: -0.7853 max: 2.3735 USE_META, weight: 0.9728 cost: -0.6897 min: -0.7853 max: 2.3735 USE_META, weight: 0.9790 cost: -0.7115 min: -0.7853 max: 2.3735 USE_META, weight: 0.9707 cost: -0.6826 min: -0.7853 max: 2.3735 USE_META, weight: 0.9707 cost: -0.6826 min: -0.7853 max: 2.3735 USE_META, weight: 0.9736 cost: -0.6925 min: -0.7853 max: 2.3735 USE_META, weight: 0.9503 cost: -0.6107 min: -0.7853 max: 2.3735 USE_META, weight: 0.9720 cost: -0.6871 min: -0.7853 max: 2.3735 USE_META, weight: 0.9517 cost: -0.6159 min: -0.7853 max: 2.3735 USE_META, weight: 0.8476 cost: -0.2505 min: -0.7853 max: 2.3735 USE_META, weight: 0.8226 cost: -0.1625 min: -0.7853 max: 2.3735 USE_META, weight: 0.9026 cost: -0.4434 min: -0.7853 max: 2.3735 USE_META, weight: 0.9577 cost: -0.6368 min: -0.7853 max: 2.3735 USE_META, weight: 0.9632 cost: -0.6562 min: -0.7853 max: 2.3735 USE_META, weight: 0.9473 cost: -0.6003 min: -0.7853 max: 2.3735 USE_META, weight: 0.9693 cost: -0.6774 min: -0.7853 max: 2.3735 USE_META, weight: 0.9161 cost: -0.4907 min: -0.7853 max: 2.3735 USE_META, weight: 0.9195 cost: -0.5026 min: -0.7853 max: 2.3735 USE_META, weight: 0.9480 cost: -0.6027 min: -0.7853 max: 2.3735 USE_META, weight: 0.9160 cost: -0.4904 min: -0.7853 max: 2.3735 USE_META, weight: 0.8620 cost: -0.3008 min: -0.7853 max: 2.3735 USE_META, weight: 0.8240 cost: -0.1677 min: -0.7853 max: 2.3735 USE_META, weight: 0.8372 cost: -0.2137 min: -0.7853 max: 2.3735 USE_META, weight: 0.8676 cost: -0.3206 min: -0.7853 max: 2.3735 USE_META, weight: 0.8024 cost: -0.0917 min: -0.7853 max: 2.3735 USE_META, weight: 0.9265 cost: -0.5272 min: -0.7853 max: 2.3735 USE_META, weight: 0.8632 cost: -0.3050 min: -0.7853 max: 2.3735 USE_META, weight: 0.8668 cost: -0.3179 min: -0.7853 max: 2.3735 USE_META, weight: 0.8712 cost: -0.3331 min: -0.7853 max: 2.3735 USE_META, weight: 0.8557 cost: -0.2788 min: -0.7853 max: 2.3735 USE_META, weight: 0.8775 cost: -0.3553 min: -0.7853 max: 2.3735 USE_META, weight: 0.9685 cost: -0.6747 min: -0.7853 max: 2.3735 USE_META, weight: 0.9432 cost: -0.5858 min: -0.7853 max: 2.3735 USE_META, weight: 0.9523 cost: -0.6178 min: -0.7853 max: 2.3735 USE_META, weight: 0.8087 cost: -0.1139 min: -0.7853 max: 2.3735 USE_META, weight: 0.8737 cost: -0.3421 min: -0.7853 max: 2.3735 USE_META, weight: 0.9773 cost: -0.7057 min: -0.7853 max: 2.3735 USE_META, weight: 0.9715 cost: -0.6854 min: -0.7853 max: 2.3735 USE_META, weight: 0.9539 cost: -0.6236 min: -0.7853 max: 2.3735 USE_META, weight: 0.9728 cost: -0.6897 min: -0.7853 max: 2.3735 USE_META, weight: 0.9626 cost: -0.6541 min: -0.7853 max: 2.3735 USE_META, weight: 0.8342 cost: -0.2034 min: -0.7853 max: 2.3735 USE_META, weight: 0.9645 cost: -0.6608 min: -0.7853 max: 2.3735 USE_META, weight: 0.9731 cost: -0.6907 min: -0.7853 max: 2.3735 USE_META, weight: 0.9754 cost: -0.6989 min: -0.7853 max: 2.3735 USE_META, weight: 0.9740 cost: -0.6940 min: -0.7853 max: 2.3735 USE_META, weight: 0.9734 cost: -0.6920 min: -0.7853 max: 2.3735 USE_META, weight: 0.9448 cost: -0.5915 min: -0.7853 max: 2.3735 USE_META, weight: 0.9448 cost: -0.5915 min: -0.7853 max: 2.3735 USE_META, weight: 0.9456 cost: -0.5944 min: -0.7853 max: 2.3735 USE_META, weight: 0.9626 cost: -0.6541 min: -0.7853 max: 2.3735 USE_META, weight: 