# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0373/ # command:# Making conformation for sequence T0373 numbered 1 through 147 Created new target T0373 from T0373.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0373/ # command:# reading script from file T0373.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a61A/T0373-2a61A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2a61A expands to /projects/compbio/data/pdb/2a61.pdb.gz 2a61A:Skipped atom 654, because occupancy 0.5 <= existing 0.500 in 2a61A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 670, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 672, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 674, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 920, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 922, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 924, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 926, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 928, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 930, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 932, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 934, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1079, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1081, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1083, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1085, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1087, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1089, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1091, because occupancy 0.500 <= existing 0.500 in 2a61A Skipped atom 1093, because occupancy 0.500 <= existing 0.500 in 2a61A # T0373 read from 2a61A/T0373-2a61A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2a61A read from 2a61A/T0373-2a61A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2a61A to template set # found chain 2a61A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (2a61A)K5 T0373 4 :NQDLQL 2a61A 6 :QPFERI # choosing archetypes in rotamer library T0373 13 :LRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 12 :LREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERREN T0373 115 :LVRAMHACLDESERALLAAAGPLLTRLAQ 2a61A 112 :FIEKITSDLGKEKSSKILDYLKELKGVME Number of specific fragments extracted= 4 number of extra gaps= 0 total=4 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_772970072.pdb -s /var/tmp/to_scwrl_772970072.seq -o /var/tmp/from_scwrl_772970072.pdb > /var/tmp/scwrl_772970072.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_772970072.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lnwA/T0373-1lnwA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1lnwA expands to /projects/compbio/data/pdb/1lnw.pdb.gz 1lnwA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 1lnwA/T0373-1lnwA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1lnwA read from 1lnwA/T0373-1lnwA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1lnwA to template set # found chain 1lnwA in template set T0373 2 :PTNQDLQLAAHLRSQVTTLTRRLRRE 1lnwA 6 :NPDLMPALMAVFQHVRTRIQSELDCQ T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSR T0373 115 :LVRAMHACLDESERALLAA 1lnwA 115 :VHDELFAPLTPVEQATLVH T0373 137 :LLTRLAQF 1lnwA 134 :LLDQCLAA Number of specific fragments extracted= 5 number of extra gaps= 0 total=9 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_94307398.pdb -s /var/tmp/to_scwrl_94307398.seq -o /var/tmp/from_scwrl_94307398.pdb > /var/tmp/scwrl_94307398.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_94307398.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbhA/T0373-2fbhA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2fbhA expands to /projects/compbio/data/pdb/2fbh.pdb.gz 2fbhA:Skipped atom 109, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 111, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 113, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 115, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 117, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 119, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 121, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 123, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 125, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 127, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 129, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 272, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 274, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 276, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 278, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 280, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 282, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 284, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 286, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 415, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 417, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 419, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 421, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 423, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 480, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 482, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 484, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 486, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 488, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 490, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 492, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 494, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 496, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 670, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 672, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 674, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 676, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 678, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 680, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 682, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 835, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 847, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 849, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 851, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 876, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 878, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 880, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 882, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 884, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 886, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1002, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1004, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1006, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1008, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1010, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1012, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1014, because occupancy 0.500 <= existing 0.500 in 2fbhA Skipped atom 1016, because occupancy 0.500 <= existing 0.500 in 2fbhA # T0373 read from 2fbhA/T0373-2fbhA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbhA read from 2fbhA/T0373-2fbhA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2fbhA to template set # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAAS T0373 115 :LVRAMHACLDESERALLAA 2fbhA 114 :VRNDVLTGIDESEQALCQQ T0373 137 :LLTRLAQF 2fbhA 133 :VLLRILAN Number of specific fragments extracted= 5 number of extra gaps= 2 total=14 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_51245830.pdb -s /var/tmp/to_scwrl_51245830.seq -o /var/tmp/from_scwrl_51245830.pdb > /var/tmp/scwrl_51245830.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_51245830.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbiA/T0373-2fbiA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2fbiA expands to /projects/compbio/data/pdb/2fbi.pdb.gz 2fbiA:Skipped atom 2, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 4, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 6, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 8, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 10, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 12, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 14, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 16, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 18, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 20, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 22, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 250, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 252, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 254, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 256, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 258, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 260, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 262, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 264, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 266, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 443, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 445, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 447, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 449, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 451, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 453, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 455, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 457, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 718, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 720, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 722, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 724, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 726, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 728, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 730, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 732, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 734, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 736, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 738, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 829, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 831, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 833, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 835, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 837, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 839, because occupancy 0.400 <= existing 0.600 in 2fbiA Skipped atom 891, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 893, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 895, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 897, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 899, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 901, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 903, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 905, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1017, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1019, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1021, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1023, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1025, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1027, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1029, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1031, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1033, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1091, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1093, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1095, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1097, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1099, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1101, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1103, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1105, because occupancy 0.500 <= existing 0.500 in 2fbiA Skipped atom 1107, because occupancy 0.500 <= existing 0.500 in 2fbiA # T0373 read from 2fbiA/T0373-2fbiA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbiA read from 2fbiA/T0373-2fbiA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2fbiA to template set # found chain 2fbiA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 3 :TNQDLQLA 2fbiA 6 :PSLTLTLL T0373 15 :SQVTTLTRRLRREAQAD 2fbiA 14 :QAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEK T0373 115 :LVRAMHACLDESERALLAA 2fbiA 112 :NYQRIQERFGEEKLAQLLE T0373 137 :LLTRLAQF 2fbiA 131 :LLNELKKI Number of specific fragments extracted= 7 number of extra gaps= 2 total=21 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_10901063.pdb -s /var/tmp/to_scwrl_10901063.seq -o /var/tmp/from_scwrl_10901063.pdb > /var/tmp/scwrl_10901063.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_10901063.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ethA/T0373-2ethA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2ethA expands to /projects/compbio/data/pdb/2eth.pdb.gz 2ethA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1046, because occupancy 0.500 <= existing 0.500 in 2ethA Skipped atom 1050, because occupancy 0.500 <= existing 0.500 in 2ethA Skipped atom 1052, because occupancy 0.500 <= existing 0.500 in 2ethA # T0373 read from 2ethA/T0373-2ethA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2ethA read from 2ethA/T0373-2ethA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2ethA to template set # found chain 2ethA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2ethA)H0 T0373 3 :TNQDLQL 2ethA 1 :MDALEIF T0373 18 :TTLTRRLRREAQADP 2ethA 8 :KTLFSLVMRFSSYLP T0373 33 :VQFSQLVVLGAIDRLGG 2ethA 30 :MKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFES T0373 115 :LVRAMHACLDESERALLAA 2ethA 110 :LLKSVLEKFSEEDFKVVSE T0373 137 :LLTRLAQF 2ethA 129 :GFNRMVEA Number of specific fragments extracted= 6 number of extra gaps= 0 total=27 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1046370347.pdb -s /var/tmp/to_scwrl_1046370347.seq -o /var/tmp/from_scwrl_1046370347.pdb > /var/tmp/scwrl_1046370347.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1046370347.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z91A/T0373-1z91A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1z91A expands to /projects/compbio/data/pdb/1z91.pdb.gz 1z91A:# T0373 read from 1z91A/T0373-1z91A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z91A read from 1z91A/T0373-1z91A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1z91A to template set # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRN 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL T0373 104 :LYGNRAKREE 1z91A 111 :AVDIPGTILG T0373 120 :HACLDESERALLAA 1z91A 121 :LSKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 5 number of extra gaps= 0 total=32 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_628966950.pdb -s /var/tmp/to_scwrl_628966950.seq -o /var/tmp/from_scwrl_628966950.pdb > /var/tmp/scwrl_628966950.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_628966950.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fxaA/T0373-2fxaA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 2fxaA expands to /projects/compbio/data/pdb/2fxa.pdb.gz 2fxaA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 461, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 463, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 465, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 467, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 469, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 471, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 473, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 475, because occupancy 0.500 <= existing 0.500 in 2fxaA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 585, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 683, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 685, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 687, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 689, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 691, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 693, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 695, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 697, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 699, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 701, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 703, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 705, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 707, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 709, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 711, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 713, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 715, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 717, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 719, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 721, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 747, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 749, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 751, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 753, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 755, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 757, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 759, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 761, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 763, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 765, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 767, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 833, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 837, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 839, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 841, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 843, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 845, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 918, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 920, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 922, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 924, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 926, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 928, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 930, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 932, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 934, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 936, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 938, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 940, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 942, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 944, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1117, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1121, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1123, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1125, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1127, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1129, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1131, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1183, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1185, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1187, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1189, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1191, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1193, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1195, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1197, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1199, because occupancy 0.500 <= existing 0.500 in 2fxaA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1272, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1276, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1278, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1280, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1282, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1284, because occupancy 0.500 <= existing 0.500 in 2fxaA Skipped atom 1286, because occupancy 0.500 <= existing 0.500 in 2fxaA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 2fxaA/T0373-2fxaA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fxaA read from 2fxaA/T0373-2fxaA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 2fxaA to template set # found chain 2fxaA in template set Warning: unaligning (T0373)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fxaA)D9 Warning: unaligning (T0373)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fxaA)D9 Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 2 :P 2fxaA 7 :P T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 16 :FTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAK 2fxaA 103 :YVQLTEEGTEVFWSLLEE Number of specific fragments extracted= 4 number of extra gaps= 1 total=36 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1520982029.pdb -s /var/tmp/to_scwrl_1520982029.seq -o /var/tmp/from_scwrl_1520982029.pdb > /var/tmp/scwrl_1520982029.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1520982029.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p4xA/T0373-1p4xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1p4xA expands to /projects/compbio/data/pdb/1p4x.pdb.gz 1p4xA:# T0373 read from 1p4xA/T0373-1p4xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1p4xA read from 1p4xA/T0373-1p4xA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1p4xA to template set # found chain 1p4xA in template set T0373 2 :PTNQDLQLAAHLR 1p4xA 5 :NHDKIRDFIIIEA T0373 20 :LTRRLRREAQ 1p4xA 18 :YMFRFKKKVK T0373 30 :ADPVQFSQLVVLGAIDRLGGD 1p4xA 29 :EVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLAD T0373 128 :RALLAAAG 1p4xA 133 :SKEFLNLM T0373 136 :PLLTRLAQ 1p4xA 144 :MYFKNIIK Number of specific fragments extracted= 6 number of extra gaps= 0 total=42 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1761250572.pdb -s /var/tmp/to_scwrl_1761250572.seq -o /var/tmp/from_scwrl_1761250572.pdb > /var/tmp/scwrl_1761250572.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1761250572.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1on2A/T0373-1on2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1on2A/T0373-1on2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1on2A read from 1on2A/T0373-1on2A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1on2A in training set T0373 35 :FSQLVVLGAIDRLGG 1on2A 8 :MYIEQIYMLIEEKGY T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1on2A 23 :ARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYE T0373 87 :QDG 1on2A 56 :KYR T0373 93 :RVSLSSEGRRNLYGNRAKRE 1on2A 59 :GLVLTSKGKKIGKRLVYRHE T0373 114 :WLVRAM 1on2A 79 :LLEQFL T0373 120 :HACLDESER 1on2A 86 :IIGVDEEKI T0373 129 :ALLAA 1on2A 111 :DRIGD T0373 137 :LLTRL 1on2A 116 :LVQYF Number of specific fragments extracted= 8 number of extra gaps= 0 total=50 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1089653713.pdb -s /var/tmp/to_scwrl_1089653713.seq -o /var/tmp/from_scwrl_1089653713.pdb > /var/tmp/scwrl_1089653713.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1089653713.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sfxA/T0373-1sfxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1sfxA/T0373-1sfxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sfxA read from 1sfxA/T0373-1sfxA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sfxA in training set T0373 2 :PTNQDLQL 1sfxA 1 :MSNPLGEL T0373 25 :RREAQADPVQFSQLVVLGAIDRLGG 1sfxA 9 :VKALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSE 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKP T0373 102 :RNLYGNRAKREEWLVRAMHACLD 1sfxA 83 :EKVLKEFKSSILGEIERIEKMFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=54 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1003886059.pdb -s /var/tmp/to_scwrl_1003886059.seq -o /var/tmp/from_scwrl_1003886059.pdb > /var/tmp/scwrl_1003886059.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1003886059.pdb Number of alignments=10 # command:# reading script from file T0373.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a61A/T0373-2a61A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2a61A/T0373-2a61A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2a61A read from 2a61A/T0373-2a61A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2a61A in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2a61A)K5 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 6 :QPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKIT T0373 121 :ACLDESERALLAAAGPLLTRLAQF 2a61A 118 :SDLGKEKSSKILDYLKELKGVMER Number of specific fragments extracted= 3 number of extra gaps= 0 total=57 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_168057522.pdb -s /var/tmp/to_scwrl_168057522.seq -o /var/tmp/from_scwrl_168057522.pdb > /var/tmp/scwrl_168057522.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_168057522.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbhA/T0373-2fbhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fbhA/T0373-2fbhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbhA read from 2fbhA/T0373-2fbhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALLAA 2fbhA 120 :TGIDESEQALCQQ T0373 137 :LLTRLAQF 2fbhA 133 :VLLRILAN Number of specific fragments extracted= 5 number of extra gaps= 2 total=62 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_410134047.pdb -s /var/tmp/to_scwrl_410134047.seq -o /var/tmp/from_scwrl_410134047.pdb > /var/tmp/scwrl_410134047.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_410134047.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lnwA/T0373-1lnwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1lnwA/T0373-1lnwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1lnwA read from 1lnwA/T0373-1lnwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1lnwA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1lnwA)Q142 T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRRE 1lnwA 5 :VNPDLMPALMAVFQHVRTRIQSELDCQ T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELF T0373 121 :ACLDESERALLAA 1lnwA 121 :APLTPVEQATLVH T0373 137 :LLTRLAQF 1lnwA 134 :LLDQCLAA Number of specific fragments extracted= 5 number of extra gaps= 0 total=67 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1038626924.pdb -s /var/tmp/to_scwrl_1038626924.seq -o /var/tmp/from_scwrl_1038626924.pdb > /var/tmp/scwrl_1038626924.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1038626924.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbiA/T0373-2fbiA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fbiA/T0373-2fbiA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbiA read from 2fbiA/T0373-2fbiA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 3 :TNQDLQL 2fbiA 6 :PSLTLTL T0373 14 :RSQVTTLTRRLRREAQAD 2fbiA 13 :LQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRL 2fbiA 33 :TEQQWRVIRILRQQ T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 47 :GEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQ T0373 121 :ACLDESERALLAA 2fbiA 118 :ERFGEEKLAQLLE T0373 137 :LLTRLAQFE 2fbiA 131 :LLNELKKIK Number of specific fragments extracted= 7 number of extra gaps= 2 total=74 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1982945081.pdb -s /var/tmp/to_scwrl_1982945081.seq -o /var/tmp/from_scwrl_1982945081.pdb > /var/tmp/scwrl_1982945081.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1982945081.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ethA/T0373-2ethA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2ethA/T0373-2ethA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2ethA read from 2ethA/T0373-2ethA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2ethA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2ethA)H0 T0373 3 :TNQDLQL 2ethA 1 :MDALEIF T0373 18 :TTLTRRLRREAQADP 2ethA 8 :KTLFSLVMRFSSYLP T0373 33 :VQFSQLVVLGAIDRL 2ethA 30 :MKTTELYAFLYVALF T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2ethA 45 :GPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVL T0373 121 :ACLDESERALLAA 2ethA 116 :EKFSEEDFKVVSE T0373 137 :LLTRLAQF 2ethA 129 :GFNRMVEA Number of specific fragments extracted= 6 number of extra gaps= 0 total=80 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_93189435.pdb -s /var/tmp/to_scwrl_93189435.seq -o /var/tmp/from_scwrl_93189435.pdb > /var/tmp/scwrl_93189435.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_93189435.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z91A/T0373-1z91A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1z91A/T0373-1z91A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z91A read from 1z91A/T0373-1z91A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEH T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRN 1z91A 53 :ETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL T0373 104 :LYGNRAKREEW 1z91A 111 :AVDIPGTILGL T0373 121 :ACLDESERALLAA 1z91A 122 :SKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 5 number of extra gaps= 0 total=85 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_181271232.pdb -s /var/tmp/to_scwrl_181271232.seq -o /var/tmp/from_scwrl_181271232.pdb > /var/tmp/scwrl_181271232.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_181271232.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fxaA/T0373-2fxaA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fxaA/T0373-2fxaA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fxaA read from 2fxaA/T0373-2fxaA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fxaA in template set Warning: unaligning (T0373)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fxaA)D9 Warning: unaligning (T0373)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fxaA)D9 Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 1 :MP 2fxaA 6 :PP T0373 5 :QD 2fxaA 10 :VK T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 18 :QKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRA 2fxaA 103 :YVQLTEEGTEVFWSLLE T0373 111 :REEW 2fxaA 128 :VFKG T0373 115 :LVRAM 2fxaA 135 :LYHLF T0373 121 :ACLD 2fxaA 140 :GKFP T0373 125 :ESERALLAAAGP 2fxaA 146 :AEMMCMIRHIYG T0373 139 :TRLAQFEE 2fxaA 158 :DDFMEIFE Number of specific fragments extracted= 10 number of extra gaps= 1 total=95 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_525829204.pdb -s /var/tmp/to_scwrl_525829204.seq -o /var/tmp/from_scwrl_525829204.pdb > /var/tmp/scwrl_525829204.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_525829204.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p4xA/T0373-1p4xA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1p4xA/T0373-1p4xA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1p4xA read from 1p4xA/T0373-1p4xA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1p4xA in template set T0373 2 :PTNQDLQLAAHLRSQVTTLTRRLR 1p4xA 4 :NNHDKIRDFIIIEAYMFRFKKKVK T0373 29 :QADPVQFSQLVVLGAIDRLGG 1p4xA 28 :PEVDMTIKEFILLTYLFHQQE T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1p4xA 50 :TLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLAD T0373 123 :LD 1p4xA 124 :SE T0373 126 :SERALLAAAGPLLTRLAQ 1p4xA 134 :KEFLNLMMYTMYFKNIIK Number of specific fragments extracted= 5 number of extra gaps= 0 total=100 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1527622953.pdb -s /var/tmp/to_scwrl_1527622953.seq -o /var/tmp/from_scwrl_1527622953.pdb > /var/tmp/scwrl_1527622953.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1527622953.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1on2A/T0373-1on2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1on2A/T0373-1on2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1on2A read from 1on2A/T0373-1on2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1on2A in training set Warning: unaligning (T0373)V33 because first residue in template chain is (1on2A)T2 T0373 34 :QFSQLVVLGAIDRL 1on2A 3 :TPSMEMYIEQIYML T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1on2A 20 :KGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYE T0373 86 :PQD 1on2A 56 :KYR T0373 93 :RVSLSSEGRRNLYGNRAKR 1on2A 59 :GLVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAA 1on2A 103 :HHLSWNSIDRIGD T0373 137 :LLTRLA 1on2A 116 :LVQYFE Number of specific fragments extracted= 7 number of extra gaps= 0 total=107 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1312630442.pdb -s /var/tmp/to_scwrl_1312630442.seq -o /var/tmp/from_scwrl_1312630442.pdb > /var/tmp/scwrl_1312630442.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1312630442.pdb Number of alignments=19 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z7uA/T0373-1z7uA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1z7uA expands to /projects/compbio/data/pdb/1z7u.pdb.gz 1z7uA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 70, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 72, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 74, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 76, because occupancy 0.500 <= existing 0.500 in 1z7uA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 259, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 261, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 263, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 265, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 267, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 269, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 271, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 273, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 275, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 297, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 299, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 301, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 303, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 305, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 307, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 309, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 311, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 313, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 315, because occupancy 0.400 <= existing 0.600 in 1z7uA Skipped atom 317, because occupancy 0.400 <= existing 0.600 in 1z7uA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 596, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 600, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 608, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 610, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 909, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 911, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 913, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 915, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 917, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 919, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 921, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 923, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 925, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 927, because occupancy 0.500 <= existing 0.500 in 1z7uA Skipped atom 929, because occupancy 0.500 <= existing 0.500 in 1z7uA # T0373 read from 1z7uA/T0373-1z7uA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z7uA read from 1z7uA/T0373-1z7uA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1z7uA to template set # found chain 1z7uA in template set T0373 6 :DLQL 1z7uA 6 :QTSI T0373 22 :RRLRREAQ 1z7uA 10 :NLALSTIN T0373 35 :FSQLVVLGAIDR 1z7uA 19 :KWKLSLMDELFQ T0373 49 :GDVTPSELAAAE 1z7uA 31 :GTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMH 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGETFAQK Number of specific fragments extracted= 5 number of extra gaps= 0 total=112 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_199411898.pdb -s /var/tmp/to_scwrl_199411898.seq -o /var/tmp/from_scwrl_199411898.pdb > /var/tmp/scwrl_199411898.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_199411898.pdb Number of alignments=20 # command:# reading script from file T0373.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a61A/T0373-2a61A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2a61A/T0373-2a61A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2a61A read from 2a61A/T0373-2a61A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2a61A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 10 :RILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEK T0373 119 :MHACLDESERALLAAAGPLLTRLAQ 2a61A 116 :ITSDLGKEKSSKILDYLKELKGVME Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_2064945485.pdb -s /var/tmp/to_scwrl_2064945485.seq -o /var/tmp/from_scwrl_2064945485.pdb > /var/tmp/scwrl_2064945485.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2064945485.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbhA/T0373-2fbhA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fbhA/T0373-2fbhA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbhA read from 2fbhA/T0373-2fbhA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 13 :LRSQVTTLTRRLRREAQADPVQF 2fbhA 13 :LAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALLAAAGPLLTRLAQF 2fbhA 118 :VLTGIDESEQALCQQVLLRILANLEN Number of specific fragments extracted= 4 number of extra gaps= 2 total=119 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1862875639.pdb -s /var/tmp/to_scwrl_1862875639.seq -o /var/tmp/from_scwrl_1862875639.pdb > /var/tmp/scwrl_1862875639.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1862875639.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbiA/T0373-2fbiA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fbiA/T0373-2fbiA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbiA read from 2fbiA/T0373-2fbiA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 14 :RSQVTTLTRRLRREAQAD 2fbiA 13 :LQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDR 2fbiA 33 :TEQQWRVIRILRQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 46 :QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQR T0373 119 :MHACLDESERALLAAAGPL 2fbiA 116 :IQERFGEEKLAQLLELLNE Number of specific fragments extracted= 5 number of extra gaps= 2 total=124 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_356684278.pdb -s /var/tmp/to_scwrl_356684278.seq -o /var/tmp/from_scwrl_356684278.pdb > /var/tmp/scwrl_356684278.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_356684278.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lnwA/T0373-1lnwA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1lnwA/T0373-1lnwA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1lnwA read from 1lnwA/T0373-1lnwA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1lnwA in template set T0373 14 :RSQVTTLTRRLRREAQADP 1lnwA 14 :MAVFQHVRTRIQSELDCQR T0373 33 :VQFSQLVVLGAIDR 1lnwA 35 :LTPPDVHVLKLIDE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 49 :QRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERALLAAAGPL 1lnwA 119 :LFAPLTPVEQATLVHLLDQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=128 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1022089159.pdb -s /var/tmp/to_scwrl_1022089159.seq -o /var/tmp/from_scwrl_1022089159.pdb > /var/tmp/scwrl_1022089159.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1022089159.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ethA/T0373-2ethA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2ethA/T0373-2ethA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2ethA read from 2ethA/T0373-2ethA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2ethA in template set Warning: unaligning (T0373)F144 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ethA)E140 Warning: unaligning (T0373)E145 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ethA)E140 T0373 19 :TLTRRLRREAQADP 2ethA 6 :IFKTLFSLVMRFSS T0373 33 :VQFSQLVVLGAIDR 2ethA 30 :MKTTELYAFLYVAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 44 :FGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERALLAAAGPLLTRLAQ 2ethA 114 :VLEKFSEEDFKVVSEGFNRMVEALS Number of specific fragments extracted= 4 number of extra gaps= 1 total=132 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1626250261.pdb -s /var/tmp/to_scwrl_1626250261.seq -o /var/tmp/from_scwrl_1626250261.pdb > /var/tmp/scwrl_1626250261.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1626250261.pdb Number of alignments=25 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z91A/T0373-1z91A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1z91A/T0373-1z91A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z91A read from 1z91A/T0373-1z91A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1z91A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1z91A 16 :FLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRN 1z91A 52 :HETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL T0373 104 :LYG 1z91A 111 :AVD T0373 111 :REEWLVR 1z91A 114 :IPGTILG T0373 120 :HACLDESERALLAAAGPLLTR 1z91A 121 :LSKQSGEDLKQLKSALYTLLE Number of specific fragments extracted= 5 number of extra gaps= 0 total=137 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1669679261.pdb -s /var/tmp/to_scwrl_1669679261.seq -o /var/tmp/from_scwrl_1669679261.pdb > /var/tmp/scwrl_1669679261.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1669679261.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p4xA/T0373-1p4xA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1p4xA/T0373-1p4xA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1p4xA read from 1p4xA/T0373-1p4xA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1p4xA in template set T0373 2 :PTNQDLQLAAHLRSQVTTLTRRLRR 1p4xA 4 :NNHDKIRDFIIIEAYMFRFKKKVKP T0373 30 :ADPVQFSQLVVLGAIDRLGGD 1p4xA 29 :EVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLAD Number of specific fragments extracted= 3 number of extra gaps= 0 total=140 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_14989683.pdb -s /var/tmp/to_scwrl_14989683.seq -o /var/tmp/from_scwrl_14989683.pdb > /var/tmp/scwrl_14989683.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_14989683.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fxaA/T0373-2fxaA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fxaA/T0373-2fxaA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fxaA read from 2fxaA/T0373-2fxaA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2fxaA 21 :AQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 58 :LNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAK 2fxaA 103 :YVQLTEEGTEVFWSLLEE T0373 112 :EEWLVR 2fxaA 133 :QPLYHL T0373 120 :HACLD 2fxaA 139 :FGKFP T0373 125 :ESERALLAA 2fxaA 146 :AEMMCMIRH Number of specific fragments extracted= 6 number of extra gaps= 0 total=146 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1242561040.pdb -s /var/tmp/to_scwrl_1242561040.seq -o /var/tmp/from_scwrl_1242561040.pdb > /var/tmp/scwrl_1242561040.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1242561040.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1on2A/T0373-1on2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1on2A/T0373-1on2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1on2A read from 1on2A/T0373-1on2A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1on2A in training set T0373 35 :FSQLVVLGAIDR 1on2A 8 :MYIEQIYMLIEE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 20 :KGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESER 1on2A 59 :GLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKI T0373 129 :ALLAAAGPLLT 1on2A 111 :DRIGDLVQYFE Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1581539847.pdb -s /var/tmp/to_scwrl_1581539847.seq -o /var/tmp/from_scwrl_1581539847.pdb > /var/tmp/scwrl_1581539847.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1581539847.pdb Number of alignments=29 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sfxA/T0373-1sfxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1sfxA/T0373-1sfxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sfxA read from 1sfxA/T0373-1sfxA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sfxA in training set T0373 22 :RRLRREAQADPVQFSQLVVLGAIDR 1sfxA 6 :GELVKALEKLSFKPSDVRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSE 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKP T0373 102 :RNLYGNRAKREEWLVRAMHACLDE 1sfxA 83 :EKVLKEFKSSILGEIERIEKMFTD Number of specific fragments extracted= 3 number of extra gaps= 0 total=153 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1597141722.pdb -s /var/tmp/to_scwrl_1597141722.seq -o /var/tmp/from_scwrl_1597141722.pdb > /var/tmp/scwrl_1597141722.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1597141722.pdb Number of alignments=30 # command:# reading script from file T0373.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a61A/T0373-2a61A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2a61A/T0373-2a61A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2a61A read from 2a61A/T0373-2a61A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2a61A in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2a61A)K5 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 6 :QPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKIT T0373 121 :ACLDESERALLAAAGPLLTRLAQF 2a61A 118 :SDLGKEKSSKILDYLKELKGVMER Number of specific fragments extracted= 3 number of extra gaps= 0 total=156 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1981208323.pdb -s /var/tmp/to_scwrl_1981208323.seq -o /var/tmp/from_scwrl_1981208323.pdb > /var/tmp/scwrl_1981208323.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1981208323.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbhA/T0373-2fbhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fbhA/T0373-2fbhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbhA read from 2fbhA/T0373-2fbhA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALLAA 2fbhA 120 :TGIDESEQALCQQ T0373 137 :LLTRLAQF 2fbhA 133 :VLLRILAN Number of specific fragments extracted= 5 number of extra gaps= 2 total=161 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_207026272.pdb -s /var/tmp/to_scwrl_207026272.seq -o /var/tmp/from_scwrl_207026272.pdb > /var/tmp/scwrl_207026272.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_207026272.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lnwA/T0373-1lnwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1lnwA/T0373-1lnwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1lnwA read from 1lnwA/T0373-1lnwA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1lnwA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1lnwA)Q142 T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRRE 1lnwA 5 :VNPDLMPALMAVFQHVRTRIQSELDCQ T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELF T0373 121 :ACLDESERALLAA 1lnwA 121 :APLTPVEQATLVH T0373 137 :LLTRLAQF 1lnwA 134 :LLDQCLAA Number of specific fragments extracted= 5 number of extra gaps= 0 total=166 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1691449121.pdb -s /var/tmp/to_scwrl_1691449121.seq -o /var/tmp/from_scwrl_1691449121.pdb > /var/tmp/scwrl_1691449121.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1691449121.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbiA/T0373-2fbiA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fbiA/T0373-2fbiA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fbiA read from 2fbiA/T0373-2fbiA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 3 :TNQDLQL 2fbiA 6 :PSLTLTL T0373 14 :RSQVTTLTRRLRREAQAD 2fbiA 13 :LQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRL 2fbiA 33 :TEQQWRVIRILRQQ T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 47 :GEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQ T0373 121 :ACLDESERALLAA 2fbiA 118 :ERFGEEKLAQLLE T0373 137 :LLTRLAQFE 2fbiA 131 :LLNELKKIK Number of specific fragments extracted= 7 number of extra gaps= 2 total=173 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_2032454153.pdb -s /var/tmp/to_scwrl_2032454153.seq -o /var/tmp/from_scwrl_2032454153.pdb > /var/tmp/scwrl_2032454153.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2032454153.pdb Number of alignments=34 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ethA/T0373-2ethA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2ethA/T0373-2ethA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2ethA read from 2ethA/T0373-2ethA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2ethA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2ethA)H0 T0373 3 :TNQDLQL 2ethA 1 :MDALEIF T0373 18 :TTLTRRLRREAQADP 2ethA 8 :KTLFSLVMRFSSYLP T0373 33 :VQFSQLVVLGAIDRL 2ethA 30 :MKTTELYAFLYVALF T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2ethA 45 :GPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVL T0373 121 :ACLDESERALLAA 2ethA 116 :EKFSEEDFKVVSE T0373 137 :LLTRLAQF 2ethA 129 :GFNRMVEA Number of specific fragments extracted= 6 number of extra gaps= 0 total=179 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_217927335.pdb -s /var/tmp/to_scwrl_217927335.seq -o /var/tmp/from_scwrl_217927335.pdb > /var/tmp/scwrl_217927335.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_217927335.pdb Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z91A/T0373-1z91A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1z91A/T0373-1z91A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1z91A read from 1z91A/T0373-1z91A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEH T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRN 1z91A 53 :ETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL T0373 104 :LYGNRAKREEW 1z91A 111 :AVDIPGTILGL T0373 121 :ACLDESERALLAA 1z91A 122 :SKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 5 number of extra gaps= 0 total=184 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_590335821.pdb -s /var/tmp/to_scwrl_590335821.seq -o /var/tmp/from_scwrl_590335821.pdb > /var/tmp/scwrl_590335821.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_590335821.pdb Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fxaA/T0373-2fxaA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 2fxaA/T0373-2fxaA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 2fxaA read from 2fxaA/T0373-2fxaA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 2fxaA in template set Warning: unaligning (T0373)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fxaA)D9 Warning: unaligning (T0373)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fxaA)D9 Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 1 :MP 2fxaA 6 :PP T0373 5 :QD 2fxaA 10 :VK T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 18 :QKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRA 2fxaA 103 :YVQLTEEGTEVFWSLLE T0373 111 :REEW 2fxaA 128 :VFKG T0373 115 :LVRAM 2fxaA 135 :LYHLF T0373 121 :ACLD 2fxaA 140 :GKFP T0373 125 :ESERALLAAAGP 2fxaA 146 :AEMMCMIRHIYG T0373 139 :TRLAQFEE 2fxaA 158 :DDFMEIFE Number of specific fragments extracted= 10 number of extra gaps= 1 total=194 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_513937457.pdb -s /var/tmp/to_scwrl_513937457.seq -o /var/tmp/from_scwrl_513937457.pdb > /var/tmp/scwrl_513937457.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_513937457.pdb Number of alignments=37 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p4xA/T0373-1p4xA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1p4xA/T0373-1p4xA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1p4xA read from 1p4xA/T0373-1p4xA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1p4xA in template set T0373 2 :PTNQDLQLAAHLRSQVTTLTRRLR 1p4xA 4 :NNHDKIRDFIIIEAYMFRFKKKVK T0373 29 :QADPVQFSQLVVLGAIDRLGG 1p4xA 28 :PEVDMTIKEFILLTYLFHQQE T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1p4xA 50 :TLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLAD T0373 123 :LD 1p4xA 124 :SE T0373 126 :SERALLAAAGPLLTRLAQ 1p4xA 134 :KEFLNLMMYTMYFKNIIK Number of specific fragments extracted= 5 number of extra gaps= 0 total=199 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1738909364.pdb -s /var/tmp/to_scwrl_1738909364.seq -o /var/tmp/from_scwrl_1738909364.pdb > /var/tmp/scwrl_1738909364.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1738909364.pdb Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1on2A/T0373-1on2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1on2A/T0373-1on2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1on2A read from 1on2A/T0373-1on2A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1on2A in training set Warning: unaligning (T0373)V33 because first residue in template chain is (1on2A)T2 T0373 34 :QFSQLVVLGAIDRL 1on2A 3 :TPSMEMYIEQIYML T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1on2A 20 :KGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYE T0373 86 :PQD 1on2A 56 :KYR T0373 93 :RVSLSSEGRRNLYGNRAKR 1on2A 59 :GLVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAA 1on2A 103 :HHLSWNSIDRIGD T0373 137 :LLTRLA 1on2A 116 :LVQYFE Number of specific fragments extracted= 7 number of extra gaps= 0 total=206 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_204102747.pdb -s /var/tmp/to_scwrl_204102747.seq -o /var/tmp/from_scwrl_204102747.pdb > /var/tmp/scwrl_204102747.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_204102747.pdb Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sfxA/T0373-1sfxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0373 read from 1sfxA/T0373-1sfxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sfxA read from 1sfxA/T0373-1sfxA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sfxA in training set T0373 1 :MPTNQDLQLA 1sfxA 0 :HMSNPLGELV T0373 26 :REAQADPVQFSQLVVLGAIDRLGG 1sfxA 10 :KALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSE 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKP T0373 102 :RNLYGNRAKREEWLVRAMHACLD 1sfxA 83 :EKVLKEFKSSILGEIERIEKMFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=210 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 133 ; scwrl3 -i /var/tmp/to_scwrl_1603591170.pdb -s /var/tmp/to_scwrl_1603591170.seq -o /var/tmp/from_scwrl_1603591170.pdb > /var/tmp/scwrl_1603591170.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1603591170.pdb Number of alignments=40 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0373//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0373/manyalignments-local.under or /projects/compbio/experiments/protein-predict/casp7/T0373//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0373/manyalignments-local.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0373/manyalignments-local.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0373/manyalignments-local.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2b0lA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2b0lA expands to /projects/compbio/data/pdb/2b0l.pdb.gz 2b0lA:Skipped atom 32, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 34, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 36, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 38, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 40, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 42, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 44, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 46, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 48, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 50, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 123, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 125, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 127, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 129, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 131, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 133, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 135, because occupancy 0.200 <= existing 0.800 in 2b0lA Skipped atom 137, because occupancy 0.200 <= existing 0.800 in 2b0lA # T0373 read from 2b0lA/merged-local-a2m # 2b0lA read from 2b0lA/merged-local-a2m # adding 2b0lA to template set # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 T0373 40 :VL 2b0lA 190 :IF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV Number of specific fragments extracted= 3 number of extra gaps= 3 total=213 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 T0373 39 :VVL 2b0lA 189 :HIF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S Number of specific fragments extracted= 4 number of extra gaps= 4 total=217 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 T0373 40 :VL 2b0lA 190 :IF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV Number of specific fragments extracted= 3 number of extra gaps= 3 total=220 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 T0373 40 :VL 2b0lA 190 :IF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 88 :DG 2b0lA 238 :KG Number of specific fragments extracted= 5 number of extra gaps= 4 total=225 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 T0373 40 :VL 2b0lA 190 :IF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV Number of specific fragments extracted= 3 number of extra gaps= 3 total=228 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 T0373 39 :VVL 2b0lA 189 :HIF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 88 :DG 2b0lA 238 :KG Number of specific fragments extracted= 5 number of extra gaps= 4 total=233 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 T0373 39 :VVL 2b0lA 189 :HIF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S Number of specific fragments extracted= 4 number of extra gaps= 4 total=237 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 T0373 33 :VQFSQLVVLGAID 2b0lA 179 :LSYSELEAIEHIF T0373 48 :GGDVTPSELAAAERMRSSNLA 2b0lA 198 :EGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S Number of specific fragments extracted= 4 number of extra gaps= 4 total=241 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 Warning: unaligning (T0373)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)L256 Warning: unaligning (T0373)N107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L256 T0373 22 :RRLRREAQ 2b0lA 170 :AVVQMAIS T0373 32 :PVQFSQLVVLGAID 2b0lA 178 :SLSYSELEAIEHIF T0373 48 :GGD 2b0lA 195 :DGN T0373 51 :VTPSELAAAERMRSSNLA 2b0lA 201 :LVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 89 :GRRTRVSLSSEGRRNLY 2b0lA 238 :KGTYIKVLNNKFLIELE Number of specific fragments extracted= 7 number of extra gaps= 5 total=248 Number of alignments=41 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)G89 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 Warning: unaligning (T0373)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)L256 T0373 7 :L 2b0lA 169 :K T0373 22 :RRLRREAQ 2b0lA 170 :AVVQMAIS T0373 32 :PVQFSQLVVLGAID 2b0lA 178 :SLSYSELEAIEHIF T0373 48 :GGD 2b0lA 195 :DGN T0373 51 :VTPSELAAAERMRSSNLA 2b0lA 201 :LVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 90 :RRTRVSL 2b0lA 238 :KGTYIKV T0373 97 :SSEGRRNLY 2b0lA 246 :NNKFLIELE Number of specific fragments extracted= 9 number of extra gaps= 5 total=257 Number of alignments=42 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 T0373 39 :VVL 2b0lA 189 :HIF T0373 44 :IDRLGGDVTPSELAAAERMRSSNLA 2b0lA 194 :LDGNEGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S Number of specific fragments extracted= 4 number of extra gaps= 4 total=261 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 T0373 32 :PVQFSQLVVLGAID 2b0lA 178 :SLSYSELEAIEHIF T0373 48 :GGDVTPSELAAAERMRSSNLA 2b0lA 198 :EGLLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S Number of specific fragments extracted= 4 number of extra gaps= 4 total=265 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 Warning: unaligning (T0373)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)L256 Warning: unaligning (T0373)N107 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L256 T0373 22 :RRLRREAQ 2b0lA 170 :AVVQMAIS T0373 32 :PVQFSQLVVLGAID 2b0lA 178 :SLSYSELEAIEHIF T0373 49 :G 2b0lA 196 :G T0373 50 :DVTPSELAAAERMRSSNLA 2b0lA 200 :LLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 89 :GRRTRVSLSSEGRRNLY 2b0lA 238 :KGTYIKVLNNKFLIELE T0373 108 :R 2b0lA 257 :K Number of specific fragments extracted= 8 number of extra gaps= 5 total=273 Number of alignments=43 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)G89 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 Warning: unaligning (T0373)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)L256 T0373 4 :NQDLQL 2b0lA 166 :HMSKAV T0373 24 :LRREAQ 2b0lA 172 :VQMAIS T0373 32 :PVQFSQLVVLGAID 2b0lA 178 :SLSYSELEAIEHIF T0373 48 :GG 2b0lA 196 :GN T0373 50 :DVTPSELAAAERMRSSNLA 2b0lA 200 :LLVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 90 :RRTRVSLS 2b0lA 238 :KGTYIKVL T0373 98 :SEGRRNLY 2b0lA 247 :NKFLIELE Number of specific fragments extracted= 9 number of extra gaps= 5 total=282 Number of alignments=44 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 T0373 33 :VQFSQLVVLGAID 2b0lA 179 :LSYSELEAIEHIF T0373 48 :GGD 2b0lA 194 :LDG T0373 51 :VTPSELAAAERMRSSNLA 2b0lA 201 :LVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV Number of specific fragments extracted= 4 number of extra gaps= 3 total=286 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 T0373 29 :QADPVQFSQLVVLGAID 2b0lA 175 :AISSLSYSELEAIEHIF T0373 48 :GGD 2b0lA 194 :LDG T0373 51 :VTPSELAAAERMRSSNLA 2b0lA 201 :LVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S Number of specific fragments extracted= 5 number of extra gaps= 3 total=291 Number of alignments=45 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)L47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 T0373 23 :RLRREAQADPVQFSQLVVLGAID 2b0lA 169 :KAVVQMAISSLSYSELEAIEHIF T0373 48 :GGD 2b0lA 194 :LDG T0373 51 :VTPSELAAAERMRSSNLA 2b0lA 201 :LVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 88 :DGRRTRV 2b0lA 238 :KGTYIKV T0373 96 :LSSEGRRNL 2b0lA 245 :LNNKFLIEL Number of specific fragments extracted= 7 number of extra gaps= 4 total=298 Number of alignments=46 # 2b0lA read from 2b0lA/merged-local-a2m # found chain 2b0lA in template set Warning: unaligning (T0373)R46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E193 Warning: unaligning (T0373)A69 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)A220 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)A220 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)E231 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)E231 Warning: unaligning (T0373)H83 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)S234 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)S234 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2b0lA)L235 Warning: unaligning (T0373)P86 because of BadResidue code BAD_PEPTIDE in next template residue (2b0lA)M237 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2b0lA)M237 Warning: unaligning (T0373)G106 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2b0lA)L256 T0373 21 :TRRLRREAQ 2b0lA 169 :KAVVQMAIS T0373 32 :PVQFSQLVVLGAID 2b0lA 178 :SLSYSELEAIEHIF T0373 47 :LGGD 2b0lA 194 :LDGN T0373 51 :VTPSELAAAERMRSSNLA 2b0lA 201 :LVASKIADRVGITRSVIV T0373 71 :LRELERGGL 2b0lA 221 :LRKLESAGV T0373 82 :R 2b0lA 232 :S T0373 88 :DGRRTRV 2b0lA 238 :KGTYIKV T0373 96 :LSSEGRRNLY 2b0lA 245 :LNNKFLIELE Number of specific fragments extracted= 8 number of extra gaps= 5 total=306 Number of alignments=47 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mkmA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1mkmA expands to /projects/compbio/data/pdb/1mkm.pdb.gz 1mkmA:# T0373 read from 1mkmA/merged-local-a2m # 1mkmA read from 1mkmA/merged-local-a2m # adding 1mkmA to template set # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=307 Number of alignments=48 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD T0373 90 :RRTR 1mkmA 56 :KRYV Number of specific fragments extracted= 2 number of extra gaps= 0 total=309 Number of alignments=49 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=310 Number of alignments=50 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDK Number of specific fragments extracted= 1 number of extra gaps= 0 total=311 Number of alignments=51 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=312 Number of alignments=52 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 39 :VVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1mkmA 9 :EILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=313 Number of alignments=53 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDK Number of specific fragments extracted= 1 number of extra gaps= 0 total=314 Number of alignments=54 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD T0373 89 :GRR 1mkmA 56 :KRY Number of specific fragments extracted= 2 number of extra gaps= 0 total=316 Number of alignments=55 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 39 :VVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1mkmA 9 :EILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRK T0373 87 :QDGRRTR 1mkmA 54 :KDKRYVP T0373 100 :GRRNLYGNRAKREE 1mkmA 61 :GYKLIEYGSFVLRR T0373 123 :LD 1mkmA 75 :FN T0373 127 :ERALLAA 1mkmA 77 :IRDIAHD T0373 137 :LLTRLAQF 1mkmA 84 :HLVDIMKR Number of specific fragments extracted= 6 number of extra gaps= 0 total=322 Number of alignments=56 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRK T0373 87 :QDGRRTR 1mkmA 54 :KDKRYVP T0373 109 :AKREE 1mkmA 62 :YKLIE T0373 115 :LVRAMHACLD 1mkmA 67 :YGSFVLRRFN T0373 127 :ERALLAA 1mkmA 77 :IRDIAHD T0373 137 :LLTRLAQFEE 1mkmA 84 :HLVDIMKRTG Number of specific fragments extracted= 6 number of extra gaps= 0 total=328 Number of alignments=57 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDK Number of specific fragments extracted= 1 number of extra gaps= 0 total=329 Number of alignments=58 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD T0373 89 :GRRT 1mkmA 56 :KRYV Number of specific fragments extracted= 2 number of extra gaps= 0 total=331 Number of alignments=59 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRK T0373 87 :QDGRRTR 1mkmA 54 :KDKRYVP T0373 98 :SEGRRNLYGNR 1mkmA 62 :YKLIEYGSFVL T0373 121 :ACLDE 1mkmA 73 :RRFNI T0373 128 :RALLAA 1mkmA 78 :RDIAHD T0373 137 :LLTRLAQ 1mkmA 84 :HLVDIMK Number of specific fragments extracted= 6 number of extra gaps= 0 total=337 Number of alignments=60 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1mkmA 6 :KAFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRK T0373 87 :QDGR 1mkmA 54 :KDKR T0373 94 :VSLSSEGRRNLYG 1mkmA 58 :YVPGYKLIEYGSF T0373 107 :NRAKREEWLVRAM 1mkmA 77 :IRDIAHDHLVDIM T0373 121 :AC 1mkmA 90 :KR Number of specific fragments extracted= 5 number of extra gaps= 0 total=342 Number of alignments=61 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKD Number of specific fragments extracted= 1 number of extra gaps= 0 total=343 Number of alignments=62 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1mkmA 8 :FEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDK Number of specific fragments extracted= 1 number of extra gaps= 0 total=344 Number of alignments=63 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 40 :VLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1mkmA 10 :ILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRK T0373 87 :QDGRRTR 1mkmA 54 :KDKRYVP T0373 98 :SEGRRNLYG 1mkmA 66 :EYGSFVLRR T0373 107 :NRAKREEWLVR 1mkmA 77 :IRDIAHDHLVD T0373 119 :MHACL 1mkmA 88 :IMKRT Number of specific fragments extracted= 5 number of extra gaps= 0 total=349 Number of alignments=64 # 1mkmA read from 1mkmA/merged-local-a2m # found chain 1mkmA in template set T0373 37 :QLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1mkmA 7 :AFEILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRK T0373 87 :QDGRRTR 1mkmA 54 :KDKRYVP T0373 110 :KREEWLVR 1mkmA 63 :KLIEYGSF T0373 119 :MHACLD 1mkmA 71 :VLRRFN T0373 127 :ERALLAAAGPLLTRLA 1mkmA 77 :IRDIAHDHLVDIMKRT Number of specific fragments extracted= 5 number of extra gaps= 0 total=354 Number of alignments=65 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbiA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 2fbiA/merged-local-a2m # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 8 :QLAAHLRSQVTTLTRRLRREAQAD 2fbiA 7 :SLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRR 2fbiA 87 :QRRVYVNLTEKGQQ T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 2fbiA 101 :CFVSMSGDMEKNYQRIQERFGEEKLAQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=359 Number of alignments=66 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 12 :HLRSQVTTLTRRLRREAQAD 2fbiA 11 :TLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEK T0373 115 :LVRAMHACLDESERALLAA 2fbiA 112 :NYQRIQERFGEEKLAQLLE Number of specific fragments extracted= 5 number of extra gaps= 2 total=364 Number of alignments=67 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 8 :QLAAHLRSQVTTLTRRLRREAQAD 2fbiA 7 :SLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRR 2fbiA 87 :QRRVYVNLTEKGQQ T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 2fbiA 101 :CFVSMSGDMEKNYQRIQERFGEEKLAQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=369 Number of alignments=68 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 12 :HLRSQVTTLTRRLRREAQAD 2fbiA 11 :TLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEW 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKN T0373 116 :VRAMHACLDESERALLAAA 2fbiA 113 :YQRIQERFGEEKLAQLLEL Number of specific fragments extracted= 5 number of extra gaps= 2 total=374 Number of alignments=69 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 8 :QLAAHLRSQVTTLTRRLRREAQAD 2fbiA 7 :SLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQR T0373 119 :MHACLDESERALL 2fbiA 116 :IQERFGEEKLAQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=379 Number of alignments=70 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 12 :HLRSQVTTLTRRLRREAQAD 2fbiA 11 :TLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQR T0373 119 :MHACLDESERALLA 2fbiA 116 :IQERFGEEKLAQLL Number of specific fragments extracted= 5 number of extra gaps= 2 total=384 Number of alignments=71 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQAD 2fbiA 6 :PSLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEK T0373 115 :LVRAMHACLDESERALLAA 2fbiA 112 :NYQRIQERFGEEKLAQLLE T0373 137 :LLTRLAQF 2fbiA 131 :LLNELKKI Number of specific fragments extracted= 6 number of extra gaps= 2 total=390 Number of alignments=72 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQAD 2fbiA 6 :PSLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEK T0373 115 :LVRAMHACLDESERALLAA 2fbiA 112 :NYQRIQERFGEEKLAQLLE T0373 137 :LLTRLAQ 2fbiA 131 :LLNELKK Number of specific fragments extracted= 6 number of extra gaps= 2 total=396 Number of alignments=73 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 Warning: unaligning (T0373)E146 because last residue in template chain is (2fbiA)P140 T0373 14 :RSQVTTLTRRLRREAQAD 2fbiA 13 :LQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEK T0373 115 :LVRAMHACLDESERALLAA 2fbiA 112 :NYQRIQERFGEEKLAQLLE T0373 137 :LLTRLAQFE 2fbiA 131 :LLNELKKIK Number of specific fragments extracted= 6 number of extra gaps= 2 total=402 Number of alignments=74 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 3 :TNQDLQLA 2fbiA 6 :PSLTLTLL T0373 15 :SQVTTLTRRLRREAQAD 2fbiA 14 :QAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRLGG 2fbiA 33 :TEQQWRVIRILRQQGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 49 :MESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEK T0373 115 :LVRAMHACLDESERALLAA 2fbiA 112 :NYQRIQERFGEEKLAQLLE T0373 137 :LLTRLAQF 2fbiA 131 :LLNELKKI Number of specific fragments extracted= 7 number of extra gaps= 2 total=409 Number of alignments=75 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQAD 2fbiA 6 :PSLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDR 2fbiA 33 :TEQQWRVIRILRQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 46 :QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQ T0373 121 :ACLDESERALLAAAGPLLTRL 2fbiA 118 :ERFGEEKLAQLLELLNELKKI Number of specific fragments extracted= 5 number of extra gaps= 2 total=414 Number of alignments=76 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQAD 2fbiA 6 :PSLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDR 2fbiA 33 :TEQQWRVIRILRQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 46 :QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQ T0373 121 :ACLDESERALLAAAGPLLTRL 2fbiA 118 :ERFGEEKLAQLLELLNELKKI Number of specific fragments extracted= 5 number of extra gaps= 2 total=419 Number of alignments=77 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 Warning: unaligning (T0373)E146 because last residue in template chain is (2fbiA)P140 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQAD 2fbiA 6 :PSLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRL 2fbiA 33 :TEQQWRVIRILRQQ T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 47 :GEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQ T0373 121 :ACLDESERALLAA 2fbiA 118 :ERFGEEKLAQLLE T0373 137 :LLTRLAQFE 2fbiA 131 :LLNELKKIK Number of specific fragments extracted= 6 number of extra gaps= 2 total=425 Number of alignments=78 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2fbiA)R5 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 3 :TNQDLQL 2fbiA 6 :PSLTLTL T0373 14 :RSQVTTLTRRLRREAQAD 2fbiA 13 :LQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDRL 2fbiA 33 :TEQQWRVIRILRQQ T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 47 :GEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQRIQ T0373 121 :ACLDESERALLAA 2fbiA 118 :ERFGEEKLAQLLE T0373 137 :LLTRLAQFE 2fbiA 131 :LLNELKKIK Number of specific fragments extracted= 7 number of extra gaps= 2 total=432 Number of alignments=79 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 8 :QLAAHLRSQVTTLTRRLRREAQAD 2fbiA 7 :SLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDR 2fbiA 33 :TEQQWRVIRILRQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 46 :QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQR T0373 119 :MHACLDESERALL 2fbiA 116 :IQERFGEEKLAQL Number of specific fragments extracted= 5 number of extra gaps= 2 total=437 Number of alignments=80 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 8 :QLAAHLRSQVTTLTRRLRREAQAD 2fbiA 7 :SLTLTLLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDR 2fbiA 33 :TEQQWRVIRILRQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 46 :QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQR T0373 119 :MHACLDESERALLAAA 2fbiA 116 :IQERFGEEKLAQLLEL Number of specific fragments extracted= 5 number of extra gaps= 2 total=442 Number of alignments=81 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 13 :LRSQVTTLTRRLRREAQAD 2fbiA 12 :LLQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDR 2fbiA 33 :TEQQWRVIRILRQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 46 :QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQR T0373 119 :MHACLDESERALLAAAG 2fbiA 116 :IQERFGEEKLAQLLELL T0373 140 :RLAQFEE 2fbiA 133 :NELKKIK Number of specific fragments extracted= 6 number of extra gaps= 2 total=448 Number of alignments=82 # 2fbiA read from 2fbiA/merged-local-a2m # found chain 2fbiA in template set Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbiA)L32 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbiA)L32 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE in next template residue (2fbiA)D86 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2fbiA)D86 T0373 14 :RSQVTTLTRRLRREAQAD 2fbiA 13 :LQAREAAMSFFRPSLNQH T0373 34 :QFSQLVVLGAIDR 2fbiA 33 :TEQQWRVIRILRQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2fbiA 46 :QGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAP T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbiA 87 :QRRVYVNLTEKGQQCFVSMSGDMEKNYQR T0373 119 :MHACLDESERALLAAAGPL 2fbiA 116 :IQERFGEEKLAQLLELLNE Number of specific fragments extracted= 5 number of extra gaps= 2 total=453 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fswA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fswA expands to /projects/compbio/data/pdb/2fsw.pdb.gz 2fswA:Skipped atom 36, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 38, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 40, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 46, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 48, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 50, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 52, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 54, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 56, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 58, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 60, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 62, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 64, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 66, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 68, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 70, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 72, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 74, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 76, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 78, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 80, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 82, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 84, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 86, because occupancy 0.500 <= existing 0.500 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 179, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 181, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 183, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 185, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 187, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 189, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 191, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 193, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 195, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 324, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 326, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 328, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 330, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 342, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 344, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 362, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 364, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 366, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 368, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 370, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 372, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 374, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 376, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 378, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 397, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 399, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 401, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 403, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 405, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 407, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 409, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 411, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 413, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 415, because occupancy 0.400 <= existing 0.600 in 2fswA Skipped atom 417, because occupancy 0.400 <= existing 0.600 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 524, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 526, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 532, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 534, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 536, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 538, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 540, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 609, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 611, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 613, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 615, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 617, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 619, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 621, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 623, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 625, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 694, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 696, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 698, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 700, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 702, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 704, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 706, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 708, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 710, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 712, because occupancy 0.500 <= existing 0.500 in 2fswA Skipped atom 714, because occupancy 0.500 <= existing 0.500 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 894, because occupancy 0.400 <= existing 0.600 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 896, because occupancy 0.400 <= existing 0.600 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 898, because occupancy 0.400 <= existing 0.600 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 900, because occupancy 0.400 <= existing 0.600 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 902, because occupancy 0.400 <= existing 0.600 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 904, because occupancy 0.400 <= existing 0.600 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 906, because occupancy 0.300 <= existing 0.340 in 2fswA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 908, because occupancy 0.400 <= existing 0.600 in 2fswA # T0373 read from 2fswA/merged-local-a2m # 2fswA read from 2fswA/merged-local-a2m # adding 2fswA to template set # found chain 2fswA in template set T0373 47 :LGGDVTPSELAAAE 2fswA 32 :NRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=455 Number of alignments=84 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 48 :GGDVTPSELAAAE 2fswA 33 :RRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEK Number of specific fragments extracted= 2 number of extra gaps= 0 total=457 Number of alignments=85 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 47 :LGGDVTPSELAAAE 2fswA 32 :NRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=459 Number of alignments=86 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 47 :LGGDVTPSELAAAE 2fswA 32 :NRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEK Number of specific fragments extracted= 2 number of extra gaps= 0 total=461 Number of alignments=87 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 47 :LGGDVTPSELAAAE 2fswA 32 :NRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGE Number of specific fragments extracted= 2 number of extra gaps= 0 total=463 Number of alignments=88 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 48 :GGDVTPSELAAAE 2fswA 33 :RRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEK Number of specific fragments extracted= 2 number of extra gaps= 0 total=465 Number of alignments=89 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set Warning: unaligning (T0373)T18 because first residue in template chain is (2fswA)R3 Warning: unaligning (T0373)T19 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fswA)K4 T0373 20 :LTRRLRREAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAE 2fswA 5 :ISDEECPVRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAK 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEI Number of specific fragments extracted= 2 number of extra gaps= 0 total=467 Number of alignments=90 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 30 :ADPVQFSQLVVLGAIDRLGGDVTPSELAAAE 2fswA 15 :SMQIFAGKWTLLIIFQINRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIA Number of specific fragments extracted= 2 number of extra gaps= 0 total=469 Number of alignments=91 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 38 :LVVLGAIDR 2fswA 25 :LLIIFQINR T0373 49 :GDVTPSELAAAE 2fswA 34 :RIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKF T0373 115 :LV 2fswA 100 :GM Number of specific fragments extracted= 4 number of extra gaps= 0 total=473 Number of alignments=92 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 41 :LGAIDRLGGD 2fswA 25 :LLIIFQINRR T0373 51 :VTPSELAAAE 2fswA 36 :IRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEG 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLG T0373 105 :YGNRAKREE 2fswA 87 :EKVLPIIDE T0373 115 :LVRAMHA 2fswA 96 :IAKFGME Number of specific fragments extracted= 5 number of extra gaps= 0 total=478 Number of alignments=93 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set Warning: unaligning (T0373)T18 because first residue in template chain is (2fswA)R3 Warning: unaligning (T0373)T19 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fswA)K4 Warning: unaligning (T0373)A118 because last residue in template chain is (2fswA)L104 T0373 20 :LTRRLRREAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAE 2fswA 5 :ISDEECPVRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGMEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=480 Number of alignments=94 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 21 :TRRLRREAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAE 2fswA 6 :SDEECPVRKSMQIFAGKWTLLIIFQINRRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=482 Number of alignments=95 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 25 :RREAQA 2fswA 16 :MQIFAG T0373 35 :FSQLVVLGAID 2fswA 22 :KWTLLIIFQIN T0373 48 :GGDVTPSELAAAE 2fswA 33 :RRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLV 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFGME Number of specific fragments extracted= 4 number of extra gaps= 0 total=486 Number of alignments=96 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 30 :ADP 2fswA 20 :AGK T0373 36 :SQLVVLGAID 2fswA 23 :WTLLIIFQIN T0373 48 :GGDVTPSELAAAE 2fswA 33 :RRIIRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEG 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLG T0373 105 :YGNRAKREEWLVRAM 2fswA 87 :EKVLPIIDEIAKFGM T0373 121 :A 2fswA 102 :E Number of specific fragments extracted= 6 number of extra gaps= 0 total=492 Number of alignments=97 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set Warning: unaligning (T0373)T18 because first residue in template chain is (2fswA)R3 Warning: unaligning (T0373)T19 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fswA)K4 T0373 20 :LTRRLRREAQADPVQFSQLVVLGAIDR 2fswA 5 :ISDEECPVRKSMQIFAGKWTLLIIFQI T0373 48 :GGD 2fswA 32 :NRR T0373 51 :VTPSELAAAE 2fswA 36 :IRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAK 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEI Number of specific fragments extracted= 4 number of extra gaps= 0 total=496 Number of alignments=98 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 27 :EAQADPVQFSQLVVLGAIDR 2fswA 12 :VRKSMQIFAGKWTLLIIFQI T0373 48 :GGD 2fswA 32 :NRR T0373 51 :VTPSELAAAE 2fswA 36 :IRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIA Number of specific fragments extracted= 4 number of extra gaps= 0 total=500 Number of alignments=99 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 41 :LGAIDRLGGD 2fswA 25 :LLIIFQINRR T0373 51 :VTPSELAAAE 2fswA 36 :IRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEW 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGEKVLPIIDEIAKFG Number of specific fragments extracted= 3 number of extra gaps= 0 total=503 Number of alignments=100 # 2fswA read from 2fswA/merged-local-a2m # found chain 2fswA in template set T0373 40 :VLGAIDRLGGD 2fswA 24 :TLLIIFQINRR T0373 51 :VTPSELAAAE 2fswA 36 :IRYGELKRAI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 2fswA 47 :GISEKMLIDELKFLCGKGLIKKKQYPEVPPRVEYSLTPLGE T0373 106 :GNRAKREEWLVR 2fswA 88 :KVLPIIDEIAKF T0373 119 :MHA 2fswA 100 :GME Number of specific fragments extracted= 5 number of extra gaps= 0 total=508 Number of alignments=101 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fu4A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fu4A expands to /projects/compbio/data/pdb/2fu4.pdb.gz 2fu4A:Skipped atom 148, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 152, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 154, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 156, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 158, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 600, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 608, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 610, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 647, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 649, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 651, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 653, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 2fu4A Skipped atom 659, because occupancy 0.500 <= existing 0.500 in 2fu4A # T0373 read from 2fu4A/merged-local-a2m # 2fu4A read from 2fu4A/merged-local-a2m # adding 2fu4A to template set # found chain 2fu4A in template set T0373 71 :LRELERGGLIVRHADPQDGRR 2fu4A 59 :LNQFDDAGIVTRHNFEGGKSV Number of specific fragments extracted= 1 number of extra gaps= 0 total=509 Number of alignments=102 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 38 :LVVLGAIDRLGG 2fu4A 20 :LKILEVLQEPDN T0373 50 :DVTPSELAAAERMRS 2fu4A 33 :HVSAEDLYKRLIDMG T0373 65 :SNLAALLRELERGGLIVRHADPQ 2fu4A 53 :ATVYRVLNQFDDAGIVTRHNFEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=512 Number of alignments=103 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 71 :LRELERGGLIVRHADPQDGRR 2fu4A 59 :LNQFDDAGIVTRHNFEGGKSV Number of specific fragments extracted= 1 number of extra gaps= 0 total=513 Number of alignments=104 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 38 :LVVLGAIDRLG 2fu4A 20 :LKILEVLQEPD T0373 49 :GDVTPSELAAAERMRS 2fu4A 32 :HHVSAEDLYKRLIDMG T0373 65 :SNL 2fu4A 50 :IGL T0373 68 :AALLRELERGGLIVRHADP 2fu4A 56 :YRVLNQFDDAGIVTRHNFE Number of specific fragments extracted= 4 number of extra gaps= 0 total=517 Number of alignments=105 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 71 :LRELERGGLIVRHADPQDGRR 2fu4A 59 :LNQFDDAGIVTRHNFEGGKSV Number of specific fragments extracted= 1 number of extra gaps= 0 total=518 Number of alignments=106 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 39 :VVLGAIDR 2fu4A 21 :KILEVLQE T0373 47 :LGGDVTPSELAAAERMR 2fu4A 30 :DNHHVSAEDLYKRLIDM T0373 64 :SSNLAALLRELERGGLIVRHADP 2fu4A 52 :LATVYRVLNQFDDAGIVTRHNFE Number of specific fragments extracted= 3 number of extra gaps= 0 total=521 Number of alignments=107 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 29 :QADPVQFSQLVVLGAIDRLGGD 2fu4A 11 :AGLKVTLPRLKILEVLQEPDNH T0373 51 :VTPSELAAAE 2fu4A 34 :VSAEDLYKRL T0373 61 :RMRSSNLAALLRELERGGLIVRH 2fu4A 49 :EIGLATVYRVLNQFDDAGIVTRH Number of specific fragments extracted= 3 number of extra gaps= 0 total=524 Number of alignments=108 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 30 :ADPVQFSQLVVLGAIDRLGGD 2fu4A 12 :GLKVTLPRLKILEVLQEPDNH T0373 51 :VTPSELAAAE 2fu4A 34 :VSAEDLYKRL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 2fu4A 49 :EIGLATVYRVLNQFDDAGIVTRHNFEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=527 Number of alignments=109 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 25 :RREAQADP 2fu4A 5 :NTALKKAG T0373 33 :VQFSQLVVLGAIDRLGGD 2fu4A 15 :VTLPRLKILEVLQEPDNH T0373 51 :VTPSELAAAE 2fu4A 34 :VSAEDLYKRL T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRT 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRHNFEGGKSVF Number of specific fragments extracted= 4 number of extra gaps= 0 total=531 Number of alignments=110 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 27 :EAQADPV 2fu4A 7 :ALKKAGL T0373 34 :QFSQLVVLGAIDR 2fu4A 16 :TLPRLKILEVLQE T0373 48 :GG 2fu4A 29 :PD T0373 50 :DVTPSELAAAE 2fu4A 33 :HVSAEDLYKRL T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRR 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRHNFEGGKSV T0373 94 :VSL 2fu4A 80 :FEL Number of specific fragments extracted= 6 number of extra gaps= 0 total=537 Number of alignments=111 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 29 :QADPVQFSQLVVLGAIDRLGG 2fu4A 11 :AGLKVTLPRLKILEVLQEPDN T0373 50 :DVTPSELAAAE 2fu4A 33 :HVSAEDLYKRL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDG 2fu4A 49 :EIGLATVYRVLNQFDDAGIVTRHNFEGGK Number of specific fragments extracted= 3 number of extra gaps= 0 total=540 Number of alignments=112 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 27 :EAQADP 2fu4A 7 :ALKKAG T0373 33 :VQFSQLVVLGAIDRLGG 2fu4A 15 :VTLPRLKILEVLQEPDN T0373 50 :DVTPSELAAAE 2fu4A 33 :HVSAEDLYKRL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGR 2fu4A 49 :EIGLATVYRVLNQFDDAGIVTRHNFEGGKS Number of specific fragments extracted= 4 number of extra gaps= 0 total=544 Number of alignments=113 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 25 :RREAQADPV 2fu4A 5 :NTALKKAGL T0373 34 :QFSQLVVLGAIDR 2fu4A 16 :TLPRLKILEVLQE T0373 48 :G 2fu4A 29 :P T0373 49 :GDVTPSELAAAE 2fu4A 32 :HHVSAEDLYKRL T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRT 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRHNFEGGKSVF Number of specific fragments extracted= 5 number of extra gaps= 0 total=549 Number of alignments=114 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set Warning: unaligning (T0373)S97 because last residue in template chain is (2fu4A)T83 T0373 26 :REAQADPV 2fu4A 6 :TALKKAGL T0373 34 :QFSQLVVLGAIDR 2fu4A 16 :TLPRLKILEVLQE T0373 48 :GG 2fu4A 29 :PD T0373 50 :DVTPSELAAAE 2fu4A 33 :HVSAEDLYKRL T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRR 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRHNFEGGKSV T0373 94 :VSL 2fu4A 80 :FEL Number of specific fragments extracted= 6 number of extra gaps= 0 total=555 Number of alignments=115 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 29 :QADPVQFSQLVVLGAIDR 2fu4A 11 :AGLKVTLPRLKILEVLQE T0373 48 :GGD 2fu4A 29 :PDN T0373 51 :VTPSELAAAER 2fu4A 34 :VSAEDLYKRLI T0373 62 :MRSSNLAALLRELERGGLIVRH 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRH Number of specific fragments extracted= 4 number of extra gaps= 0 total=559 Number of alignments=116 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 29 :QADPVQFSQLVVLGAIDR 2fu4A 11 :AGLKVTLPRLKILEVLQE T0373 48 :GGD 2fu4A 29 :PDN T0373 51 :VTPSELAAAE 2fu4A 34 :VSAEDLYKRL T0373 62 :MRSSNLAALLRELERGGLIVRHAD 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRHNF Number of specific fragments extracted= 4 number of extra gaps= 0 total=563 Number of alignments=117 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 25 :RREAQADPV 2fu4A 5 :NTALKKAGL T0373 34 :QFSQLVVLGAIDR 2fu4A 16 :TLPRLKILEVLQE T0373 48 :GGD 2fu4A 29 :PDN T0373 51 :VTPSELAAAE 2fu4A 34 :VSAEDLYKRL T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRT 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRHNFEGGKSVF Number of specific fragments extracted= 5 number of extra gaps= 0 total=568 Number of alignments=118 # 2fu4A read from 2fu4A/merged-local-a2m # found chain 2fu4A in template set T0373 27 :EAQADPV 2fu4A 7 :ALKKAGL T0373 34 :QFSQLVVLGAIDR 2fu4A 16 :TLPRLKILEVLQE T0373 48 :GG 2fu4A 29 :PD T0373 51 :VTPSELAAAE 2fu4A 34 :VSAEDLYKRL T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTR 2fu4A 50 :IGLATVYRVLNQFDDAGIVTRHNFEGGKSVFE Number of specific fragments extracted= 5 number of extra gaps= 0 total=573 Number of alignments=119 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cfxA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cfxA expands to /projects/compbio/data/pdb/2cfx.pdb.gz 2cfxA:# T0373 read from 2cfxA/merged-local-a2m # 2cfxA read from 2cfxA/merged-local-a2m # adding 2cfxA to template set # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVR 2cfxA 35 :SVTERVRQLESFGIIKQ Number of specific fragments extracted= 2 number of extra gaps= 1 total=575 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQD 2cfxA 55 :EVD Number of specific fragments extracted= 3 number of extra gaps= 2 total=578 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVR 2cfxA 35 :SVTERVRQLESFGIIKQ Number of specific fragments extracted= 2 number of extra gaps= 1 total=580 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGR 2cfxA 55 :EVDQK Number of specific fragments extracted= 3 number of extra gaps= 2 total=583 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVR 2cfxA 35 :SVTERVRQLESFGIIKQ Number of specific fragments extracted= 2 number of extra gaps= 1 total=585 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQD 2cfxA 55 :EVD Number of specific fragments extracted= 3 number of extra gaps= 2 total=588 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 33 :VQFSQLVVLGAIDR 2cfxA 3 :LDQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGRRTRVSLS 2cfxA 55 :EVDQKKLGLPVS Number of specific fragments extracted= 4 number of extra gaps= 2 total=592 Number of alignments=120 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 34 :QFSQLVVLGAIDR 2cfxA 4 :DQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGRRTRVSL 2cfxA 55 :EVDQKKLGLPV Number of specific fragments extracted= 4 number of extra gaps= 2 total=596 Number of alignments=121 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 1 :MPTNQDL 2cfxA 1 :MKLDQID T0373 22 :RRLRREAQA 2cfxA 8 :LNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGR 2cfxA 55 :EVDQK T0373 91 :RTRVSLSSE 2cfxA 66 :SCIVEATVK T0373 106 :GNRAKREE 2cfxA 76 :ADYERFKS Number of specific fragments extracted= 7 number of extra gaps= 2 total=603 Number of alignments=122 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 32 :PVQFSQLVVLGAIDR 2cfxA 2 :KLDQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGRRTRVSLS 2cfxA 61 :LGLPVSCIVEAT T0373 98 :SEGRRNLYGN 2cfxA 79 :ERFKSYIQTL T0373 108 :RAKREE 2cfxA 112 :LEAVED T0373 115 :LVRAMHA 2cfxA 118 :FINKTSP Number of specific fragments extracted= 7 number of extra gaps= 2 total=610 Number of alignments=123 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 33 :VQFSQLVVLGAIDR 2cfxA 3 :LDQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGRR 2cfxA 55 :EVDQKK Number of specific fragments extracted= 4 number of extra gaps= 2 total=614 Number of alignments=124 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 33 :VQFSQLVVLGAIDR 2cfxA 3 :LDQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGRRTRV 2cfxA 55 :EVDQKKLGL Number of specific fragments extracted= 4 number of extra gaps= 2 total=618 Number of alignments=125 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)R82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 1 :MPTNQD 2cfxA 1 :MKLDQI T0373 21 :TRRLRREAQA 2cfxA 7 :DLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLI 2cfxA 35 :SVTERVRQLESFGII T0373 83 :HADPQD 2cfxA 55 :EVDQKK T0373 89 :GRRTRVSLS 2cfxA 64 :PVSCIVEAT T0373 100 :GRRNLYGNR 2cfxA 77 :DYERFKSYI Number of specific fragments extracted= 7 number of extra gaps= 2 total=625 Number of alignments=126 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)D31 because first residue in template chain is (2cfxA)M1 Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)R82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 32 :PVQFSQLVVLGAIDR 2cfxA 2 :KLDQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLI 2cfxA 35 :SVTERVRQLESFGII T0373 83 :HAD 2cfxA 55 :EVD T0373 86 :PQDGRRTRVSLS 2cfxA 61 :LGLPVSCIVEAT T0373 98 :SEGRRNLYGN 2cfxA 79 :ERFKSYIQTL T0373 108 :RAKREEWLVRA 2cfxA 112 :LEAVEDFINKT Number of specific fragments extracted= 7 number of extra gaps= 2 total=632 Number of alignments=127 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 33 :VQFSQLVVLGAIDR 2cfxA 3 :LDQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGRR 2cfxA 55 :EVDQKK Number of specific fragments extracted= 4 number of extra gaps= 2 total=636 Number of alignments=128 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 34 :QFSQLVVLGAIDR 2cfxA 4 :DQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGRRTRV 2cfxA 55 :EVDQKKLGL Number of specific fragments extracted= 4 number of extra gaps= 2 total=640 Number of alignments=129 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 Warning: unaligning (T0373)A84 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2cfxA)L54 Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2cfxA)L54 T0373 24 :LRREAQA 2cfxA 10 :IIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 86 :PQDGR 2cfxA 55 :EVDQK T0373 91 :RTRVSLS 2cfxA 66 :SCIVEAT Number of specific fragments extracted= 5 number of extra gaps= 2 total=645 Number of alignments=130 # 2cfxA read from 2cfxA/merged-local-a2m # found chain 2cfxA in template set Warning: unaligning (T0373)S64 because of BadResidue code BAD_PEPTIDE in next template residue (2cfxA)P34 Warning: unaligning (T0373)S65 because of BadResidue code BAD_PEPTIDE at template residue (2cfxA)P34 T0373 32 :PVQFSQLVVLGAIDR 2cfxA 2 :KLDQIDLNIIEELKK T0373 48 :GGDVTPSELAAAERMR 2cfxA 17 :DSRLSMRELGRKIKLS T0373 66 :NLAALLRELERGGLIVRH 2cfxA 35 :SVTERVRQLESFGIIKQY T0373 85 :DPQDGRRTRVSLS 2cfxA 60 :KLGLPVSCIVEAT T0373 98 :SEGRRNLYGN 2cfxA 79 :ERFKSYIQTL Number of specific fragments extracted= 5 number of extra gaps= 1 total=650 Number of alignments=131 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ddnA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ddnA expands to /projects/compbio/data/pdb/1ddn.pdb.gz 1ddnA:# T0373 read from 1ddnA/merged-local-a2m # 1ddnA read from 1ddnA/merged-local-a2m # adding 1ddnA to template set # found chain 1ddnA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ddnA 12 :LRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 87 :QDGRRTRVSLSSEG 1ddnA 65 :TPTGRTLATAVMRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=652 Number of alignments=132 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1ddnA 22 :GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD Number of specific fragments extracted= 1 number of extra gaps= 0 total=653 Number of alignments=133 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 46 :RLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1ddnA 20 :EEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 90 :RRTRVSLSSEGRRN 1ddnA 58 :SDRSLQMTPTGRTL T0373 104 :LYGNRAKREEWLVR 1ddnA 75 :VMRKHRLAERLLTD Number of specific fragments extracted= 3 number of extra gaps= 0 total=656 Number of alignments=134 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1ddnA 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKRE 1ddnA 60 :RSLQMTPTGRTLATAVMRKHR T0373 115 :LVRAMHACLDESERALLAA 1ddnA 81 :LAERLLTDIIGLDINKVHD T0373 137 :LLTRLAQFEEP 1ddnA 100 :EADRWEHVMSD Number of specific fragments extracted= 4 number of extra gaps= 0 total=660 Number of alignments=135 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1ddnA 10 :MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKRE 1ddnA 60 :RSLQMTPTGRTLATAVMRKHR T0373 115 :LVRAMHACL 1ddnA 81 :LAERLLTDI Number of specific fragments extracted= 3 number of extra gaps= 0 total=663 Number of alignments=136 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1ddnA)L120 T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1ddnA 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGRR 1ddnA 58 :SDRSL T0373 95 :SLSSEGRRNLYGNRAKRE 1ddnA 63 :QMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHAC 1ddnA 81 :LAERLLTDI T0373 123 :LDESERALLAAAG 1ddnA 92 :LDINKVHDEADRW T0373 136 :PLLTRLAQF 1ddnA 111 :EVERRLVKV Number of specific fragments extracted= 6 number of extra gaps= 0 total=669 Number of alignments=137 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1ddnA 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1ddnA 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKRE 1ddnA 62 :LQMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHAC 1ddnA 81 :LAERLLTDI T0373 123 :LDESERALLAA 1ddnA 108 :MSDEVERRLVK Number of specific fragments extracted= 5 number of extra gaps= 0 total=674 Number of alignments=138 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1ddnA 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1ddnA 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1ddnA 88 :DIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=677 Number of alignments=139 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 34 :QFSQLVVLGAIDR 1ddnA 8 :TEMYLRTIYELEE T0373 48 :GG 1ddnA 21 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1ddnA 24 :TPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1ddnA 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1ddnA 88 :DIIGLD Number of specific fragments extracted= 5 number of extra gaps= 0 total=682 Number of alignments=140 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 36 :SQLVVLGAIDRL 1ddnA 7 :TTEMYLRTIYEL T0373 48 :GG 1ddnA 21 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVR 1ddnA 24 :TPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 86 :PQDGR 1ddnA 57 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1ddnA 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :A 1ddnA 88 :D T0373 122 :CLDESERALLAAA 1ddnA 91 :GLDINKVHDEADR Number of specific fragments extracted= 7 number of extra gaps= 0 total=689 Number of alignments=141 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1ddnA)L120 T0373 34 :QFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1ddnA 8 :TEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1ddnA 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKR 1ddnA 62 :LQMTPTGRTLATAVMRKH T0373 113 :EWLVRAMHA 1ddnA 80 :RLAERLLTD T0373 122 :CLD 1ddnA 91 :GLD T0373 125 :ESERALLAAAG 1ddnA 95 :NKVHDEADRWE T0373 136 :PLLTRLAQF 1ddnA 111 :EVERRLVKV Number of specific fragments extracted= 7 number of extra gaps= 0 total=696 Number of alignments=142 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 39 :VVLGAIDRLGGD 1ddnA 10 :MYLRTIYELEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1ddnA 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1ddnA 60 :RSLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLDES 1ddnA 86 :LTDIIGLD Number of specific fragments extracted= 4 number of extra gaps= 0 total=700 Number of alignments=143 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 35 :FSQLVVLGAIDR 1ddnA 9 :EMYLRTIYELEE T0373 50 :D 1ddnA 21 :E T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ddnA 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1ddnA 61 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1ddnA 86 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=705 Number of alignments=144 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 37 :QLVVLGAIDRLGGD 1ddnA 8 :TEMYLRTIYELEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1ddnA 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVR 1ddnA 62 :LQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1ddnA 86 :LTDIIG Number of specific fragments extracted= 4 number of extra gaps= 0 total=709 Number of alignments=145 # 1ddnA read from 1ddnA/merged-local-a2m # found chain 1ddnA in template set T0373 35 :FSQLVVLGAIDR 1ddnA 9 :EMYLRTIYELEE T0373 48 :GGD 1ddnA 21 :EGV T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ddnA 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKRE 1ddnA 61 :SLQMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHA 1ddnA 81 :LAERLLTD T0373 122 :CLDESERALLAA 1ddnA 107 :VMSDEVERRLVK Number of specific fragments extracted= 6 number of extra gaps= 0 total=715 Number of alignments=146 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lnwA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1lnwA/merged-local-a2m # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLA T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 1lnwA 104 :IHQHAEAIMSRVHDELFAPLTPVEQATL Number of specific fragments extracted= 4 number of extra gaps= 0 total=719 Number of alignments=147 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 6 :DLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 6 :NPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERALLAA 1lnwA 119 :LFAPLTPVEQATLVH Number of specific fragments extracted= 4 number of extra gaps= 0 total=723 Number of alignments=148 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLA T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 1lnwA 104 :IHQHAEAIMSRVHDELFAPLTPVEQATL Number of specific fragments extracted= 4 number of extra gaps= 0 total=727 Number of alignments=149 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQ 1lnwA 7 :PDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVH T0373 117 :RAMHACLDESERALLAA 1lnwA 117 :DELFAPLTPVEQATLVH Number of specific fragments extracted= 4 number of extra gaps= 0 total=731 Number of alignments=150 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRRE 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSE T0373 28 :AQADPVQFSQLVVLGAIDRLGG 1lnwA 30 :CQRLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERALL 1lnwA 119 :LFAPLTPVEQATL Number of specific fragments extracted= 4 number of extra gaps= 0 total=735 Number of alignments=151 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRRE 1lnwA 5 :VNPDLMPALMAVFQHVRTRIQSE T0373 28 :AQADPVQFSQLVVLGAIDRLGG 1lnwA 30 :CQRLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERALL 1lnwA 119 :LFAPLTPVEQATL Number of specific fragments extracted= 4 number of extra gaps= 0 total=739 Number of alignments=152 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSR T0373 115 :LVRAMHACLDESERALLAA 1lnwA 115 :VHDELFAPLTPVEQATLVH T0373 137 :LLTRLAQ 1lnwA 134 :LLDQCLA Number of specific fragments extracted= 5 number of extra gaps= 0 total=744 Number of alignments=153 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSR T0373 115 :LVRAMHACLDESERALLAA 1lnwA 115 :VHDELFAPLTPVEQATLVH T0373 137 :LLTRLAQ 1lnwA 134 :LLDQCLA Number of specific fragments extracted= 5 number of extra gaps= 0 total=749 Number of alignments=154 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1lnwA)Q142 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSR T0373 115 :LVRAMHACLDESERALLAA 1lnwA 115 :VHDELFAPLTPVEQATLVH T0373 137 :LLTRLAQF 1lnwA 134 :LLDQCLAA Number of specific fragments extracted= 5 number of extra gaps= 0 total=754 Number of alignments=155 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 2 :PTNQDLQLAAHLRSQVTTLTRRLRRE 1lnwA 6 :NPDLMPALMAVFQHVRTRIQSELDCQ T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSR T0373 115 :LVRAMHACLDESERALLAA 1lnwA 115 :VHDELFAPLTPVEQATLVH T0373 137 :LLTRLAQF 1lnwA 134 :LLDQCLAA Number of specific fragments extracted= 5 number of extra gaps= 0 total=759 Number of alignments=156 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELF T0373 121 :ACLDESERALLAA 1lnwA 121 :APLTPVEQATLVH T0373 137 :LLTRLAQ 1lnwA 134 :LLDQCLA Number of specific fragments extracted= 5 number of extra gaps= 0 total=764 Number of alignments=157 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELF T0373 121 :ACLDESERALLAA 1lnwA 121 :APLTPVEQATLVH T0373 137 :LLTRLAQ 1lnwA 134 :LLDQCLA Number of specific fragments extracted= 5 number of extra gaps= 0 total=769 Number of alignments=158 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1lnwA)N2 Warning: unaligning (T0373)E145 because last residue in template chain is (1lnwA)Q142 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQ 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELD T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELF T0373 121 :ACLDESERALLAA 1lnwA 121 :APLTPVEQATLVH T0373 137 :LLTRLAQF 1lnwA 134 :LLDQCLAA Number of specific fragments extracted= 5 number of extra gaps= 0 total=774 Number of alignments=159 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1lnwA)Q142 T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRRE 1lnwA 5 :VNPDLMPALMAVFQHVRTRIQSELDCQ T0373 30 :ADPVQFSQLVVLGAIDRLGG 1lnwA 32 :RLDLTPPDVHVLKLIDEQRG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lnwA 52 :LNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDELF T0373 121 :ACLDESERALLAA 1lnwA 121 :APLTPVEQATLVH T0373 137 :LLTRLAQF 1lnwA 134 :LLDQCLAA Number of specific fragments extracted= 5 number of extra gaps= 0 total=779 Number of alignments=160 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 49 :QRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERALL 1lnwA 119 :LFAPLTPVEQATL Number of specific fragments extracted= 3 number of extra gaps= 0 total=782 Number of alignments=161 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1lnwA 9 :LMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 49 :QRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERALLAAA 1lnwA 119 :LFAPLTPVEQATLVHL Number of specific fragments extracted= 3 number of extra gaps= 0 total=785 Number of alignments=162 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1lnwA 3 :YPVNPDLMPALMAVFQHVRTRIQSELDCQRLDLTPPDVHVLKLIDE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 49 :QRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERAL 1lnwA 119 :LFAPLTPVEQAT Number of specific fragments extracted= 3 number of extra gaps= 0 total=788 Number of alignments=163 # 1lnwA read from 1lnwA/merged-local-a2m # found chain 1lnwA in template set T0373 14 :RSQVTTLTRRLRREAQADP 1lnwA 14 :MAVFQHVRTRIQSELDCQR T0373 33 :VQFSQLVVLGAIDR 1lnwA 35 :LTPPDVHVLKLIDE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lnwA 49 :QRGLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPSDQRSFQLFLTDEGLAIHQHAEAIMSRVHDE T0373 119 :MHACLDESERALLAAAGPL 1lnwA 119 :LFAPLTPVEQATLVHLLDQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=792 Number of alignments=164 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z7uA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1z7uA/merged-local-a2m # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 47 :LGGDVTPSELAAAE 1z7uA 29 :FQGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYA Number of specific fragments extracted= 2 number of extra gaps= 0 total=794 Number of alignments=165 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 47 :LGGDVTPSELAAAE 1z7uA 29 :FQGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYA Number of specific fragments extracted= 2 number of extra gaps= 0 total=796 Number of alignments=166 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 47 :LGGDVTPSELAAAE 1z7uA 29 :FQGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGY Number of specific fragments extracted= 2 number of extra gaps= 0 total=798 Number of alignments=167 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 44 :I 1z7uA 28 :L T0373 47 :LGGDVTPSELAAAE 1z7uA 29 :FQGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYA Number of specific fragments extracted= 3 number of extra gaps= 0 total=801 Number of alignments=168 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 47 :LGGDVTPSELAAAE 1z7uA 29 :FQGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGY Number of specific fragments extracted= 2 number of extra gaps= 0 total=803 Number of alignments=169 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 48 :GGDVTPSELAAAE 1z7uA 30 :QGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGY Number of specific fragments extracted= 2 number of extra gaps= 0 total=805 Number of alignments=170 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGN 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=806 Number of alignments=171 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 51 :VTPSELAAAE 1z7uA 33 :KRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAK 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSL Number of specific fragments extracted= 2 number of extra gaps= 0 total=808 Number of alignments=172 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 38 :LVVLGAIDR 1z7uA 22 :LSLMDELFQ T0373 49 :GDVTPSELAAAE 1z7uA 31 :GTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHW T0373 115 :LVRA 1z7uA 97 :GETF Number of specific fragments extracted= 4 number of extra gaps= 0 total=812 Number of alignments=173 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 36 :SQLVVLGAIDR 1z7uA 20 :WKLSLMDELFQ T0373 48 :GG 1z7uA 31 :GT T0373 51 :VTPSELAAAE 1z7uA 33 :KRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHW T0373 115 :LVRAMHA 1z7uA 97 :GETFAQK Number of specific fragments extracted= 5 number of extra gaps= 0 total=817 Number of alignments=174 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 34 :QFSQLVVLGAID 1z7uA 18 :GKWKLSLMDELF T0373 48 :GGDVTPSELAAAE 1z7uA 30 :QGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHW Number of specific fragments extracted= 3 number of extra gaps= 0 total=820 Number of alignments=175 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 36 :SQLVVLGAID 1z7uA 20 :WKLSLMDELF T0373 48 :GGDVTPSELAAAE 1z7uA 30 :QGTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=823 Number of alignments=176 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 34 :QFSQLVVLGAIDR 1z7uA 18 :GKWKLSLMDELFQ T0373 49 :GDVTPSELAAAE 1z7uA 31 :GTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGETFAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=826 Number of alignments=177 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 6 :DLQL 1z7uA 6 :QTSI T0373 22 :RRLRREAQ 1z7uA 10 :NLALSTIN T0373 35 :FSQLVVLGAIDR 1z7uA 19 :KWKLSLMDELFQ T0373 49 :GDVTPSELAAAE 1z7uA 31 :GTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMH 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGETFAQK Number of specific fragments extracted= 5 number of extra gaps= 0 total=831 Number of alignments=178 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGN 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDAL Number of specific fragments extracted= 1 number of extra gaps= 0 total=832 Number of alignments=179 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 41 :LGAIDR 1z7uA 25 :MDELFQ T0373 49 :GDVTPSELAAAE 1z7uA 31 :GTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAK 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSL Number of specific fragments extracted= 3 number of extra gaps= 0 total=835 Number of alignments=180 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 37 :QLVVLGAIDR 1z7uA 21 :KLSLMDELFQ T0373 49 :GDVTPSELAAAE 1z7uA 31 :GTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGETF Number of specific fragments extracted= 3 number of extra gaps= 0 total=838 Number of alignments=181 # 1z7uA read from 1z7uA/merged-local-a2m # found chain 1z7uA in template set T0373 25 :RREAQADPVQFSQLVVLGAIDR 1z7uA 9 :INLALSTINGKWKLSLMDELFQ T0373 49 :GDVTPSELAAAE 1z7uA 31 :GTKRNGELMRAL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z7uA 44 :GITQRVLTDRLREMEKDGLVHRESFNELPPRVEYTLTPEGYALYDALSSLCHWGETF T0373 119 :MHA 1z7uA 101 :AQK Number of specific fragments extracted= 4 number of extra gaps= 0 total=842 Number of alignments=182 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bi0/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bi0 expands to /projects/compbio/data/pdb/1bi0.pdb.gz 1bi0:Warning: there is no chain 1bi0 will retry with 1bi0A # T0373 read from 1bi0/merged-local-a2m # 1bi0 read from 1bi0/merged-local-a2m # adding 1bi0 to template set # found chain 1bi0 in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1bi0 12 :LRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 87 :QDGRRTRVSLSSEG 1bi0 65 :TPTGRTLATAVMRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=844 Number of alignments=183 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1bi0 12 :LRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRR 1bi0 62 :LQMTPTGRT Number of specific fragments extracted= 2 number of extra gaps= 0 total=846 Number of alignments=184 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 46 :RLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1bi0 20 :EEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRN 1bi0 62 :LQMTPTGRTL T0373 104 :LYGNRAKREEWLVRAMHA 1bi0 75 :VMRKHRLAERLLTDIIGL Number of specific fragments extracted= 3 number of extra gaps= 0 total=849 Number of alignments=185 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1bi0 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1bi0 60 :RSLQMTPTGRTLATAVMRKHRL T0373 115 :LVRAMHACLDES 1bi0 82 :AERLLTDIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=852 Number of alignments=186 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1bi0 10 :MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1bi0 60 :RSLQMTPTGRTLATAVMRKHRL T0373 115 :LVRAMHA 1bi0 82 :AERLLTD Number of specific fragments extracted= 3 number of extra gaps= 0 total=855 Number of alignments=187 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set Warning: unaligning (T0373)L131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1bi0)R103 Warning: unaligning (T0373)A133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1bi0)R103 T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1bi0 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1bi0 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKRE 1bi0 62 :LQMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHAC 1bi0 81 :LAERLLTDI T0373 123 :LDESER 1bi0 92 :LDINKV T0373 129 :AL 1bi0 99 :DE T0373 134 :AG 1bi0 104 :WE T0373 136 :PLLTRLAQFEEP 1bi0 111 :EVERRLVKVLKD Number of specific fragments extracted= 8 number of extra gaps= 0 total=863 Number of alignments=188 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set Warning: unaligning (T0373)L131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1bi0)R103 Warning: unaligning (T0373)A133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1bi0)R103 T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1bi0 10 :MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1bi0 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKRE 1bi0 62 :LQMTPTGRTLATAVMRKHR T0373 115 :LVRAMHAC 1bi0 81 :LAERLLTD T0373 123 :LD 1bi0 92 :LD T0373 125 :ESERAL 1bi0 95 :NKVHDE T0373 134 :AG 1bi0 104 :WE T0373 136 :PLLTRLAQFEEP 1bi0 111 :EVERRLVKVLKD Number of specific fragments extracted= 8 number of extra gaps= 0 total=871 Number of alignments=189 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1bi0 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1bi0 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1bi0 88 :DIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=874 Number of alignments=190 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 34 :QFSQLVVLGAIDR 1bi0 8 :TEMYLRTIYELEE T0373 48 :GG 1bi0 21 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1bi0 24 :TPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1bi0 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1bi0 88 :DIIGLD Number of specific fragments extracted= 5 number of extra gaps= 0 total=879 Number of alignments=191 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set Warning: unaligning (T0373)L131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1bi0)R103 Warning: unaligning (T0373)A133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1bi0)R103 T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1bi0 6 :DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 86 :PQDGR 1bi0 57 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1bi0 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :A 1bi0 88 :D T0373 122 :CLDESER 1bi0 91 :GLDINKV T0373 129 :AL 1bi0 99 :DE T0373 134 :AG 1bi0 104 :WE T0373 136 :PLLTRLAQFEEP 1bi0 111 :EVERRLVKVLKD Number of specific fragments extracted= 8 number of extra gaps= 0 total=887 Number of alignments=192 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set Warning: unaligning (T0373)L131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1bi0)R103 Warning: unaligning (T0373)A133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1bi0)R103 T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1bi0 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 85 :DPQDG 1bi0 57 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1bi0 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLD 1bi0 88 :DIIG T0373 125 :ESERAL 1bi0 95 :NKVHDE T0373 134 :AG 1bi0 104 :WE T0373 136 :PLLTRLAQFEEP 1bi0 111 :EVERRLVKVLKD Number of specific fragments extracted= 7 number of extra gaps= 0 total=894 Number of alignments=193 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 39 :VVLGAIDRLGGD 1bi0 10 :MYLRTIYELEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1bi0 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1bi0 60 :RSLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLDES 1bi0 86 :LTDIIGLD Number of specific fragments extracted= 4 number of extra gaps= 0 total=898 Number of alignments=194 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 35 :FSQLVVLGAIDR 1bi0 9 :EMYLRTIYELEE T0373 50 :D 1bi0 21 :E T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1bi0 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1bi0 61 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1bi0 86 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=903 Number of alignments=195 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 34 :QFSQLVVLGAIDR 1bi0 8 :TEMYLRTIYELEE T0373 48 :GGD 1bi0 21 :EGV T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1bi0 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1bi0 61 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1bi0 86 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=908 Number of alignments=196 # 1bi0 read from 1bi0/merged-local-a2m # found chain 1bi0 in template set T0373 36 :SQLVVLGAIDR 1bi0 10 :MYLRTIYELEE T0373 48 :GGD 1bi0 21 :EGV T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1bi0 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRA 1bi0 61 :SLQMTPTGRTLATAVMRKHRLAERLL T0373 119 :MHACLDES 1bi0 88 :DIIGLDIN Number of specific fragments extracted= 5 number of extra gaps= 0 total=913 Number of alignments=197 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2a61A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 2a61A/merged-local-a2m # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2a61A)K5 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 6 :QPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEE T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 2a61A 101 :VIEKVIERRENFIEKITSDLGKEKSSKI Number of specific fragments extracted= 3 number of extra gaps= 0 total=916 Number of alignments=198 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 9 :ERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEE T0373 104 :LYGNRAKREEWLVRAMHACLDESERALLAAA 2a61A 101 :VIEKVIERRENFIEKITSDLGKEKSSKILDY Number of specific fragments extracted= 3 number of extra gaps= 0 total=919 Number of alignments=199 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 7 :PFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEE T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 2a61A 101 :VIEKVIERRENFIEKITSDLGKEKSSKI Number of specific fragments extracted= 3 number of extra gaps= 0 total=922 Number of alignments=200 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 12 :HLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 11 :ILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERREN T0373 115 :LVRAMHACLDESERALLAAA 2a61A 112 :FIEKITSDLGKEKSSKILDY Number of specific fragments extracted= 3 number of extra gaps= 0 total=925 Number of alignments=201 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 7 :PFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEK T0373 119 :MHACLDESERALL 2a61A 116 :ITSDLGKEKSSKI Number of specific fragments extracted= 3 number of extra gaps= 0 total=928 Number of alignments=202 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 13 :LRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 12 :LREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEK T0373 119 :MHACLDESERALLAA 2a61A 116 :ITSDLGKEKSSKILD Number of specific fragments extracted= 3 number of extra gaps= 0 total=931 Number of alignments=203 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 10 :RILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERREN T0373 115 :LVRAMHACLDESERALLAA 2a61A 112 :FIEKITSDLGKEKSSKILD T0373 137 :LLTRLAQFEE 2a61A 131 :YLKELKGVME Number of specific fragments extracted= 4 number of extra gaps= 0 total=935 Number of alignments=204 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 9 :ERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERREN T0373 115 :LVRAMHACLDESERALLAA 2a61A 112 :FIEKITSDLGKEKSSKILD T0373 137 :LLTRLAQF 2a61A 131 :YLKELKGV Number of specific fragments extracted= 4 number of extra gaps= 0 total=939 Number of alignments=205 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 13 :LRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 12 :LREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERREN T0373 115 :LVRAMHACLDESERALLAA 2a61A 112 :FIEKITSDLGKEKSSKILD T0373 137 :LLTRLAQFEE 2a61A 131 :YLKELKGVME Number of specific fragments extracted= 4 number of extra gaps= 0 total=943 Number of alignments=206 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (2a61A)K5 T0373 4 :NQDLQL 2a61A 6 :QPFERI T0373 13 :LRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2a61A 12 :LREICFMVKVEGRKVLRDFGITPAQFDILQKIYFEGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2a61A 49 :KRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERREN T0373 115 :LVRAMHACLDESERALLAAAGPLLTRLAQ 2a61A 112 :FIEKITSDLGKEKSSKILDYLKELKGVME Number of specific fragments extracted= 4 number of extra gaps= 0 total=947 Number of alignments=207 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 6 :QPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKIT T0373 121 :ACLDESERALLAA 2a61A 118 :SDLGKEKSSKILD T0373 137 :LLTRLAQFEE 2a61A 131 :YLKELKGVME Number of specific fragments extracted= 4 number of extra gaps= 0 total=951 Number of alignments=208 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 8 :FERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKIT T0373 121 :ACLDESERALLAA 2a61A 118 :SDLGKEKSSKILD T0373 137 :LLTRLAQFE 2a61A 131 :YLKELKGVM Number of specific fragments extracted= 4 number of extra gaps= 0 total=955 Number of alignments=209 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2a61A)K5 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 6 :QPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKIT T0373 121 :ACLDESERALLAAAGPLLTRLAQ 2a61A 118 :SDLGKEKSSKILDYLKELKGVME Number of specific fragments extracted= 3 number of extra gaps= 0 total=958 Number of alignments=210 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set Warning: unaligning (T0373)D6 because first residue in template chain is (2a61A)K5 T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 6 :QPFERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEKIT T0373 121 :ACLDESERALLAAAGPLLTRLAQF 2a61A 118 :SDLGKEKSSKILDYLKELKGVMER Number of specific fragments extracted= 3 number of extra gaps= 0 total=961 Number of alignments=211 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 10 :RILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEK T0373 119 :MHACLDESERALL 2a61A 116 :ITSDLGKEKSSKI Number of specific fragments extracted= 3 number of extra gaps= 0 total=964 Number of alignments=212 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 8 :FERILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEK T0373 119 :MHACLDESERALLAAA 2a61A 116 :ITSDLGKEKSSKILDY Number of specific fragments extracted= 3 number of extra gaps= 0 total=967 Number of alignments=213 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 10 :RILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEK T0373 119 :MHACLDESERA 2a61A 116 :ITSDLGKEKSS Number of specific fragments extracted= 3 number of extra gaps= 0 total=970 Number of alignments=214 # 2a61A read from 2a61A/merged-local-a2m # found chain 2a61A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2a61A 10 :RILREICFMVKVEGRKVLRDFGITPAQFDILQKIYF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2a61A 46 :EGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRAYFLVITRKGEEVIEKVIERRENFIEK T0373 119 :MHACLDESERALLAAAGPLLTRLAQ 2a61A 116 :ITSDLGKEKSSKILDYLKELKGVME Number of specific fragments extracted= 3 number of extra gaps= 0 total=973 Number of alignments=215 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1s3jA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1s3jA expands to /projects/compbio/data/pdb/1s3j.pdb.gz 1s3jA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 993, because occupancy 0.400 <= existing 0.600 in 1s3jA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 995, because occupancy 0.400 <= existing 0.600 in 1s3jA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 997, because occupancy 0.350 <= existing 0.530 in 1s3jA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 999, because occupancy 0.400 <= existing 0.600 in 1s3jA # T0373 read from 1s3jA/merged-local-a2m # 1s3jA read from 1s3jA/merged-local-a2m # adding 1s3jA to template set # found chain 1s3jA in template set T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1s3jA 3 :SADQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1s3jA 52 :LKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDI T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 1s3jA 104 :KFEEVLAGRKAIMARYLSFLTEEEMLQA Number of specific fragments extracted= 3 number of extra gaps= 0 total=976 Number of alignments=216 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1s3jA 6 :QLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1s3jA 52 :LKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDI T0373 104 :LYGNRAKREEWLVRAMHACLDESERALLAA 1s3jA 104 :KFEEVLAGRKAIMARYLSFLTEEEMLQAAH Number of specific fragments extracted= 3 number of extra gaps= 0 total=979 Number of alignments=217 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLG 1s3jA 5 :DQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1s3jA 51 :SLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMAR T0373 119 :MHACLDESERALL 1s3jA 119 :YLSFLTEEEMLQA Number of specific fragments extracted= 3 number of extra gaps= 0 total=982 Number of alignments=218 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLG 1s3jA 7 :LMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1s3jA 51 :SLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMAR T0373 119 :MHACLDESERALLA 1s3jA 119 :YLSFLTEEEMLQAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=985 Number of alignments=219 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1s3jA 5 :DQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1s3jA 52 :LKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKA T0373 115 :LVRAMHACLDESERALLAA 1s3jA 115 :IMARYLSFLTEEEMLQAAH T0373 137 :LLTRLAQFEE 1s3jA 134 :ITAKLAQAAE Number of specific fragments extracted= 4 number of extra gaps= 0 total=989 Number of alignments=220 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1s3jA 7 :LMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1s3jA 52 :LKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKA T0373 115 :LVRAMHACLDESERALLAA 1s3jA 115 :IMARYLSFLTEEEMLQAAH T0373 137 :LLTRLAQF 1s3jA 134 :ITAKLAQA Number of specific fragments extracted= 4 number of extra gaps= 0 total=993 Number of alignments=221 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1s3jA 7 :LMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1s3jA 52 :LKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKA T0373 115 :LVRAMHACLDESERALLAA 1s3jA 115 :IMARYLSFLTEEEMLQAAH T0373 137 :LLTRLAQFEEP 1s3jA 134 :ITAKLAQAAET Number of specific fragments extracted= 4 number of extra gaps= 0 total=997 Number of alignments=222 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1s3jA 6 :QLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKHGS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1s3jA 52 :LKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKA T0373 115 :LVRAMHACLDESERALLAAAGPLLTRL 1s3jA 115 :IMARYLSFLTEEEMLQAAHITAKLAQA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1000 Number of alignments=223 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1s3jA 5 :DQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKK T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1s3jA 49 :HGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYL T0373 121 :ACLDESERALLAA 1s3jA 121 :SFLTEEEMLQAAH T0373 137 :LLTRLAQFEE 1s3jA 134 :ITAKLAQAAE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1004 Number of alignments=224 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1s3jA 7 :LMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKK T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1s3jA 49 :HGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYL T0373 121 :ACLDESERALLAA 1s3jA 121 :SFLTEEEMLQAAH T0373 137 :LLTRLAQ 1s3jA 134 :ITAKLAQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=1008 Number of alignments=225 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1s3jA 5 :DQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKH T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1s3jA 50 :GSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYL T0373 121 :ACLDESERALLAA 1s3jA 121 :SFLTEEEMLQAAH T0373 137 :LLTRLAQFEEP 1s3jA 134 :ITAKLAQAAET Number of specific fragments extracted= 4 number of extra gaps= 0 total=1012 Number of alignments=226 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1s3jA)D145 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1s3jA 5 :DQLMSDIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKKH T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1s3jA 50 :GSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMARYL T0373 121 :ACLDESERALLAAAGPLLTRLAQF 1s3jA 121 :SFLTEEEMLQAAHITAKLAQAAET Number of specific fragments extracted= 3 number of extra gaps= 0 total=1015 Number of alignments=227 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1s3jA 11 :IQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKK T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1s3jA 49 :HGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMAR T0373 119 :MHACLDESERALL 1s3jA 119 :YLSFLTEEEMLQA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1018 Number of alignments=228 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1s3jA 13 :LSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKK T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1s3jA 49 :HGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMAR T0373 119 :MHACLDESERALLAAA 1s3jA 119 :YLSFLTEEEMLQAAHI Number of specific fragments extracted= 3 number of extra gaps= 0 total=1021 Number of alignments=229 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set T0373 12 :HLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1s3jA 14 :SLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKK T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1s3jA 49 :HGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMAR T0373 119 :MHACLDESER 1s3jA 119 :YLSFLTEEEM Number of specific fragments extracted= 3 number of extra gaps= 0 total=1024 Number of alignments=230 # 1s3jA read from 1s3jA/merged-local-a2m # found chain 1s3jA in template set Warning: unaligning (T0373)E145 because last residue in template chain is (1s3jA)D145 T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1s3jA 10 :DIQLSLQALFQKIQPEMLESMEKQGVTPAQLFVLASLKK T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1s3jA 49 :HGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTKDRRVIDLSLTDEGDIKFEEVLAGRKAIMAR T0373 119 :MHACLDESERALLAAAGPLLTRLAQF 1s3jA 119 :YLSFLTEEEMLQAAHITAKLAQAAET Number of specific fragments extracted= 3 number of extra gaps= 0 total=1027 Number of alignments=231 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1on2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1on2A/merged-local-a2m # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 3 :TPSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKR 1on2A 59 :GLVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAAAGPL 1on2A 85 :RIIGVDEEKIYNDVEGI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1031 Number of alignments=232 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 4 :PSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKR 1on2A 59 :GLVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERAL 1on2A 85 :RIIGVDEEKI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1035 Number of alignments=233 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 4 :PSMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKR 1on2A 59 :GLVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAAAGPL 1on2A 85 :RIIGVDEEKIYNDVEGI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1039 Number of alignments=234 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 33 :VQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 5 :SMEMYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKR 1on2A 59 :GLVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAAAGPL 1on2A 85 :RIIGVDEEKIYNDVEGI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1043 Number of alignments=235 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 20 :KGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRR 1on2A 59 :GLVLTSKGKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1045 Number of alignments=236 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 44 :IDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 16 :LIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRA 1on2A 59 :GLVLTSKGKKIGKRLVYRHELLEQFL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1047 Number of alignments=237 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 41 :LGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1on2A 13 :IYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEK T0373 91 :RTRVSLSSEGRRNLYGNRAKRE 1on2A 57 :YRGLVLTSKGKKIGKRLVYRHE T0373 115 :LVRAMHACLDESERALLAA 1on2A 79 :LLEQFLRIIGVDEEKIYND Number of specific fragments extracted= 3 number of extra gaps= 0 total=1050 Number of alignments=238 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 41 :LGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1on2A 13 :IYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEK T0373 91 :RTRVSLSSEGRRNLYGNRAKRE 1on2A 57 :YRGLVLTSKGKKIGKRLVYRHE T0373 115 :LVRAMHACLDESERALLAA 1on2A 79 :LLEQFLRIIGVDEEKIYND Number of specific fragments extracted= 3 number of extra gaps= 0 total=1053 Number of alignments=239 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 8 :MYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKRE 1on2A 59 :GLVLTSKGKKIGKRLVYRHE T0373 115 :LVRAMHA 1on2A 79 :LLEQFLR T0373 122 :CLDESERALLAAA 1on2A 88 :GVDEEKIYNDVEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=1057 Number of alignments=240 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 35 :FSQLVVLGAIDRLGG 1on2A 8 :MYIEQIYMLIEEKGY T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1on2A 23 :ARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYE T0373 87 :QDG 1on2A 56 :KYR T0373 93 :RVSLSSEGRRNLYGNRAKRE 1on2A 59 :GLVLTSKGKKIGKRLVYRHE T0373 114 :WLVRAM 1on2A 79 :LLEQFL T0373 120 :HACLDESER 1on2A 86 :IIGVDEEKI T0373 129 :ALLAA 1on2A 111 :DRIGD T0373 137 :LLTRL 1on2A 116 :LVQYF Number of specific fragments extracted= 8 number of extra gaps= 0 total=1065 Number of alignments=241 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 41 :LGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1on2A 13 :IYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRG T0373 94 :VSLSSEGRRNLYGNRAKR 1on2A 60 :LVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAA 1on2A 85 :RIIGVDEEKIYND Number of specific fragments extracted= 4 number of extra gaps= 0 total=1069 Number of alignments=242 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 41 :LGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1on2A 13 :IYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRG T0373 94 :VSLSSEGRRNLYGNRAKR 1on2A 60 :LVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAAAG 1on2A 85 :RIIGVDEEKIYNDVE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1073 Number of alignments=243 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1on2A 8 :MYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYRG T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1on2A 60 :LVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIYNDVE T0373 140 :RLA 1on2A 100 :GIE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1076 Number of alignments=244 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set Warning: unaligning (T0373)V33 because first residue in template chain is (1on2A)T2 T0373 34 :QFSQLVVLGAIDRL 1on2A 3 :TPSMEMYIEQIYML T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1on2A 20 :KGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYE T0373 86 :PQD 1on2A 56 :KYR T0373 93 :RVSLSSEGRRNLYGNRAKR 1on2A 59 :GLVLTSKGKKIGKRLVYRH T0373 113 :EWLVRAM 1on2A 78 :ELLEQFL T0373 121 :ACLDESERALLAA 1on2A 103 :HHLSWNSIDRIGD T0373 137 :LLTRLA 1on2A 116 :LVQYFE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1083 Number of alignments=245 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 41 :LGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1on2A 13 :IYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEK T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESER 1on2A 57 :YRGLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1085 Number of alignments=246 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 42 :GAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1on2A 14 :YMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEK T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLVR 1on2A 57 :YRGLVLTSKGKKIGKRLVYRHELLEQF T0373 120 :HACLDESERALL 1on2A 84 :LRIIGVDEEKIY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1088 Number of alignments=247 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 8 :MYIEQIYMLIEEKGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERA 1on2A 59 :GLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKIY Number of specific fragments extracted= 2 number of extra gaps= 0 total=1090 Number of alignments=248 # 1on2A read from 1on2A/merged-local-a2m # found chain 1on2A in training set T0373 35 :FSQLVVLGAIDR 1on2A 8 :MYIEQIYMLIEE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1on2A 20 :KGYARVSDIAEALAVHPSSVTKMVQKLDKDEYLIYEKYR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESER 1on2A 59 :GLVLTSKGKKIGKRLVYRHELLEQFLRIIGVDEEKI T0373 129 :ALLAAAGPLLT 1on2A 111 :DRIGDLVQYFE Number of specific fragments extracted= 4 number of extra gaps= 0 total=1094 Number of alignments=249 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f2eA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f2eA expands to /projects/compbio/data/pdb/2f2e.pdb.gz 2f2eA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 955, because occupancy 0.500 <= existing 0.500 in 2f2eA Skipped atom 959, because occupancy 0.500 <= existing 0.500 in 2f2eA Skipped atom 961, because occupancy 0.500 <= existing 0.500 in 2f2eA Skipped atom 963, because occupancy 0.500 <= existing 0.500 in 2f2eA Skipped atom 965, because occupancy 0.500 <= existing 0.500 in 2f2eA # T0373 read from 2f2eA/merged-local-a2m # 2f2eA read from 2f2eA/merged-local-a2m # adding 2f2eA to template set # found chain 2f2eA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2f2eA 35 :EGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVA T0373 84 :ADPQDGRRTRVSLSSEGR 2f2eA 70 :VPAESGSHQEYRLTDKGR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1096 Number of alignments=250 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2f2eA 35 :EGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVA T0373 84 :ADPQDGRRTRVSLSSEGRR 2f2eA 70 :VPAESGSHQEYRLTDKGRA T0373 104 :LYGNRAKREEWLVRAMHACLD 2f2eA 89 :LFPLLVAIRQWGEDYFFAPDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=1099 Number of alignments=251 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2f2eA 34 :FEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAES T0373 89 :GRRTRVSLSSEGR 2f2eA 75 :GSHQEYRLTDKGR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1101 Number of alignments=252 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 44 :IDR 2f2eA 33 :AFE T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2f2eA 36 :GLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAES T0373 89 :GRRTRVSLSSEGRR 2f2eA 75 :GSHQEYRLTDKGRA T0373 104 :LYGNRAKREEWLVRAMHACLDESERA 2f2eA 89 :LFPLLVAIRQWGEDYFFAPDESHVRL Number of specific fragments extracted= 4 number of extra gaps= 0 total=1105 Number of alignments=253 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2f2eA 34 :FEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVA T0373 84 :ADPQDGRRTRVSLSSEGR 2f2eA 70 :VPAESGSHQEYRLTDKGR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1107 Number of alignments=254 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2f2eA 34 :FEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVA T0373 84 :ADPQDGRRTRVSLSSEGRR 2f2eA 70 :VPAESGSHQEYRLTDKGRA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1109 Number of alignments=255 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 26 :REAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2f2eA 13 :PVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPA T0373 87 :QDGRRTRVSLSSEGRRNLYGNRAKREE 2f2eA 73 :ESGSHQEYRLTDKGRALFPLLVAIRQW T0373 115 :LVRAMHAC 2f2eA 100 :GEDYFFAP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1112 Number of alignments=256 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 26 :REAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2f2eA 13 :PVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAES T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 2f2eA 75 :GSHQEYRLTDKGRALFPLLVAIRQW T0373 115 :LVRAMHAC 2f2eA 100 :GEDYFFAP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1115 Number of alignments=257 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 38 :LVVLGAID 2f2eA 27 :MLIVRDAF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTR 2f2eA 35 :EGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAESGSHQEY T0373 95 :SLSSEGRRNLYGNRAKREE 2f2eA 81 :RLTDKGRALFPLLVAIRQW T0373 115 :LVR 2f2eA 100 :GED Number of specific fragments extracted= 4 number of extra gaps= 0 total=1119 Number of alignments=258 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 37 :QLVVLGAIDR 2f2eA 26 :SMLIVRDAFE T0373 48 :GG 2f2eA 36 :GL T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRT 2f2eA 38 :TRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAESGSHQE T0373 94 :VSLSSEGR 2f2eA 80 :YRLTDKGR T0373 106 :GNRAKREEWLVRAMHACLDES 2f2eA 88 :ALFPLLVAIRQWGEDYFFAPD Number of specific fragments extracted= 5 number of extra gaps= 0 total=1124 Number of alignments=259 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 22 :RRLRREAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2f2eA 9 :QASCPVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAES T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2f2eA 75 :GSHQEYRLTDKGRALFPLLVAIRQWGEDYFF T0373 121 :AC 2f2eA 106 :AP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1127 Number of alignments=260 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 26 :REAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2f2eA 13 :PVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAES T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2f2eA 75 :GSHQEYRLTDKGRALFPLLVAIRQWGEDYFF T0373 121 :AC 2f2eA 106 :AP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1130 Number of alignments=261 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 36 :SQLVVLGAID 2f2eA 25 :WSMLIVRDAF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRR 2f2eA 35 :EGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAESGSHQ T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 2f2eA 79 :EYRLTDKGRALFPLLVAIRQWGEDYFF Number of specific fragments extracted= 3 number of extra gaps= 0 total=1133 Number of alignments=262 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 37 :QLVVLGAID 2f2eA 26 :SMLIVRDAF T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRR 2f2eA 35 :EGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAESGSHQ T0373 93 :RVSLSSEGRRNLYGNRAKREEWLV 2f2eA 79 :EYRLTDKGRALFPLLVAIRQWGED T0373 121 :AC 2f2eA 103 :YF Number of specific fragments extracted= 4 number of extra gaps= 0 total=1137 Number of alignments=263 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 26 :REAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2f2eA 13 :PVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVP T0373 86 :PQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2f2eA 72 :AESGSHQEYRLTDKGRALFPLLVAIRQWGEDY T0373 119 :MHAC 2f2eA 104 :FFAP Number of specific fragments extracted= 3 number of extra gaps= 0 total=1140 Number of alignments=264 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 26 :REAQADPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2f2eA 13 :PVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAES T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVR 2f2eA 75 :GSHQEYRLTDKGRALFPLLVAIRQWGEDY T0373 119 :MHA 2f2eA 104 :FFA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1143 Number of alignments=265 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 41 :LGAIDRLGGD 2f2eA 27 :MLIVRDAFEG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTR 2f2eA 38 :TRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAESGSHQEY T0373 95 :SLSSEGRRNLYGNRAKREEWLVR 2f2eA 81 :RLTDKGRALFPLLVAIRQWGEDY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1146 Number of alignments=266 # 2f2eA read from 2f2eA/merged-local-a2m # found chain 2f2eA in template set T0373 37 :QLVVLGAIDR 2f2eA 26 :SMLIVRDAFE T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRT 2f2eA 36 :GLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAESGSHQE T0373 94 :VSLSSEGR 2f2eA 80 :YRLTDKGR T0373 106 :GNRAKREEWLVRAMHACLDES 2f2eA 88 :ALFPLLVAIRQWGEDYFFAPD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1150 Number of alignments=267 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fx7A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1fx7A expands to /projects/compbio/data/pdb/1fx7.pdb.gz 1fx7A:Skipped atom 596, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 600, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 872, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 874, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 876, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 878, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 1703, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 1705, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 1707, because occupancy 0.500 <= existing 0.500 in 1fx7A Skipped atom 1709, because occupancy 0.500 <= existing 0.500 in 1fx7A # T0373 read from 1fx7A/merged-local-a2m # 1fx7A read from 1fx7A/merged-local-a2m # adding 1fx7A to template set # found chain 1fx7A in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1fx7A 12 :LRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDR T0373 87 :QDGRRTRVSLSSEG 1fx7A 65 :TEKGRALAIAVMRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=1152 Number of alignments=268 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1fx7A 22 :GVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH T0373 94 :VSLSSEGRR 1fx7A 62 :LELTEKGRA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1154 Number of alignments=269 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 40 :VLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1fx7A 14 :TIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH T0373 94 :VSLSSEGRRNL 1fx7A 62 :LELTEKGRALA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1156 Number of alignments=270 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1fx7A 5 :VDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1fx7A 60 :RHLELTEKGRALAIAVMRKHRL T0373 115 :LVRAMHACLD 1fx7A 82 :AERLLVDVIG Number of specific fragments extracted= 3 number of extra gaps= 0 total=1159 Number of alignments=271 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 37 :QLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1fx7A 11 :YLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1fx7A 60 :RHLELTEKGRALAIAVMRKHRL T0373 115 :LVRAMHACLD 1fx7A 82 :AERLLVDVIG Number of specific fragments extracted= 3 number of extra gaps= 0 total=1162 Number of alignments=272 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 34 :QFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1fx7A 8 :TEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVA T0373 87 :QDGR 1fx7A 58 :GDRH T0373 94 :VSLSSEGRRNLYGNRAKRE 1fx7A 62 :LELTEKGRALAIAVMRKHR T0373 114 :WLVRAMHACLDESERALLAAAGP 1fx7A 81 :LAERLLVDVIGLPWEEVHAEACR T0373 137 :LLTRLAQFEE 1fx7A 112 :VERRLVKVLN Number of specific fragments extracted= 5 number of extra gaps= 0 total=1167 Number of alignments=273 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1fx7A 9 :EMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVA T0373 87 :QDGR 1fx7A 58 :GDRH T0373 94 :VSLSSEGRRNLYGNRAKR 1fx7A 62 :LELTEKGRALAIAVMRKH T0373 112 :EE 1fx7A 95 :EE T0373 115 :LVRAMHAC 1fx7A 97 :VHAEACRW T0373 123 :LDES 1fx7A 108 :MSED T0373 137 :LLTRLAQFEEP 1fx7A 112 :VERRLVKVLNN Number of specific fragments extracted= 7 number of extra gaps= 0 total=1174 Number of alignments=274 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHAD 1fx7A 30 :IAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVRAM 1fx7A 60 :RHLELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLD 1fx7A 88 :DVIG Number of specific fragments extracted= 3 number of extra gaps= 0 total=1177 Number of alignments=275 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 34 :QFSQLVVLGAIDR 1fx7A 8 :TEMYLRTIYDLEE T0373 48 :GG 1fx7A 21 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1fx7A 24 :TPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVRAM 1fx7A 60 :RHLELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLDESERAL 1fx7A 88 :DVIGLPWEEV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1182 Number of alignments=276 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1fx7A 6 :DTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRV T0373 86 :PQDGR 1fx7A 57 :AGDRH T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1fx7A 62 :LELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLDESERALLAAAGP 1fx7A 88 :DVIGLPWEEVHAEACR T0373 137 :LLTRLAQFE 1fx7A 112 :VERRLVKVL Number of specific fragments extracted= 5 number of extra gaps= 0 total=1187 Number of alignments=277 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1fx7A 9 :EMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRV T0373 85 :DPQ 1fx7A 57 :AGD T0373 89 :GR 1fx7A 60 :RH T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1fx7A 62 :LELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLD 1fx7A 88 :DVIG T0373 125 :ESERALLAAA 1fx7A 95 :EEVHAEACRW T0373 135 :GPLLTRLAQFEE 1fx7A 110 :EDVERRLVKVLN Number of specific fragments extracted= 7 number of extra gaps= 0 total=1194 Number of alignments=278 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 39 :VVLGAIDRLGGD 1fx7A 10 :MYLRTIYDLEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1fx7A 25 :PLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1fx7A 60 :RHLELTEKGRALAIAVMRKHRLAERL T0373 119 :MHACLD 1fx7A 86 :LVDVIG Number of specific fragments extracted= 4 number of extra gaps= 0 total=1198 Number of alignments=279 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 37 :QLVVLGAIDR 1fx7A 11 :YLRTIYDLEE T0373 50 :D 1fx7A 21 :E T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1fx7A 25 :PLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1fx7A 60 :RHLELTEKGRALAIAVMRKHRLAERL T0373 119 :MHACLD 1fx7A 86 :LVDVIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=1203 Number of alignments=280 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1fx7A 5 :VDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1fx7A 61 :HLELTEKGRALAIAVMRKHRLAERL T0373 119 :MHACLDESERALLAAAGPL 1fx7A 86 :LVDVIGLPWEEVHAEACRW Number of specific fragments extracted= 3 number of extra gaps= 0 total=1206 Number of alignments=281 # 1fx7A read from 1fx7A/merged-local-a2m # found chain 1fx7A in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1fx7A 9 :EMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVA T0373 87 :QDG 1fx7A 58 :GDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1fx7A 61 :HLELTEKGRALAIAVMRKHRLAERL T0373 119 :MHACLD 1fx7A 86 :LVDVIG Number of specific fragments extracted= 4 number of extra gaps= 0 total=1210 Number of alignments=282 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2eshA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2eshA expands to /projects/compbio/data/pdb/2esh.pdb.gz 2eshA:Skipped atom 109, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 111, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 113, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 115, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 117, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 119, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 121, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 415, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 417, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 419, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 421, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 631, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 633, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 635, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 637, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 639, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 641, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 643, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 645, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 647, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 649, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 651, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 786, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 788, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 790, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 792, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 794, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 796, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 798, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 800, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 802, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 955, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 957, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 959, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 961, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 963, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 965, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 967, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 969, because occupancy 0.500 <= existing 0.500 in 2eshA Skipped atom 971, because occupancy 0.500 <= existing 0.500 in 2eshA # T0373 read from 2eshA/merged-local-a2m # 2eshA read from 2eshA/merged-local-a2m # adding 2eshA to template set # found chain 2eshA in template set Warning: unaligning (T0373)P32 because of BadResidue code BAD_PEPTIDE in next template residue (2eshA)G11 Warning: unaligning (T0373)V33 because of BadResidue code BAD_PEPTIDE at template residue (2eshA)G11 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 34 :QFSQLVVLGAIDR 2eshA 12 :WWLASTILLLVAE T0373 49 :GDVTPSELAAAERMRS 2eshA 25 :KPSHGYELAERLAEFG T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQDGR 2eshA 57 :ADLEESGFLSTEWDTTVSP T0373 91 :RTRVSL 2eshA 77 :RKIYRI T0373 99 :EGRRNLYGNRAKREEWLVR 2eshA 85 :QGKLYLREILRSLEDMKRR Number of specific fragments extracted= 6 number of extra gaps= 4 total=1216 Number of alignments=283 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)V33 because of BadResidue code BAD_PEPTIDE at template residue (2eshA)G11 Warning: unaligning (T0373)M62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 34 :QFSQLVVLGAIDR 2eshA 12 :WWLASTILLLVAE T0373 49 :GDVTPSELAAAE 2eshA 25 :KPSHGYELAERL T0373 61 :R 2eshA 46 :I T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQDGR 2eshA 57 :ADLEESGFLSTEWDTTVSP T0373 91 :RTRVSL 2eshA 77 :RKIYRI T0373 99 :EGRRNLYGNRAKREEWL 2eshA 85 :QGKLYLREILRSLEDMK Number of specific fragments extracted= 7 number of extra gaps= 4 total=1223 Number of alignments=284 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 72 :RELERGGLIVRHADPQDGRRTRV 2eshA 57 :ADLEESGFLSTEWDTTVSPPRKI T0373 95 :SL 2eshA 81 :RI T0373 99 :EGRRNLYGNRAKREEWLVR 2eshA 85 :QGKLYLREILRSLEDMKRR Number of specific fragments extracted= 3 number of extra gaps= 2 total=1226 Number of alignments=285 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWL 2eshA 85 :QGKLYLREILRSLEDMK Number of specific fragments extracted= 4 number of extra gaps= 3 total=1230 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREE 2eshA 85 :QGKLYLREILRSLED T0373 115 :LVRAM 2eshA 100 :MKRRI Number of specific fragments extracted= 5 number of extra gaps= 3 total=1235 Number of alignments=286 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 50 :DVTPSELAAAER 2eshA 26 :PSHGYELAERLA T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 89 :GRRTRVSL 2eshA 75 :PPRKIYRI T0373 99 :EGRRNLYGNRAKREE 2eshA 85 :QGKLYLREILRSLED T0373 115 :LVRAM 2eshA 100 :MKRRI Number of specific fragments extracted= 6 number of extra gaps= 3 total=1241 Number of alignments=287 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)M62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 37 :QLVVLGAIDR 2eshA 15 :ASTILLLVAE T0373 49 :GDVTPSELAAAE 2eshA 25 :KPSHGYELAERL T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREE 2eshA 85 :QGKLYLREILRSLED T0373 115 :LVRAM 2eshA 100 :MKRRI T0373 129 :ALLAA 2eshA 105 :ETLEE T0373 137 :LLTRL 2eshA 110 :RIKRV Number of specific fragments extracted= 9 number of extra gaps= 3 total=1250 Number of alignments=288 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2eshA)R4 Warning: unaligning (T0373)Q8 because of BadResidue code BAD_PEPTIDE in next template residue (2eshA)G11 Warning: unaligning (T0373)L9 because of BadResidue code BAD_PEPTIDE at template residue (2eshA)G11 Warning: unaligning (T0373)Q34 because of BadResidue code BAD_PEPTIDE in next template residue (2eshA)I43 Warning: unaligning (T0373)L47 because of BadResidue code BAD_PEPTIDE at template residue (2eshA)I43 Warning: unaligning (T0373)T52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 3 :TNQDL 2eshA 5 :GGRGF T0373 10 :AAHLRSQVTTLTR 2eshA 12 :WWLASTILLLVAE T0373 23 :RLRREAQADPV 2eshA 31 :ELAERLAEFGI T0373 48 :GG 2eshA 44 :PG T0373 51 :V 2eshA 46 :I T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREE 2eshA 85 :QGKLYLREILRSLED T0373 115 :LVRAM 2eshA 100 :MKRRI T0373 129 :ALLAA 2eshA 105 :ETLEE T0373 137 :LLTR 2eshA 110 :RIKR Number of specific fragments extracted= 12 number of extra gaps= 5 total=1262 Number of alignments=289 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)M62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 40 :VLGAID 2eshA 18 :ILLLVA T0373 48 :GGDVTPSELAAAER 2eshA 24 :EKPSHGYELAERLA T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVRA 2eshA 85 :QGKLYLREILRSLEDMKRRI Number of specific fragments extracted= 6 number of extra gaps= 3 total=1268 Number of alignments=290 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)M62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 40 :VLGAID 2eshA 18 :ILLLVA T0373 48 :GGDVTPSELAAAER 2eshA 24 :EKPSHGYELAERLA T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVRAM 2eshA 85 :QGKLYLREILRSLEDMKRRIE Number of specific fragments extracted= 6 number of extra gaps= 3 total=1274 Number of alignments=291 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)M62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 36 :SQLVVLGAIDR 2eshA 14 :LASTILLLVAE T0373 49 :GDVTPSELAAAE 2eshA 25 :KPSHGYELAERL T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVRAM 2eshA 85 :QGKLYLREILRSLEDMKRRIE T0373 121 :A 2eshA 106 :T T0373 137 :LLTRLA 2eshA 107 :LEERIK Number of specific fragments extracted= 8 number of extra gaps= 3 total=1282 Number of alignments=292 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 35 :FSQLVVLGAIDR 2eshA 13 :WLASTILLLVAE T0373 49 :GDVTPSELAAAE 2eshA 25 :KPSHGYELAERL T0373 61 :RM 2eshA 45 :GI T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVRAM 2eshA 85 :QGKLYLREILRSLEDMKRRIE T0373 130 :LLAA 2eshA 106 :TLEE T0373 137 :LLT 2eshA 110 :RIK Number of specific fragments extracted= 9 number of extra gaps= 4 total=1291 Number of alignments=293 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVR 2eshA 85 :QGKLYLREILRSLEDMKRR T0373 119 :M 2eshA 104 :I Number of specific fragments extracted= 5 number of extra gaps= 3 total=1296 Number of alignments=294 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 49 :GDVTPSELAAAER 2eshA 25 :KPSHGYELAERLA T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVR 2eshA 85 :QGKLYLREILRSLEDMKRR Number of specific fragments extracted= 5 number of extra gaps= 3 total=1301 Number of alignments=295 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)M62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 36 :SQLVVLGAIDR 2eshA 13 :WLASTILLLVA T0373 48 :GGDVTPSELAAAE 2eshA 24 :EKPSHGYELAERL T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVR 2eshA 85 :QGKLYLREILRSLEDMKRR T0373 119 :MH 2eshA 104 :IE Number of specific fragments extracted= 7 number of extra gaps= 3 total=1308 Number of alignments=296 # 2eshA read from 2eshA/merged-local-a2m # found chain 2eshA in template set Warning: unaligning (T0373)Q8 because of BadResidue code BAD_PEPTIDE in next template residue (2eshA)G11 Warning: unaligning (T0373)L9 because of BadResidue code BAD_PEPTIDE at template residue (2eshA)G11 Warning: unaligning (T0373)Q34 because of BadResidue code BAD_PEPTIDE in next template residue (2eshA)I43 Warning: unaligning (T0373)G48 because of BadResidue code BAD_PEPTIDE at template residue (2eshA)I43 Warning: unaligning (T0373)T52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)H48 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)H48 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)M49 Warning: unaligning (T0373)S65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)G50 Warning: unaligning (T0373)N66 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)N51 Warning: unaligning (T0373)L70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2eshA)L56 Warning: unaligning (T0373)L71 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2eshA)L56 Warning: unaligning (T0373)S97 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (2eshA)P84 Warning: unaligning (T0373)S98 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (2eshA)P84 T0373 10 :AAHLRSQVTTLT 2eshA 12 :WWLASTILLLVA T0373 22 :RRLRREAQADPV 2eshA 30 :YELAERLAEFGI T0373 49 :GDV 2eshA 44 :PGI T0373 67 :LAA 2eshA 52 :IYR T0373 72 :RELERGGLIVRHADPQ 2eshA 57 :ADLEESGFLSTEWDTT T0373 88 :DGRRTRVSL 2eshA 74 :SPPRKIYRI T0373 99 :EGRRNLYGNRAKREEWLVR 2eshA 85 :QGKLYLREILRSLEDMKRR T0373 128 :RALLAAAGPL 2eshA 104 :IETLEERIKR Number of specific fragments extracted= 8 number of extra gaps= 5 total=1316 Number of alignments=297 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yyvA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yyvA expands to /projects/compbio/data/pdb/1yyv.pdb.gz 1yyvA:Skipped atom 310, because occupancy 0.490 <= existing 0.510 in 1yyvA Skipped atom 312, because occupancy 0.490 <= existing 0.510 in 1yyvA Skipped atom 314, because occupancy 0.490 <= existing 0.510 in 1yyvA Skipped atom 316, because occupancy 0.490 <= existing 0.510 in 1yyvA Skipped atom 318, because occupancy 0.490 <= existing 0.510 in 1yyvA Skipped atom 320, because occupancy 0.490 <= existing 0.510 in 1yyvA Skipped atom 322, because occupancy 0.490 <= existing 0.510 in 1yyvA Bad short name: CH1 for alphabet: pdb_atoms Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: CH1 for alphabet: pdb_atoms Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 637, because occupancy 0.460 <= existing 0.540 in 1yyvA Skipped atom 639, because occupancy 0.460 <= existing 0.540 in 1yyvA Skipped atom 641, because occupancy 0.460 <= existing 0.540 in 1yyvA Skipped atom 643, because occupancy 0.460 <= existing 0.540 in 1yyvA Skipped atom 645, because occupancy 0.460 <= existing 0.540 in 1yyvA Skipped atom 647, because occupancy 0.460 <= existing 0.540 in 1yyvA Bad short name: CH1 for alphabet: pdb_atoms # T0373 read from 1yyvA/merged-local-a2m # 1yyvA read from 1yyvA/merged-local-a2m # adding 1yyvA to template set # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 T0373 47 :LGGDVTPSELA 1yyvA 42 :RDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRR 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQ Number of specific fragments extracted= 4 number of extra gaps= 1 total=1320 Number of alignments=298 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 T0373 47 :LGGDVTPSELA 1yyvA 42 :RDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRR 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQ Number of specific fragments extracted= 4 number of extra gaps= 1 total=1324 Number of alignments=299 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 T0373 47 :LGGDVTPSELA 1yyvA 42 :RDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGR 1yyvA 78 :RVSYPVVPPHVEYSLTPLGE Number of specific fragments extracted= 4 number of extra gaps= 1 total=1328 Number of alignments=300 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 T0373 48 :GGDVTPSELA 1yyvA 43 :DGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGR 1yyvA 78 :RVSYPVVPPHVEYSLTPLGE Number of specific fragments extracted= 4 number of extra gaps= 1 total=1332 Number of alignments=301 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 36 :SQLVVLGAIDRLGGDVTPSELA 1yyvA 31 :SRWGVLILVALRDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKRE 1yyvA 104 :AALAD Number of specific fragments extracted= 5 number of extra gaps= 1 total=1337 Number of alignments=302 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 36 :SQLVVLGAIDRLGGDVTPSELA 1yyvA 31 :SRWGVLILVALRDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREE 1yyvA 104 :AALADW T0373 115 :LV 1yyvA 110 :IE Number of specific fragments extracted= 6 number of extra gaps= 1 total=1343 Number of alignments=303 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 37 :QLVVLGAIDRLGGDVTPSELA 1yyvA 32 :RWGVLILVALRDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREE 1yyvA 104 :AALADW T0373 115 :LVRAM 1yyvA 110 :IELNL Number of specific fragments extracted= 6 number of extra gaps= 1 total=1349 Number of alignments=304 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 26 :REAQ 1yyvA 27 :KHVT T0373 34 :QFSQLVVLGAID 1yyvA 31 :SRWGVLILVALR T0373 48 :GGDVTPSELA 1yyvA 43 :DGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVRA 1yyvA 104 :AALADWIELNL Number of specific fragments extracted= 7 number of extra gaps= 1 total=1356 Number of alignments=305 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 Warning: unaligning (T0373)E127 because last residue in template chain is (1yyvA)E122 T0373 36 :SQLVVLGAIDRLGGDVTPSELA 1yyvA 31 :SRWGVLILVALRDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVRAM 1yyvA 104 :AALADWIELNLP T0373 121 :ACLDES 1yyvA 116 :QVLAQR Number of specific fragments extracted= 6 number of extra gaps= 1 total=1362 Number of alignments=306 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 Warning: unaligning (T0373)E127 because last residue in template chain is (1yyvA)E122 T0373 36 :SQLVVLGAIDRLGGDVTPSELA 1yyvA 31 :SRWGVLILVALRDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVRAM 1yyvA 104 :AALADWIELNLP T0373 121 :ACLDES 1yyvA 116 :QVLAQR Number of specific fragments extracted= 6 number of extra gaps= 1 total=1368 Number of alignments=307 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 34 :QFSQLVVLGAID 1yyvA 31 :SRWGVLILVALR T0373 48 :GGDVTPSELA 1yyvA 43 :DGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVRAM 1yyvA 104 :AALADWIELNLP Number of specific fragments extracted= 6 number of extra gaps= 1 total=1374 Number of alignments=308 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 7 :L 1yyvA 23 :R T0373 19 :TLTRRLR 1yyvA 24 :EVLKHVT T0373 34 :QFSQLVVLGAID 1yyvA 31 :SRWGVLILVALR T0373 48 :GGDVTPSELA 1yyvA 43 :DGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVRAM 1yyvA 104 :AALADWIELNLP Number of specific fragments extracted= 8 number of extra gaps= 1 total=1382 Number of alignments=309 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 Warning: unaligning (T0373)E127 because last residue in template chain is (1yyvA)E122 T0373 36 :SQLVVLGAIDRLGGDVTPSELA 1yyvA 31 :SRWGVLILVALRDGTHRFSDLR T0373 61 :R 1yyvA 56 :G T0373 62 :MR 1yyvA 58 :VS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVR 1yyvA 104 :AALADWIELN T0373 119 :MHACLDES 1yyvA 114 :LPQVLAQR Number of specific fragments extracted= 7 number of extra gaps= 1 total=1389 Number of alignments=310 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 36 :SQLVVLGAIDRLGGDVTPSELA 1yyvA 31 :SRWGVLILVALRDGTHRFSDLR T0373 61 :R 1yyvA 56 :G T0373 62 :MR 1yyvA 58 :VS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVR 1yyvA 104 :AALADWIELN T0373 119 :MHACL 1yyvA 114 :LPQVL Number of specific fragments extracted= 7 number of extra gaps= 1 total=1396 Number of alignments=311 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 T0373 38 :LVVLGAIDRLGGDVTPSELA 1yyvA 33 :WGVLILVALRDGTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVR 1yyvA 104 :AALADWIELN T0373 119 :MH 1yyvA 114 :LP Number of specific fragments extracted= 6 number of extra gaps= 1 total=1402 Number of alignments=312 # 1yyvA read from 1yyvA/merged-local-a2m # found chain 1yyvA in template set Warning: unaligning (T0373)A58 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M55 Warning: unaligning (T0373)E60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M55 Warning: unaligning (T0373)S64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)M62 Warning: unaligning (T0373)N66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)M62 Warning: unaligning (T0373)I80 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1yyvA)N77 Warning: unaligning (T0373)V81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1yyvA)N77 Warning: unaligning (T0373)Y105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yyvA)V103 Warning: unaligning (T0373)N107 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yyvA)V103 Warning: unaligning (T0373)D124 because last residue in template chain is (1yyvA)E122 T0373 23 :RLRREAQ 1yyvA 24 :EVLKHVT T0373 34 :QFSQLVVLGAIDR 1yyvA 31 :SRWGVLILVALRD T0373 49 :GDVTPSELA 1yyvA 44 :GTHRFSDLR T0373 61 :RMR 1yyvA 57 :GVS T0373 67 :LAALLRELERGGL 1yyvA 63 :LAQSLQALEQDGF T0373 82 :RHADPQDGRRTRVSLSSEGRRNL 1yyvA 78 :RVSYPVVPPHVEYSLTPLGEQVS T0373 108 :RAKREEWLVRA 1yyvA 104 :AALADWIELNL T0373 119 :MHACL 1yyvA 117 :VLAQR Number of specific fragments extracted= 8 number of extra gaps= 1 total=1410 Number of alignments=313 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1p4xA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1p4xA/merged-local-a2m # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 124 :SESQMIPKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQNKN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1p4xA 175 :VLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLLAQVNQLL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1412 Number of alignments=314 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 130 :PKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQNKN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1p4xA 175 :VLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLLAQVNQLL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1414 Number of alignments=315 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 35 :FSQLVVLGAIDRLG 1p4xA 158 :FVEFTILAIITSQN T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1p4xA 173 :NIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1416 Number of alignments=316 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLG 1p4xA 130 :PKDSKEFLNLMMYTMYFKNIIKKHLTLSFVEFTILAIITSQN T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1p4xA 173 :NIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1418 Number of alignments=317 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 35 :FSQLVVLGAIDR 1p4xA 34 :IKEFILLTYLFH T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1p4xA 47 :QENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQII T0373 117 :RAMH 1p4xA 116 :KQFN T0373 122 :CLDESERALL 1p4xA 120 :LADQSESQMI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1422 Number of alignments=318 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 20 :LTRRLRREAQADPVQFSQLVVLGAIDR 1p4xA 19 :MFRFKKKVKPEVDMTIKEFILLTYLFH T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1p4xA 47 :QENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQII T0373 117 :RAMH 1p4xA 116 :KQFN T0373 122 :CLDESERALL 1p4xA 120 :LADQSESQMI Number of specific fragments extracted= 4 number of extra gaps= 0 total=1426 Number of alignments=319 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 9 :IRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESER 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSESQM Number of specific fragments extracted= 2 number of extra gaps= 0 total=1428 Number of alignments=320 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 12 :HLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 11 :DFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSE Number of specific fragments extracted= 2 number of extra gaps= 0 total=1430 Number of alignments=321 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 9 :IRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSE T0373 126 :SERALLAAAGPLLTRLAQF 1p4xA 134 :KEFLNLMMYTMYFKNIIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1433 Number of alignments=322 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 2 :PTNQDLQLAAHLR 1p4xA 5 :NHDKIRDFIIIEA T0373 20 :LTRRLRREAQ 1p4xA 18 :YMFRFKKKVK T0373 30 :ADPVQFSQLVVLGAIDRLGGD 1p4xA 29 :EVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLAD T0373 128 :RALLAAAG 1p4xA 133 :SKEFLNLM T0373 136 :PLLTRLAQ 1p4xA 144 :MYFKNIIK Number of specific fragments extracted= 6 number of extra gaps= 0 total=1439 Number of alignments=323 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 6 :DLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1p4xA 5 :NHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESER 1p4xA 48 :ENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSESQM Number of specific fragments extracted= 2 number of extra gaps= 0 total=1441 Number of alignments=324 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1p4xA 9 :IRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQE T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESE 1p4xA 50 :TLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSESQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1443 Number of alignments=325 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1p4xA 8 :KIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQE T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1p4xA 50 :TLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSE T0373 126 :SERALLAAAGPLLTRLA 1p4xA 134 :KEFLNLMMYTMYFKNII Number of specific fragments extracted= 3 number of extra gaps= 0 total=1446 Number of alignments=326 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 2 :PTNQDLQLAAHLRSQVTTLTRRLR 1p4xA 4 :NNHDKIRDFIIIEAYMFRFKKKVK T0373 29 :QADPVQFSQLVVLGAIDRLGG 1p4xA 28 :PEVDMTIKEFILLTYLFHQQE T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1p4xA 50 :TLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLAD T0373 123 :LD 1p4xA 124 :SE T0373 126 :SERALLAAAGPLLTRLAQ 1p4xA 134 :KEFLNLMMYTMYFKNIIK Number of specific fragments extracted= 5 number of extra gaps= 0 total=1451 Number of alignments=327 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 2 :KYNNHDKIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESER 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSESQM Number of specific fragments extracted= 2 number of extra gaps= 0 total=1453 Number of alignments=328 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 8 :KIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESE 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSESQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1455 Number of alignments=329 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1p4xA 8 :KIRDFIIIEAYMFRFKKKVKPEVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLADQSE T0373 126 :SERALLAAAGPLLTRLAQ 1p4xA 134 :KEFLNLMMYTMYFKNIIK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1458 Number of alignments=330 # 1p4xA read from 1p4xA/merged-local-a2m # found chain 1p4xA in template set T0373 2 :PTNQDLQLAAHLRSQVTTLTRRLRR 1p4xA 4 :NNHDKIRDFIIIEAYMFRFKKKVKP T0373 30 :ADPVQFSQLVVLGAIDRLGGD 1p4xA 29 :EVDMTIKEFILLTYLFHQQEN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1p4xA 51 :LPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQIIKQFNLAD Number of specific fragments extracted= 3 number of extra gaps= 0 total=1461 Number of alignments=331 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1smtA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1smtA expands to /projects/compbio/data/pdb/1smt.pdb.gz 1smtA:# T0373 read from 1smtA/merged-local-a2m # 1smtA read from 1smtA/merged-local-a2m # adding 1smtA to template set # found chain 1smtA in template set T0373 38 :LVVLGAIDRL 1smtA 49 :LRLLSLLARS T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 59 :ELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSEGRRNLYGN 1smtA 95 :GRHVYYQLQDHHIVALYQN Number of specific fragments extracted= 3 number of extra gaps= 0 total=1464 Number of alignments=332 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1smtA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSEGRRNLYG 1smtA 94 :QGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1466 Number of alignments=333 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1smtA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSEGRRNLYG 1smtA 94 :QGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1468 Number of alignments=334 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1smtA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYR T0373 87 :QDGRRTRVSLSSEGRRNLYG 1smtA 93 :KQGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1470 Number of alignments=335 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 39 :VVLG 1smtA 53 :SLLA T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1smtA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYR T0373 87 :QDGRRTRVSLSSEGRRNLY 1smtA 93 :KQGRHVYYQLQDHHIVALY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1473 Number of alignments=336 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1smtA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1476 Number of alignments=337 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1479 Number of alignments=338 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSE 1smtA 95 :GRHVYYQLQDH T0373 100 :GRRNLYGNRAKREE 1smtA 107 :IVALYQNALDHLQE Number of specific fragments extracted= 5 number of extra gaps= 0 total=1484 Number of alignments=339 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 18 :TTLTRRLRREAQ 1smtA 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLS 1smtA 95 :GRHVYYQLQ T0373 98 :SEGRRNLYGNRAKREE 1smtA 105 :HHIVALYQNALDHLQE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1490 Number of alignments=340 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSL 1smtA 95 :GRHVYYQL Number of specific fragments extracted= 4 number of extra gaps= 0 total=1494 Number of alignments=341 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSS 1smtA 95 :GRHVYYQLQD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1498 Number of alignments=342 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 9 :LAAHLR 1smtA 32 :VAQSLA T0373 23 :RLRREA 1smtA 38 :EFFAVL T0373 33 :VQFSQLVVLGAIDR 1smtA 44 :ADPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSE 1smtA 95 :GRHVYYQLQDH T0373 100 :GRRNLYGNRAKREE 1smtA 107 :IVALYQNALDHLQE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1504 Number of alignments=343 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 2 :PTNQDL 1smtA 27 :AIAPEV T0373 18 :TTLTRRLRREAQ 1smtA 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAID 1smtA 45 :DPNRLRLLSLLA T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLS 1smtA 95 :GRHVYYQLQ T0373 98 :SEGRRNLYGNRAKREE 1smtA 105 :HHIVALYQNALDHLQE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1510 Number of alignments=344 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLI 1smtA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLV Number of specific fragments extracted= 2 number of extra gaps= 0 total=1512 Number of alignments=345 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1smtA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 99 :EGR 1smtA 94 :QGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=1515 Number of alignments=346 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 25 :RREAQADPVQFSQLVVLGAIDR 1smtA 36 :LAEFFAVLADPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSE 1smtA 95 :GRHVYYQLQDH T0373 106 :GNRAKREEWLVR 1smtA 106 :HIVALYQNALDH T0373 119 :M 1smtA 118 :L Number of specific fragments extracted= 5 number of extra gaps= 0 total=1520 Number of alignments=347 # 1smtA read from 1smtA/merged-local-a2m # found chain 1smtA in template set T0373 18 :TTLTRRLRREAQ 1smtA 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAIDR 1smtA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1smtA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQG T0373 90 :RRTRVSLSSE 1smtA 96 :RHVYYQLQDH T0373 106 :GNRAKREEWLVR 1smtA 106 :HIVALYQNALDH T0373 119 :MHA 1smtA 118 :LQE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1526 Number of alignments=348 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r1tA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1r1tA/merged-local-a2m # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1tA 94 :QGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1528 Number of alignments=349 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1tA 94 :QGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1530 Number of alignments=350 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 56 :ARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1tA 94 :QGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1532 Number of alignments=351 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 41 :LGAI 1r1tA 52 :LSLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 56 :ARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1tA 94 :QGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1535 Number of alignments=352 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 30 :ADPVQFSQLVVLG 1r1tA 44 :ADPNRLRLLSLLA T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1r1tA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1537 Number of alignments=353 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 37 :QLVVLG 1r1tA 51 :LLSLLA T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1r1tA 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYR T0373 87 :QDGRRTRVSLSSEGRRNLY 1r1tA 93 :KQGRHVYYQLQDHHIVALY Number of specific fragments extracted= 3 number of extra gaps= 0 total=1540 Number of alignments=354 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 48 :GG 1r1tA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1543 Number of alignments=355 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 48 :GG 1r1tA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1tA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1546 Number of alignments=356 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 26 :REAQ 1r1tA 41 :AVLA T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 48 :GG 1r1tA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1tA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSS 1r1tA 95 :GRHVYYQLQD T0373 105 :YGNRAKREE 1r1tA 105 :HHIVALYQN T0373 115 :LVR 1r1tA 114 :ALD Number of specific fragments extracted= 7 number of extra gaps= 0 total=1553 Number of alignments=357 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 18 :TTLTRRLRREAQ 1r1tA 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 48 :GG 1r1tA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1tA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLS 1r1tA 95 :GRHVYYQLQ T0373 98 :SEGRRNLYGNRAK 1r1tA 105 :HHIVALYQNALDH Number of specific fragments extracted= 6 number of extra gaps= 0 total=1559 Number of alignments=358 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 48 :GG 1r1tA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1tA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSL 1r1tA 95 :GRHVYYQL Number of specific fragments extracted= 4 number of extra gaps= 0 total=1563 Number of alignments=359 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 48 :GG 1r1tA 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1tA 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSS 1r1tA 95 :GRHVYYQLQD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1567 Number of alignments=360 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 9 :LAAHL 1r1tA 32 :VAQSL T0373 22 :RRLRREAQ 1r1tA 37 :AEFFAVLA T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1tA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSEGR 1r1tA 95 :GRHVYYQLQDHHI T0373 102 :RNLYGNRA 1r1tA 109 :ALYQNALD Number of specific fragments extracted= 6 number of extra gaps= 0 total=1573 Number of alignments=361 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 1 :MPTNQDL 1r1tA 26 :QAIAPEV T0373 18 :TTLTRRLRREAQ 1r1tA 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1tA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLS 1r1tA 95 :GRHVYYQLQ T0373 98 :SEGRRNLYGNRAK 1r1tA 105 :HHIVALYQNALDH Number of specific fragments extracted= 6 number of extra gaps= 0 total=1579 Number of alignments=362 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLI 1r1tA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLV Number of specific fragments extracted= 2 number of extra gaps= 0 total=1581 Number of alignments=363 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 99 :EGR 1r1tA 94 :QGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=1584 Number of alignments=364 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 24 :LRREAQADPVQFSQLVVLGAIDR 1r1tA 35 :SLAEFFAVLADPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSE 1r1tA 94 :QGRHVYYQLQDH T0373 110 :KREEWLVR 1r1tA 106 :HIVALYQN T0373 119 :MHA 1r1tA 114 :ALD Number of specific fragments extracted= 5 number of extra gaps= 0 total=1589 Number of alignments=365 # 1r1tA read from 1r1tA/merged-local-a2m # found chain 1r1tA in training set T0373 18 :TTLTRRLRREAQ 1r1tA 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAIDR 1r1tA 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1tA 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 88 :DGRRTRVSLSSE 1r1tA 94 :QGRHVYYQLQDH T0373 106 :GNRAKREEWLVR 1r1tA 106 :HIVALYQNALDH Number of specific fragments extracted= 5 number of extra gaps= 0 total=1594 Number of alignments=366 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1smtB/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1smtB expands to /projects/compbio/data/pdb/1smt.pdb.gz 1smtB:# T0373 read from 1smtB/merged-local-a2m # 1smtB read from 1smtB/merged-local-a2m # adding 1smtB to template set # found chain 1smtB in template set T0373 38 :LVVLGAIDRL 1smtB 49 :LRLLSLLARS T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 59 :ELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSEGRRNLYGN 1smtB 95 :GRHVYYQLQDHHIVALYQN Number of specific fragments extracted= 3 number of extra gaps= 0 total=1597 Number of alignments=367 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1smtB 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSY T0373 86 :PQDGRRTRVSLSSEGRRNLYG 1smtB 92 :RKQGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1599 Number of alignments=368 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1smtB 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSY T0373 86 :PQDGRRTRVSLSSEGRRNLYG 1smtB 92 :RKQGRHVYYQLQDHHIVALYQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1601 Number of alignments=369 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtB 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1smtB 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1604 Number of alignments=370 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtB 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=1607 Number of alignments=371 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtB 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSE 1smtB 95 :GRHVYYQLQDH T0373 100 :GRRNLYGNRAKR 1smtB 107 :IVALYQNALDHL Number of specific fragments extracted= 5 number of extra gaps= 0 total=1612 Number of alignments=372 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 18 :TTLTRRLRREAQ 1smtB 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtB 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1smtB 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQG T0373 90 :RRTRVSLS 1smtB 96 :RHVYYQLQ T0373 98 :SEGRRNLYGNRAKR 1smtB 105 :HHIVALYQNALDHL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1618 Number of alignments=373 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtB 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSL 1smtB 95 :GRHVYYQL Number of specific fragments extracted= 4 number of extra gaps= 0 total=1622 Number of alignments=374 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 48 :GG 1smtB 58 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 60 :LCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSS 1smtB 95 :GRHVYYQLQD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1626 Number of alignments=375 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 21 :TRRLRREAQ 1smtB 36 :LAEFFAVLA T0373 34 :QFSQLVVLGAID 1smtB 45 :DPNRLRLLSLLA T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSEG 1smtB 95 :GRHVYYQLQDHH T0373 101 :RRNLYGNRAKRE 1smtB 108 :VALYQNALDHLQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=1631 Number of alignments=376 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 1 :MPTNQDL 1smtB 26 :QAIAPEV T0373 18 :TTLTRRLRREAQ 1smtB 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAID 1smtB 45 :DPNRLRLLSLLA T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1smtB 57 :RSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQG T0373 90 :RRTRVSLS 1smtB 96 :RHVYYQLQ T0373 98 :SEGRRNLYGNRAKR 1smtB 105 :HHIVALYQNALDHL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1637 Number of alignments=377 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLI 1smtB 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLV Number of specific fragments extracted= 2 number of extra gaps= 0 total=1639 Number of alignments=378 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1smtB 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRK T0373 99 :EGR 1smtB 94 :QGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=1642 Number of alignments=379 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 25 :RREAQADPVQFSQLVVLGAIDR 1smtB 36 :LAEFFAVLADPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSE 1smtB 95 :GRHVYYQLQDH T0373 106 :GNRAKREEWLVR 1smtB 106 :HIVALYQNALDH Number of specific fragments extracted= 4 number of extra gaps= 0 total=1646 Number of alignments=380 # 1smtB read from 1smtB/merged-local-a2m # found chain 1smtB in template set T0373 18 :TTLTRRLRREAQ 1smtB 33 :AQSLAEFFAVLA T0373 34 :QFSQLVVLGAIDR 1smtB 45 :DPNRLRLLSLLAR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1smtB 58 :SELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQ T0373 89 :GRRTRVSLSSE 1smtB 95 :GRHVYYQLQDH T0373 106 :GNRAKREEWLVR 1smtB 106 :HIVALYQNALDH Number of specific fragments extracted= 5 number of extra gaps= 0 total=1651 Number of alignments=381 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1okrA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1okrA expands to /projects/compbio/data/pdb/1okr.pdb.gz 1okrA:# T0373 read from 1okrA/merged-local-a2m # 1okrA read from 1okrA/merged-local-a2m # adding 1okrA to template set # found chain 1okrA in template set Warning: unaligning (T0373)G100 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)R101 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 94 :VSLSSE 1okrA 58 :IDRKKD T0373 102 :RNLYGNRAKREEWLVRAMHACLDE 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINK Number of specific fragments extracted= 2 number of extra gaps= 1 total=1653 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)G100 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)R101 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 37 :QLVVLGAIDRLG 1okrA 12 :EWEVMNIIWMKK T0373 50 :DVTPSELAAA 1okrA 24 :YASANNIIEE T0373 60 :ERMRSSNLAALLRELERGGLIVRHAD 1okrA 38 :KDWSPKTIRTLITRLYKKGFIDRKKD T0373 102 :RNLYGNRAKREEWLVRAMHACLDE 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINK Number of specific fragments extracted= 4 number of extra gaps= 1 total=1657 Number of alignments=382 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDRLG 1okrA 7 :EISSAEWEVMNIIWMKK T0373 50 :DVTPSELAAAER 1okrA 24 :YASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGR 1okrA 66 :IFQYYSLVEESD Number of specific fragments extracted= 4 number of extra gaps= 1 total=1661 Number of alignments=383 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 33 :VQFSQLVVLGAIDRLG 1okrA 8 :ISSAEWEVMNIIWMKK T0373 50 :DVTPSELAAAER 1okrA 24 :YASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWL 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINKVY Number of specific fragments extracted= 4 number of extra gaps= 1 total=1665 Number of alignments=384 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDRLGG 1okrA 7 :EISSAEWEVMNIIWMKKY T0373 51 :VTPSELAAAERM 1okrA 25 :ASANNIIEEIQM T0373 63 :RSSNLAALLRELERGGLIVRHAD 1okrA 41 :SPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREE 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINK T0373 115 :LVRAMHAC 1okrA 90 :VYKGGFNS T0373 123 :LDESERALLAA 1okrA 108 :LSQDEIEELRN T0373 137 :LLTR 1okrA 119 :ILNK Number of specific fragments extracted= 7 number of extra gaps= 1 total=1672 Number of alignments=385 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDRLGG 1okrA 7 :EISSAEWEVMNIIWMKKY T0373 51 :VTPSELAAAERM 1okrA 25 :ASANNIIEEIQM T0373 63 :RSSNLAALLRELERGGLIVRHAD 1okrA 41 :SPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREE 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINK T0373 115 :LVRAMH 1okrA 90 :VYKGGF T0373 121 :ACLDESERALLAA 1okrA 106 :EDLSQDEIEELRN T0373 137 :LLTR 1okrA 119 :ILNK Number of specific fragments extracted= 7 number of extra gaps= 1 total=1679 Number of alignments=386 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDRLGG 1okrA 7 :EISSAEWEVMNIIWMKKY T0373 51 :VTPSELAAAER 1okrA 25 :ASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEW 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINKV T0373 115 :LVRAMH 1okrA 99 :VLNFVE T0373 121 :ACLDESERALLAA 1okrA 106 :EDLSQDEIEELRN T0373 137 :LL 1okrA 119 :IL Number of specific fragments extracted= 7 number of extra gaps= 1 total=1686 Number of alignments=387 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDRLGG 1okrA 7 :EISSAEWEVMNIIWMKKY T0373 51 :VTPSELAAAER 1okrA 25 :ASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 91 :RTRVSLS 1okrA 66 :IFQYYSL T0373 98 :SEGRRNLYGNRAKR 1okrA 76 :SDIKYKTSKNFINK T0373 113 :EWLVRAMHAC 1okrA 96 :NSLVLNFVEK T0373 123 :LDESERALLAA 1okrA 108 :LSQDEIEELRN T0373 137 :L 1okrA 119 :I Number of specific fragments extracted= 8 number of extra gaps= 2 total=1694 Number of alignments=388 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDR 1okrA 7 :EISSAEWEVMNIIWM T0373 48 :GGDVTPSELAAAE 1okrA 22 :KKYASANNIIEEI T0373 61 :RMRSSNLAALLRELERGGLIVRHAD 1okrA 39 :DWSPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINKVYKGGF T0373 120 :HACLDESERALLAA 1okrA 105 :KEDLSQDEIEELRN T0373 137 :LLTR 1okrA 119 :ILNK Number of specific fragments extracted= 6 number of extra gaps= 1 total=1700 Number of alignments=389 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDR 1okrA 7 :EISSAEWEVMNIIWM T0373 48 :GGDVTPSELAAAER 1okrA 22 :KKYASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINKVYKGGF T0373 120 :HACLDESERALLAA 1okrA 105 :KEDLSQDEIEELRN T0373 137 :LLTR 1okrA 119 :ILNK Number of specific fragments extracted= 6 number of extra gaps= 1 total=1706 Number of alignments=390 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)D88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)G89 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDR 1okrA 7 :EISSAEWEVMNIIWM T0373 48 :GGDVTPSELAAAER 1okrA 22 :KKYASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREE 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINK T0373 114 :WLVRAMHACLDESERALLAA 1okrA 99 :VLNFVEKEDLSQDEIEELRN T0373 137 :LL 1okrA 119 :IL Number of specific fragments extracted= 6 number of extra gaps= 1 total=1712 Number of alignments=391 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDRL 1okrA 7 :EISSAEWEVMNIIWMK T0373 49 :GDVTPSELAAAE 1okrA 23 :KYASANNIIEEI T0373 61 :RMRSSNLAALLRELERGGLIVRHAD 1okrA 39 :DWSPKTIRTLITRLYKKGFIDRKKD T0373 91 :RTRVSLS 1okrA 66 :IFQYYSL T0373 98 :SEGRRNLYGNR 1okrA 76 :SDIKYKTSKNF T0373 109 :AKREEWLVRA 1okrA 96 :NSLVLNFVEK T0373 121 :ACLDESERALLAA 1okrA 106 :EDLSQDEIEELRN Number of specific fragments extracted= 7 number of extra gaps= 2 total=1719 Number of alignments=392 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDR 1okrA 7 :EISSAEWEVMNIIWM T0373 48 :GGDVTPSELAAAERM 1okrA 22 :KKYASANNIIEEIQM T0373 63 :RSSNLAALLRELERGGLIVRHAD 1okrA 41 :SPKTIRTLITRLYKKGFIDRKKD Number of specific fragments extracted= 3 number of extra gaps= 1 total=1722 Number of alignments=393 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)Q29 because first residue in template chain is (1okrA)K4 Warning: unaligning (T0373)A30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)Y6 Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDR 1okrA 7 :EISSAEWEVMNIIWM T0373 48 :GGDVTPSELAAAERM 1okrA 22 :KKYASANNIIEEIQM T0373 63 :RSSNLAALLRELERGGLIVRHAD 1okrA 41 :SPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVR 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINKVYKG T0373 118 :AMHACLDESERALLAAA 1okrA 103 :VEKEDLSQDEIEELRNI Number of specific fragments extracted= 5 number of extra gaps= 1 total=1727 Number of alignments=394 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)D31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)Y6 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDR 1okrA 7 :EISSAEWEVMNIIWM T0373 48 :GGDVTPSELAAAER 1okrA 22 :KKYASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEW 1okrA 66 :IFQYYSLVEESDIKYKTSKNFINKV T0373 115 :LVRAMHACLDESERAL 1okrA 100 :LNFVEKEDLSQDEIEE Number of specific fragments extracted= 5 number of extra gaps= 2 total=1732 Number of alignments=395 # 1okrA read from 1okrA/merged-local-a2m # found chain 1okrA in template set Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1okrA)K65 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1okrA)K65 T0373 32 :PVQFSQLVVLGAIDR 1okrA 7 :EISSAEWEVMNIIWM T0373 48 :GGDVTPSELAAAER 1okrA 22 :KKYASANNIIEEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1okrA 40 :WSPKTIRTLITRLYKKGFIDRKKD T0373 91 :RTRVSLS 1okrA 66 :IFQYYSL T0373 98 :SEGRRNLYGNR 1okrA 76 :SDIKYKTSKNF T0373 109 :AKREEWLVR 1okrA 96 :NSLVLNFVE T0373 120 :HACLDESERALLAAA 1okrA 105 :KEDLSQDEIEELRNI Number of specific fragments extracted= 7 number of extra gaps= 1 total=1739 Number of alignments=396 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r7jA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1r7jA/merged-local-a2m # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 39 :VVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLI 1r7jA 9 :IIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEII Number of specific fragments extracted= 1 number of extra gaps= 0 total=1740 Number of alignments=397 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 43 :AIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1r7jA 13 :ILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQ T0373 90 :RRTRVSLSSEGRR 1r7jA 53 :EGKQYMLTKKGEE Number of specific fragments extracted= 2 number of extra gaps= 0 total=1742 Number of alignments=398 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 39 :VVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIV 1r7jA 9 :IIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIR T0373 89 :GRRTRVSLSSEGRRNL 1r7jA 52 :QEGKQYMLTKKGEELL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1744 Number of alignments=399 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 40 :VLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIV 1r7jA 10 :IQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIR T0373 89 :GRRTRVSLSSEGRRN 1r7jA 52 :QEGKQYMLTKKGEEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1746 Number of alignments=400 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 39 :VVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1r7jA 9 :IIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQ T0373 90 :RRTRVSLSSEGRRNL 1r7jA 53 :EGKQYMLTKKGEELL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1748 Number of alignments=401 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 39 :VVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1r7jA 9 :IIQAILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQ T0373 90 :RRTRVSLSSEGRRN 1r7jA 53 :EGKQYMLTKKGEEL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1750 Number of alignments=402 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 43 :AIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1r7jA 13 :ILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQE T0373 91 :RTRVSLSSEGRRNLYGNRAK 1r7jA 54 :GKQYMLTKKGEELLEDIRKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=1752 Number of alignments=403 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r7jA 19 :SGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEG T0373 92 :TRVSLSSEGRRNLYGNRAK 1r7jA 55 :KQYMLTKKGEELLEDIRKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=1754 Number of alignments=404 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 42 :GAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r7jA 12 :AILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEG T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1r7jA 55 :KQYMLTKKGEELLEDIRKFNEM T0373 116 :V 1r7jA 77 :R T0373 126 :SERAL 1r7jA 78 :KNMDQ T0373 137 :LLTRLAQFE 1r7jA 83 :LKEKINSVL Number of specific fragments extracted= 5 number of extra gaps= 0 total=1759 Number of alignments=405 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 38 :LVVLGAID 1r7jA 11 :QAILEACK T0373 48 :GG 1r7jA 19 :SG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1r7jA 21 :SPKTRIMYGANLSYALTGRYIKMLMDLEIIRQE T0373 86 :PQ 1r7jA 54 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREE 1r7jA 56 :QYMLTKKGEELLEDIRKFNEM T0373 115 :LVRA 1r7jA 77 :RKNM T0373 129 :ALLAA 1r7jA 81 :DQLKE T0373 140 :RLAQF 1r7jA 86 :KINSV Number of specific fragments extracted= 8 number of extra gaps= 0 total=1767 Number of alignments=406 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 61 :RMRSSNLAALLRELERGGLIVRHA 1r7jA 31 :NLSYALTGRYIKMLMDLEIIRQEG T0373 92 :TRVSLSSEGRRNLYGNRAK 1r7jA 55 :KQYMLTKKGEELLEDIRKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=1769 Number of alignments=407 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r7jA 20 :GSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEG T0373 92 :TRVSLSSEGRRNLYGNRAKR 1r7jA 55 :KQYMLTKKGEELLEDIRKFN Number of specific fragments extracted= 2 number of extra gaps= 0 total=1771 Number of alignments=408 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set Warning: unaligning (T0373)E146 because last residue in template chain is (1r7jA)S92 T0373 43 :AIDRL 1r7jA 12 :AILEA T0373 48 :GG 1r7jA 19 :SG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1r7jA 21 :SPKTRIMYGANLSYALTGRYIKMLMDLEIIRQE T0373 86 :PQ 1r7jA 54 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 1r7jA 56 :QYMLTKKGEELLEDIRKFNEMRKNMDQ T0373 137 :LLTRLAQFE 1r7jA 83 :LKEKINSVL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1777 Number of alignments=409 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set Warning: unaligning (T0373)E146 because last residue in template chain is (1r7jA)S92 T0373 36 :SQLVVLGAID 1r7jA 9 :IIQAILEACK T0373 48 :GG 1r7jA 19 :SG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1r7jA 21 :SPKTRIMYGANLSYALTGRYIKMLMDLEIIRQE T0373 86 :PQ 1r7jA 54 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 1r7jA 56 :QYMLTKKGEELLEDIRKFNEMRKNMDQ T0373 137 :LLTRLAQFE 1r7jA 83 :LKEKINSVL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1783 Number of alignments=410 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 96 :LSSEGRRNLYGNRAK 1r7jA 59 :LTKKGEELLEDIRKF Number of specific fragments extracted= 1 number of extra gaps= 0 total=1784 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r7jA 20 :GSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEG T0373 92 :TRVSLSSEGRRNLYGNRAKR 1r7jA 55 :KQYMLTKKGEELLEDIRKFN Number of specific fragments extracted= 2 number of extra gaps= 0 total=1786 Number of alignments=411 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 42 :GAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r7jA 12 :AILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1r7jA 56 :QYMLTKKGEELLEDIRKFNEMRKNM Number of specific fragments extracted= 2 number of extra gaps= 0 total=1788 Number of alignments=412 # 1r7jA read from 1r7jA/merged-local-a2m # found chain 1r7jA in training set T0373 42 :GAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r7jA 12 :AILEACKSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAMHA 1r7jA 56 :QYMLTKKGEELLEDIRKFNEMRKNMDQLK T0373 133 :A 1r7jA 85 :E Number of specific fragments extracted= 3 number of extra gaps= 0 total=1791 Number of alignments=413 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dpuA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1dpuA expands to /projects/compbio/data/pdb/1dpu.pdb.gz 1dpuA:# T0373 read from 1dpuA/merged-local-a2m # 1dpuA read from 1dpuA/merged-local-a2m # adding 1dpuA to template set # found chain 1dpuA in template set T0373 36 :SQLVVLGAIDRLG 1dpuA 208 :AQNQVLNLIKACP T0373 49 :GDVTPSELAAAER 1dpuA 223 :EGLNFQDLKNQLK T0373 62 :MRSSNLAALLRELERGGLIVRHADPQD 1dpuA 237 :MSVSSIKQAVDFLSNEGHIYSTVDDDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=1794 Number of alignments=414 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set T0373 37 :QLVVLGAIDRLGGD 1dpuA 209 :QNQVLNLIKACPRP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1795 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set T0373 37 :QLVVLGAIDRLGGD 1dpuA 209 :QNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVR 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYS Number of specific fragments extracted= 3 number of extra gaps= 0 total=1798 Number of alignments=415 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set T0373 35 :FSQLVVLGAIDRLGGD 1dpuA 237 :MSVSSIKQAVDFLSNE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1799 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set T0373 52 :TPSELAAAER 1dpuA 226 :NFQDLKNQLK T0373 62 :MRSSNLAALLRELERGGLI 1dpuA 237 :MSVSSIKQAVDFLSNEGHI Number of specific fragments extracted= 2 number of extra gaps= 0 total=1801 Number of alignments=416 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=1804 Number of alignments=417 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQD 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=1807 Number of alignments=418 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=1810 Number of alignments=419 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD T0373 93 :RVSLSS 1dpuA 263 :HFKSTD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1814 Number of alignments=420 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=1817 Number of alignments=421 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQD 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=1820 Number of alignments=422 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD T0373 93 :RVS 1dpuA 263 :HFK Number of specific fragments extracted= 4 number of extra gaps= 0 total=1824 Number of alignments=423 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD T0373 93 :RVSLSS 1dpuA 263 :HFKSTD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1828 Number of alignments=424 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=1831 Number of alignments=425 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=1834 Number of alignments=426 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQD 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=1837 Number of alignments=427 # 1dpuA read from 1dpuA/merged-local-a2m # found chain 1dpuA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1dpuA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1dpuA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1dpuA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1dpuA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD T0373 93 :RVSLS 1dpuA 263 :HFKST Number of specific fragments extracted= 4 number of extra gaps= 0 total=1841 Number of alignments=428 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fbhA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 2fbhA/merged-local-a2m # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALL 2fbhA 120 :TGIDESEQALC Number of specific fragments extracted= 4 number of extra gaps= 2 total=1845 Number of alignments=429 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 13 :LRSQVTTLTRRLRREAQADPVQF 2fbhA 13 :LAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALLAAA 2fbhA 118 :VLTGIDESEQALCQQV Number of specific fragments extracted= 4 number of extra gaps= 2 total=1849 Number of alignments=430 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALL 2fbhA 120 :TGIDESEQALC Number of specific fragments extracted= 4 number of extra gaps= 2 total=1853 Number of alignments=431 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALLAAA 2fbhA 118 :VLTGIDESEQALCQQV Number of specific fragments extracted= 4 number of extra gaps= 2 total=1857 Number of alignments=432 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALL 2fbhA 120 :TGIDESEQALC Number of specific fragments extracted= 4 number of extra gaps= 2 total=1861 Number of alignments=433 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 13 :LRSQVTTLTRRLRREAQADPVQF 2fbhA 13 :LAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALLA 2fbhA 118 :VLTGIDESEQALCQ Number of specific fragments extracted= 4 number of extra gaps= 2 total=1865 Number of alignments=434 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAAS T0373 115 :LVRAMHACLDESERALLAA 2fbhA 114 :VRNDVLTGIDESEQALCQQ T0373 137 :LLTRLAQFEEP 2fbhA 133 :VLLRILANLEN Number of specific fragments extracted= 5 number of extra gaps= 2 total=1870 Number of alignments=435 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAAS T0373 115 :LVRAMHACLDESERALLAA 2fbhA 114 :VRNDVLTGIDESEQALCQQ T0373 137 :LLTRLAQF 2fbhA 133 :VLLRILAN Number of specific fragments extracted= 5 number of extra gaps= 2 total=1875 Number of alignments=436 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAAS T0373 115 :LVRAMHACLDESERALLAA 2fbhA 114 :VRNDVLTGIDESEQALCQQ T0373 137 :LLTRLAQFEE 2fbhA 133 :VLLRILANLE Number of specific fragments extracted= 5 number of extra gaps= 2 total=1880 Number of alignments=437 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAAS T0373 115 :LVRAMHACLDESERALLAA 2fbhA 114 :VRNDVLTGIDESEQALCQQ T0373 137 :LLTRLAQF 2fbhA 133 :VLLRILAN Number of specific fragments extracted= 5 number of extra gaps= 2 total=1885 Number of alignments=438 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALLAA 2fbhA 120 :TGIDESEQALCQQ T0373 137 :LLTRLAQFEEP 2fbhA 133 :VLLRILANLEN Number of specific fragments extracted= 5 number of extra gaps= 2 total=1890 Number of alignments=439 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALLAA 2fbhA 120 :TGIDESEQALCQQ T0373 137 :LLTRLAQFE 2fbhA 133 :VLLRILANL Number of specific fragments extracted= 5 number of extra gaps= 2 total=1895 Number of alignments=440 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALLAA 2fbhA 120 :TGIDESEQALCQQ T0373 137 :LLTRLAQFEE 2fbhA 133 :VLLRILANLE Number of specific fragments extracted= 5 number of extra gaps= 2 total=1900 Number of alignments=441 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 12 :HLRSQVTTLTRRLRREAQADPVQF 2fbhA 12 :LLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRNDVL T0373 121 :ACLDESERALLAA 2fbhA 120 :TGIDESEQALCQQ T0373 137 :LLTRLAQF 2fbhA 133 :VLLRILAN Number of specific fragments extracted= 5 number of extra gaps= 2 total=1905 Number of alignments=442 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALL 2fbhA 118 :VLTGIDESEQALC Number of specific fragments extracted= 4 number of extra gaps= 2 total=1909 Number of alignments=443 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALLAAA 2fbhA 118 :VLTGIDESEQALCQQV Number of specific fragments extracted= 4 number of extra gaps= 2 total=1913 Number of alignments=444 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)Q8 because first residue in template chain is (2fbhA)Y8 Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQF 2fbhA 9 :FGTLLAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALL 2fbhA 118 :VLTGIDESEQALC Number of specific fragments extracted= 4 number of extra gaps= 2 total=1917 Number of alignments=445 # 2fbhA read from 2fbhA/merged-local-a2m # found chain 2fbhA in template set Warning: unaligning (T0373)S36 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fbhA)R37 Warning: unaligning (T0373)Q37 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fbhA)R37 Warning: unaligning (T0373)E60 because of BadResidue code BAD_PEPTIDE in next template residue (2fbhA)G61 Warning: unaligning (T0373)R61 because of BadResidue code BAD_PEPTIDE at template residue (2fbhA)G61 T0373 13 :LRSQVTTLTRRLRREAQADPVQF 2fbhA 13 :LAQTSRAWRAELDRRLSHLGLSQ T0373 38 :LVVLGAIDRLGGDVTPSELAAA 2fbhA 38 :WLVLLHLARHRDSPTQRELAQS T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2fbhA 62 :VEGPTLARLLDGLESQGLVRRLAVAEDRRAKHIVLTPKADVLIADIEAIAASVRND T0373 119 :MHACLDESERALLAAAGPLLTRLAQF 2fbhA 118 :VLTGIDESEQALCQQVLLRILANLEN Number of specific fragments extracted= 4 number of extra gaps= 2 total=1921 Number of alignments=446 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yg2A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yg2A expands to /projects/compbio/data/pdb/1yg2.pdb.gz 1yg2A:# T0373 read from 1yg2A/merged-local-a2m # 1yg2A read from 1yg2A/merged-local-a2m # adding 1yg2A to template set # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 70 :LLRELERGGLIVRHA 1yg2A 43 :ELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREE 1yg2A 69 :YSITQAGRSALGEWFDQPTA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1923 Number of alignments=447 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 37 :QLVVLGAIDR 1yg2A 4 :PHVILTVLST T0373 49 :GDVTPSELAAAE 1yg2A 14 :RDATGYDITKEF T0373 61 :RMRSSNLAALLRELERGGLIVRHA 1yg2A 34 :KASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREE 1yg2A 69 :YSITQAGRSALGEWFDQPTA Number of specific fragments extracted= 4 number of extra gaps= 0 total=1927 Number of alignments=448 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 70 :LLRELERGGLIVRHA 1yg2A 43 :ELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREE 1yg2A 69 :YSITQAGRSALGEWFDQPTA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1929 Number of alignments=449 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 37 :QLVVLGAIDR 1yg2A 4 :PHVILTVLST T0373 49 :GDVTPSELAAAERMR 1yg2A 14 :RDATGYDITKEFSAS T0373 64 :SSNLAALLRELERGGLIVRHA 1yg2A 37 :HQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREEW 1yg2A 69 :YSITQAGRSALGEWFDQPTAH Number of specific fragments extracted= 4 number of extra gaps= 0 total=1933 Number of alignments=450 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 70 :LLRELERGGLIVRHA 1yg2A 43 :ELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREE 1yg2A 69 :YSITQAGRSALGEWFDQPTA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1935 Number of alignments=451 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 38 :LVVLGAID 1yg2A 5 :HVILTVLS T0373 48 :GGDVTPSELAAAERMRSSNL 1yg2A 13 :TRDATGYDITKEFSASIGYF T0373 68 :AALLRELERGGLIVRHA 1yg2A 41 :YRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREE 1yg2A 69 :YSITQAGRSALGEWFDQPTA Number of specific fragments extracted= 4 number of extra gaps= 0 total=1939 Number of alignments=452 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHA 1yg2A 29 :IGYFWKASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1941 Number of alignments=453 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 55 :ELAAAERMRSSNLAALLRELERGGLIVRHA 1yg2A 28 :SIGYFWKASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREE 1yg2A 69 :YSITQAGRSALGEWFDQPTA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1943 Number of alignments=454 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 38 :LVVLGAIDR 1yg2A 5 :HVILTVLST T0373 48 :GG 1yg2A 14 :RD T0373 51 :VTPSELAAAER 1yg2A 16 :ATGYDITKEFS T0373 62 :MRSSNLAALLRELERGGLIVRHA 1yg2A 35 :ASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD T0373 111 :REE 1yg2A 93 :RDE T0373 115 :LVRAMHAC 1yg2A 96 :FSAKLMAC T0373 123 :LD 1yg2A 106 :QS T0373 125 :ESERALLAAAGPLLTRLAQF 1yg2A 109 :EPYRLQLAELVEESRKLVAH Number of specific fragments extracted= 9 number of extra gaps= 0 total=1952 Number of alignments=455 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 36 :SQLVVLGAIDR 1yg2A 3 :LPHVILTVLST T0373 48 :GG 1yg2A 14 :RD T0373 51 :VTPSELAAAER 1yg2A 16 :ATGYDITKEFS T0373 62 :MRSSNLAALLRELERGGLIVRHA 1yg2A 35 :ASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD T0373 113 :E 1yg2A 95 :E T0373 115 :LVRAMHAC 1yg2A 96 :FSAKLMAC T0373 125 :ESERALLAAAGPLLTRLAQF 1yg2A 109 :EPYRLQLAELVEESRKLVAH Number of specific fragments extracted= 8 number of extra gaps= 0 total=1960 Number of alignments=456 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHA 1yg2A 29 :IGYFWKASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1962 Number of alignments=457 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHA 1yg2A 29 :IGYFWKASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKRE 1yg2A 69 :YSITQAGRSALGEWFDQPT Number of specific fragments extracted= 2 number of extra gaps= 0 total=1964 Number of alignments=458 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 38 :LVVLGAIDR 1yg2A 5 :HVILTVLST T0373 48 :GG 1yg2A 14 :RD T0373 51 :VTPSELAAAER 1yg2A 16 :ATGYDITKEFS T0373 62 :MRSSNLAALLRELERGGLIVRHA 1yg2A 35 :ASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD T0373 113 :EWLVRAM 1yg2A 95 :EFSAKLM T0373 120 :HACLDESE 1yg2A 103 :CSVQSAEP T0373 128 :RALLAAAGPLLTRLAQF 1yg2A 112 :RLQLAELVEESRKLVAH Number of specific fragments extracted= 8 number of extra gaps= 0 total=1972 Number of alignments=459 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 36 :SQLVVLGAIDR 1yg2A 3 :LPHVILTVLST T0373 49 :GDVTPSELAAAER 1yg2A 14 :RDATGYDITKEFS T0373 62 :MRSSNLAALLRELERGGLIVRHA 1yg2A 35 :ASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD T0373 110 :KREEWLVRA 1yg2A 95 :EFSAKLMAC T0373 121 :ACLD 1yg2A 104 :SVQS T0373 125 :ESERALLAAAGPLLTRLAQF 1yg2A 109 :EPYRLQLAELVEESRKLVAH Number of specific fragments extracted= 7 number of extra gaps= 0 total=1979 Number of alignments=460 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHA 1yg2A 29 :IGYFWKASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREEW 1yg2A 69 :YSITQAGRSALGEWFDQPTAH Number of specific fragments extracted= 2 number of extra gaps= 0 total=1981 Number of alignments=461 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 59 :AERMRSSNLAALLRELERGGLIVRHA 1yg2A 32 :FWKASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRAKREE 1yg2A 69 :YSITQAGRSALGEWFDQPTA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1983 Number of alignments=462 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 39 :VVLGAIDR 1yg2A 6 :VILTVLST T0373 49 :GDVTPSELAAAER 1yg2A 14 :RDATGYDITKEFS T0373 62 :MRSSNLAALLRELERGGLIVRHA 1yg2A 35 :ASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD Number of specific fragments extracted= 4 number of extra gaps= 0 total=1987 Number of alignments=463 # 1yg2A read from 1yg2A/merged-local-a2m # found chain 1yg2A in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1yg2A)V68 Warning: unaligning (T0373)R93 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1yg2A)V68 T0373 37 :QLVVLGAIDR 1yg2A 4 :PHVILTVLST T0373 49 :GDVTPSELAAAER 1yg2A 14 :RDATGYDITKEFS T0373 62 :MRSSNLAALLRELERGGLIVRHA 1yg2A 35 :ASHQQVYRELNKMGEQGLVTCVL T0373 94 :VSLSSEGRRNLYGNRA 1yg2A 69 :YSITQAGRSALGEWFD T0373 110 :KREEWLVR 1yg2A 95 :EFSAKLMA T0373 119 :M 1yg2A 103 :C T0373 121 :ACLD 1yg2A 104 :SVQS T0373 125 :ESERALLAAAGPLLTRLAQ 1yg2A 109 :EPYRLQLAELVEESRKLVA Number of specific fragments extracted= 8 number of extra gaps= 0 total=1995 Number of alignments=464 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fxaA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 2fxaA/merged-local-a2m # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 59 :NGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLY 2fxaA 103 :YVQLTEEGTEVFW Number of specific fragments extracted= 2 number of extra gaps= 0 total=1997 Number of alignments=465 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 45 :DRLGG 2fxaA 56 :YQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYG 2fxaA 103 :YVQLTEEGTEVFWS Number of specific fragments extracted= 3 number of extra gaps= 0 total=2000 Number of alignments=466 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 59 :NGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLY 2fxaA 103 :YVQLTEEGTEVFW Number of specific fragments extracted= 2 number of extra gaps= 0 total=2002 Number of alignments=467 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 46 :RLGG 2fxaA 57 :QLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYG 2fxaA 103 :YVQLTEEGTEVFWS Number of specific fragments extracted= 3 number of extra gaps= 0 total=2005 Number of alignments=468 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 59 :NGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLY 2fxaA 103 :YVQLTEEGTEVFW Number of specific fragments extracted= 2 number of extra gaps= 0 total=2007 Number of alignments=469 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 46 :RLGG 2fxaA 57 :QLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYG 2fxaA 103 :YVQLTEEGTEVFWS Number of specific fragments extracted= 3 number of extra gaps= 0 total=2010 Number of alignments=470 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 16 :QVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 27 :LWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAKREE 2fxaA 103 :YVQLTEEGTEVFWSLLEEFDP T0373 115 :LVRAMHAC 2fxaA 124 :TRNAVFKG Number of specific fragments extracted= 4 number of extra gaps= 0 total=2014 Number of alignments=471 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 12 :HLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 23 :LSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAKREE 2fxaA 103 :YVQLTEEGTEVFWSLLEEFDP T0373 115 :LVRAMHACLD 2fxaA 124 :TRNAVFKGSQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=2018 Number of alignments=472 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 22 :QLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAK 2fxaA 103 :YVQLTEEGTEVFWSLLEE T0373 111 :REE 2fxaA 131 :GSQ T0373 115 :LVRAMHACLDE 2fxaA 134 :PLYHLFGKFPE T0373 126 :SERALLAA 2fxaA 146 :AEMMCMIR Number of specific fragments extracted= 6 number of extra gaps= 0 total=2024 Number of alignments=473 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fxaA)D9 Warning: unaligning (T0373)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fxaA)D9 Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 2 :P 2fxaA 7 :P T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 16 :FTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAK 2fxaA 103 :YVQLTEEGTEVFWSLLEE Number of specific fragments extracted= 4 number of extra gaps= 1 total=2028 Number of alignments=474 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 16 :QVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 27 :LWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 2fxaA 103 :YVQLTEEGTEVFWSLLEEFDPTRNAVF T0373 121 :AC 2fxaA 130 :KG Number of specific fragments extracted= 4 number of extra gaps= 0 total=2032 Number of alignments=475 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 12 :HLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 23 :LSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 2fxaA 103 :YVQLTEEGTEVFWSLLEEFDPTRNAVF T0373 121 :ACL 2fxaA 130 :KGS Number of specific fragments extracted= 4 number of extra gaps= 0 total=2036 Number of alignments=476 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fxaA)D9 Warning: unaligning (T0373)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fxaA)D9 Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 1 :MP 2fxaA 6 :PP T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 16 :FTQKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRA 2fxaA 103 :YVQLTEEGTEVFWSLLE T0373 111 :REEWLVRAM 2fxaA 131 :GSQPLYHLF T0373 121 :ACLD 2fxaA 140 :GKFP T0373 126 :SERALLAAAG 2fxaA 146 :AEMMCMIRHI T0373 137 :LLTRLAQFEEP 2fxaA 156 :YGDDFMEIFET Number of specific fragments extracted= 8 number of extra gaps= 1 total=2044 Number of alignments=477 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)T3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2fxaA)D9 Warning: unaligning (T0373)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2fxaA)D9 Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 1 :MP 2fxaA 6 :PP T0373 5 :QD 2fxaA 10 :VK T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2fxaA 18 :QKMAQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQLNG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 61 :ASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRA 2fxaA 103 :YVQLTEEGTEVFWSLLE T0373 111 :REEW 2fxaA 128 :VFKG T0373 115 :LVRAM 2fxaA 135 :LYHLF T0373 121 :ACLD 2fxaA 140 :GKFP T0373 125 :ESERALLAAAGP 2fxaA 146 :AEMMCMIRHIYG T0373 139 :TRLAQFEE 2fxaA 158 :DDFMEIFE Number of specific fragments extracted= 10 number of extra gaps= 1 total=2054 Number of alignments=478 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 16 :QVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2fxaA 27 :LWKSIEKDWQQWLKPYDLNINEHHILWIAYQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 58 :LNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 2fxaA 103 :YVQLTEEGTEVFWSLLEEFDPTRNA T0373 119 :MHACLDE 2fxaA 128 :VFKGSQP Number of specific fragments extracted= 4 number of extra gaps= 0 total=2058 Number of alignments=479 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 14 :RSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2fxaA 25 :KALWKSIEKDWQQWLKPYDLNINEHHILWIAYQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 58 :LNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 2fxaA 103 :YVQLTEEGTEVFWSLLEEFDPTRNA T0373 119 :MHACL 2fxaA 128 :VFKGS Number of specific fragments extracted= 4 number of extra gaps= 0 total=2062 Number of alignments=480 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 16 :QVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2fxaA 27 :LWKSIEKDWQQWLKPYDLNINEHHILWIAYQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 58 :LNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNR 2fxaA 103 :YVQLTEEGTEVFWSLL T0373 121 :ACLDE 2fxaA 119 :EEFDP Number of specific fragments extracted= 4 number of extra gaps= 0 total=2066 Number of alignments=481 # 2fxaA read from 2fxaA/merged-local-a2m # found chain 2fxaA in template set Warning: unaligning (T0373)D85 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fxaA)T102 Warning: unaligning (T0373)T92 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fxaA)T102 T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2fxaA 21 :AQLSKALWKSIEKDWQQWLKPYDLNINEHHILWIAYQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2fxaA 58 :LNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSK T0373 93 :RVSLSSEGRRNLYGNRAK 2fxaA 103 :YVQLTEEGTEVFWSLLEE T0373 112 :EEWLVR 2fxaA 133 :QPLYHL T0373 120 :HACLD 2fxaA 139 :FGKFP T0373 125 :ESERALLAA 2fxaA 146 :AEMMCMIRH Number of specific fragments extracted= 6 number of extra gaps= 0 total=2072 Number of alignments=482 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2dbbA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2dbbA expands to /projects/compbio/data/pdb/2dbb.pdb.gz 2dbbA:# T0373 read from 2dbbA/merged-local-a2m # 2dbbA read from 2dbbA/merged-local-a2m # adding 2dbbA to template set # found chain 2dbbA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2073 Number of alignments=483 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=2074 Number of alignments=484 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2075 Number of alignments=485 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=2076 Number of alignments=486 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2077 Number of alignments=487 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=2078 Number of alignments=488 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 33 :VQFSQLVVLGAIDRLGG 2dbbA 7 :LDRVDMQLVKILSENSR T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPD Number of specific fragments extracted= 2 number of extra gaps= 0 total=2080 Number of alignments=489 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 33 :VQFSQLVVLGAIDRLGG 2dbbA 7 :LDRVDMQLVKILSENSR T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKLGIIRKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=2082 Number of alignments=490 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 43 :AIDRLGG 2dbbA 17 :ILSENSR T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVR 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKLGIIRK T0373 83 :HADPQDGRRTRVSL 2dbbA 59 :IPDIDKLGYMYAIV T0373 98 :S 2dbbA 76 :S T0373 106 :GNRAKREE 2dbbA 77 :KVPSDADK T0373 115 :LVRAMHA 2dbbA 85 :VISEISD Number of specific fragments extracted= 6 number of extra gaps= 0 total=2088 Number of alignments=491 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set Warning: unaligning (T0373)P32 because first residue in template chain is (2dbbA)K6 T0373 33 :VQFSQLVVLGAIDR 2dbbA 7 :LDRVDMQLVKILSE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLI 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGII T0373 81 :VRHADPQDGRRTRVSLS 2dbbA 57 :TIIPDIDKLGYMYAIVL T0373 107 :NRAKREE 2dbbA 78 :VPSDADK T0373 115 :LVRAMHAC 2dbbA 85 :VISEISDI T0373 124 :DESERALLAA 2dbbA 116 :DIKDAENLIS T0373 140 :RLAQFEEP 2dbbA 126 :EFLQRIKN Number of specific fragments extracted= 7 number of extra gaps= 0 total=2095 Number of alignments=492 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 33 :VQFSQLVVLGAIDRLGG 2dbbA 7 :LDRVDMQLVKILSENSR T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKLGIIRKFTIIPD Number of specific fragments extracted= 2 number of extra gaps= 0 total=2097 Number of alignments=493 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 33 :VQFSQLVVLGAIDRLGG 2dbbA 7 :LDRVDMQLVKILSENSR T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKLGIIRKFT Number of specific fragments extracted= 2 number of extra gaps= 0 total=2099 Number of alignments=494 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 33 :VQFSQLVVLGAIDRLGG 2dbbA 7 :LDRVDMQLVKILSENSR T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLI 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKLGII T0373 81 :VRHADPQDGRRTRVSL 2dbbA 57 :TIIPDIDKLGYMYAIV T0373 105 :YGNRAKREEWLVRAM 2dbbA 76 :SKVPSDADKVISEIS T0373 121 :A 2dbbA 91 :D Number of specific fragments extracted= 5 number of extra gaps= 0 total=2104 Number of alignments=495 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set Warning: unaligning (T0373)P32 because first residue in template chain is (2dbbA)K6 T0373 33 :VQFSQLVVLGAIDRLGG 2dbbA 7 :LDRVDMQLVKILSENSR T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLI 2dbbA 24 :LTYRELADILNTTRQRIARRIDKLKKLGII T0373 81 :VRHADPQDGRRTRVSLS 2dbbA 57 :TIIPDIDKLGYMYAIVL T0373 98 :SEGRRNLYGN 2dbbA 83 :DKVISEISDI T0373 109 :AKREEWLVRAM 2dbbA 118 :KDAENLISEFL T0373 121 :ACLD 2dbbA 129 :QRIK Number of specific fragments extracted= 6 number of extra gaps= 0 total=2110 Number of alignments=496 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 33 :VQFSQLVVLGAIDR 2dbbA 7 :LDRVDMQLVKILSE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=2112 Number of alignments=497 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 33 :VQFSQLVVLGAIDR 2dbbA 7 :LDRVDMQLVKILSE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRKF Number of specific fragments extracted= 2 number of extra gaps= 0 total=2114 Number of alignments=498 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set T0373 43 :AIDR 2dbbA 17 :ILSE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGIIRK T0373 83 :HADPQDGRRTRVSL 2dbbA 59 :IPDIDKLGYMYAIV T0373 98 :SEGRRNLYGN 2dbbA 80 :SDADKVISEI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2118 Number of alignments=499 # 2dbbA read from 2dbbA/merged-local-a2m # found chain 2dbbA in template set Warning: unaligning (T0373)P32 because first residue in template chain is (2dbbA)K6 T0373 33 :VQFSQLVVLGAIDR 2dbbA 7 :LDRVDMQLVKILSE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLI 2dbbA 21 :NSRLTYRELADILNTTRQRIARRIDKLKKLGII T0373 81 :VRHADPQDGRRTRVSL 2dbbA 57 :TIIPDIDKLGYMYAIV T0373 98 :SEGRRNLYGN 2dbbA 83 :DKVISEISDI T0373 108 :RAKREEWLVR 2dbbA 117 :IKDAENLISE T0373 119 :MHACLDE 2dbbA 127 :FLQRIKN Number of specific fragments extracted= 6 number of extra gaps= 0 total=2124 Number of alignments=500 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1c0wA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1c0wA expands to /projects/compbio/data/pdb/1c0w.pdb.gz 1c0wA:# T0373 read from 1c0wA/merged-local-a2m # 1c0wA read from 1c0wA/merged-local-a2m # adding 1c0wA to template set # found chain 1c0wA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1c0wA 12 :LRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 87 :QDGRRTRVSLSSEG 1c0wA 65 :TPTGRTLATAVMRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=2126 Number of alignments=501 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1c0wA 22 :GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 90 :RRTRVSLSSEGRR 1c0wA 58 :SDRSLQMTPTGRT Number of specific fragments extracted= 2 number of extra gaps= 0 total=2128 Number of alignments=502 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 42 :GAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1c0wA 16 :YELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 90 :RRTRVSLSSEGRRNL 1c0wA 58 :SDRSLQMTPTGRTLA Number of specific fragments extracted= 2 number of extra gaps= 0 total=2130 Number of alignments=503 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1c0wA 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1c0wA 60 :RSLQMTPTGRTLATAVMRKHRL T0373 115 :LVRAMHACLDES 1c0wA 82 :AERLLTDIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=2133 Number of alignments=504 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 37 :QLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1c0wA 11 :YLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1c0wA 60 :RSLQMTPTGRTLATAVMRKHRL T0373 115 :LVRAMHA 1c