0.9586 cost: -0.6398 min: -0.7853 max: 2.3735 USE_META, weight: 0.9797 cost: -0.7140 min: -0.7853 max: 2.3735 USE_META, weight: 0.9864 cost: -0.7374 min: -0.7853 max: 2.3735 USE_META, weight: 0.9830 cost: -0.7255 min: -0.7853 max: 2.3735 USE_META, weight: 0.9764 cost: -0.7024 min: -0.7853 max: 2.3735 USE_META, weight: 0.9763 cost: -0.7022 min: -0.7853 max: 2.3735 USE_META, weight: 0.9254 cost: -0.5235 min: -0.7853 max: 2.3735 USE_META, weight: 0.8905 cost: -0.4008 min: -0.7853 max: 2.3735 USE_META, weight: 0.9430 cost: -0.5853 min: -0.7853 max: 2.3735 USE_META, weight: 0.9319 cost: -0.5461 min: -0.7853 max: 2.3735 USE_META, weight: 0.9539 cost: -0.6234 min: -0.7853 max: 2.3735 USE_META, weight: 0.9805 cost: -0.7166 min: -0.7853 max: 2.3735 USE_META, weight: 0.9785 cost: -0.7096 min: -0.7853 max: 2.3735 USE_META, weight: 0.9508 cost: -0.6125 min: -0.7853 max: 2.3735 USE_META, weight: 0.9505 cost: -0.6114 min: -0.7853 max: 2.3735 USE_META, weight: 0.9374 cost: -0.5656 min: -0.7853 max: 2.3735 USE_META, weight: 0.9514 cost: -0.6145 min: -0.7853 max: 2.3735 USE_META, weight: 0.9253 cost: -0.5231 min: -0.7853 max: 2.3735 USE_META, weight: 0.9754 cost: -0.6989 min: -0.7853 max: 2.3735 USE_META, weight: 0.9770 cost: -0.7045 min: -0.7853 max: 2.3735 USE_META, weight: 0.9255 cost: -0.5238 min: -0.7853 max: 2.3735 USE_META, weight: 0.9044 cost: -0.4498 min: -0.7853 max: 2.3735 USE_META, weight: 0.9780 cost: -0.7079 min: -0.7853 max: 2.3735 USE_META, weight: 0.8980 cost: -0.4272 min: -0.7853 max: 2.3735 USE_META, weight: 0.9005 cost: -0.4362 min: -0.7853 max: 2.3735 USE_META, weight: 0.8994 cost: -0.4322 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.9786 cost: -0.7102 min: -0.7853 max: 2.3735 USE_META, weight: 0.7573 cost: 0.0664 min: -0.7853 max: 2.3735 USE_META, weight: 0.8866 cost: -0.3871 min: -0.7853 max: 2.3735 USE_META, weight: 0.9745 cost: -0.6958 min: -0.7853 max: 2.3735 USE_META, weight: 0.9689 cost: -0.6760 min: -0.7853 max: 2.3735 USE_META, weight: 0.9864 cost: -0.7374 min: -0.7853 max: 2.3735 USE_META, weight: 0.9539 cost: -0.6235 min: -0.7853 max: 2.3735 USE_META, weight: 0.9557 cost: -0.6298 min: -0.7853 max: 2.3735 USE_META, weight: 0.9456 cost: -0.5943 min: -0.7853 max: 2.3735 USE_META, weight: 0.9716 cost: -0.6854 min: -0.7853 max: 2.3735 USE_META, weight: 0.9551 cost: -0.6277 min: -0.7853 max: 2.3735 USE_META, weight: 0.9561 cost: -0.6312 min: -0.7853 max: 2.3735 USE_META, weight: 0.9737 cost: -0.6930 min: -0.7853 max: 2.3735 USE_META, weight: 0.9439 cost: -0.5882 min: -0.7853 max: 2.3735 USE_META, weight: 0.9849 cost: -0.7321 min: -0.7853 max: 2.3735 USE_META, weight: 0.9746 cost: -0.6959 min: -0.7853 max: 2.3735 USE_META, weight: 0.9875 cost: -0.7412 min: -0.7853 max: 2.3735 USE_META, weight: 0.9532 cost: -0.6211 min: -0.7853 max: 2.3735 USE_META, weight: 0.9559 cost: -0.6304 min: -0.7853 max: 2.3735 USE_META, weight: 0.9697 cost: -0.6789 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.9533 cost: -0.6213 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.9804 cost: -0.7165 min: -0.7853 max: 2.3735 USE_META, weight: 0.9399 cost: -0.5743 min: -0.7853 max: 2.3735 USE_META, weight: 0.9258 cost: -0.5249 min: -0.7853 max: 2.3735 USE_META, weight: 0.9797 cost: -0.7139 min: -0.7853 max: 2.3735 USE_META, weight: 0.9891 cost: -0.7471 min: -0.7853 max: 2.3735 USE_META, weight: 0.9638 cost: -0.6581 min: -0.7853 max: 2.3735 USE_META, weight: 0.9853 cost: -0.7337 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2770 min: -0.7853 max: 2.3735 USE_META, weight: 0.4124 cost: 1.2771 min: -0.7853 max: 2.3735 USE_META, weight: 0.9841 cost: -0.7295 min: -0.7853 max: 2.3735 USE_META, weight: 0.9223 cost: -0.5126 min: -0.7853 max: 2.3735 USE_META, weight: 0.2089 cost: 1.9912 min: -0.7853 max: 2.3735 USE_META, weight: 0.1817 cost: 2.0867 min: -0.7853 max: 2.3735 USE_META, weight: 0.1713 cost: 2.1233 min: -0.7853 max: 2.3735 USE_META, weight: 0.1000 cost: 2.3735 min: -0.7853 max: 2.3735 USE_META, weight: 0.9839 cost: -0.7289 min: -0.7853 max: 2.3735 USE_META, weight: 0.9110 cost: -0.4728 min: -0.7853 max: 2.3735 USE_META, weight: 0.9475 cost: -0.6011 min: -0.7853 max: 2.3735 USE_META, weight: 0.9421 cost: -0.5822 min: -0.7853 max: 2.3735 USE_META, weight: 0.9561 cost: -0.6313 min: -0.7853 max: 2.3735 USE_META, weight: 0.9674 cost: -0.6708 min: -0.7853 max: 2.3735 USE_META, weight: 0.9620 cost: -0.6520 min: -0.7853 max: 2.3735 USE_META, weight: 0.9548 cost: -0.6267 min: -0.7853 max: 2.3735 USE_META, weight: 0.9356 cost: -0.5594 min: -0.7853 max: 2.3735 USE_META, weight: 0.9347 cost: -0.5559 min: -0.7853 max: 2.3735 USE_META, weight: 0.9830 cost: -0.7257 min: -0.7853 max: 2.3735 USE_META, weight: 0.9861 cost: -0.7366 min: -0.7853 max: 2.3735 USE_META, weight: 0.7970 cost: -0.0729 min: -0.7853 max: 2.3735 USE_META, weight: 0.9575 cost: -0.6360 min: -0.7853 max: 2.3735 USE_META, weight: 0.8901 cost: -0.3997 min: -0.7853 max: 2.3735 USE_META, weight: 0.9826 cost: -0.7241 min: -0.7853 max: 2.3735 USE_META, weight: 0.9564 cost: -0.6322 min: -0.7853 max: 2.3735 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 USE_EVALUE, weight: 1.0000 eval: 0.0000 min: 0.0000 max: 0.0000 Number of contacts in models: 249 Number of contacts in alignments: 168 NUMB_ALIGNS: 168 Adding 8291 constraints to all3.constraints Done adding distance constraints # command:Reading probabilities from probabilities.dat Reading constraints from ConstraintSet all3.constraints maxweight: 1.0000 Optimizing... Probability sum: -458.4868, CN propb: -458.4868 weights: 0.5160 constraints: 604 # command:Found ConstraintSet # PrintContacts align.constraints_meta03 Number of constraints in align3.constraints 604 # command:Found ConstraintSet # PrintContacts align_bonus.constraints_meta03 Number of constraints in align3.constraints.bonus 604 # command:Found ConstraintSet # PrintContacts rejected.constraints_meta03 Number of constraints in rejected3.constraints 7687 # command:Found ConstraintSet # PrintContacts rejected_bonus.constraints_meta03 Number of constraints in rejected3.constraints.bonus 7687 # command:Found ConstraintSet # PrintContacts non_contacts.constraints_meta03 Number of constraints in noncontact3.constraints 0 # command:Found ConstraintSet # PrintContacts non_contacts_bonus.constraints_meta03 Number of constraints in noncontact3.constraints.bonus 0 # command:Found ConstraintSet # PrintContacts all.constraints_meta03 Number of constraints in all3.constraints 8291 # command: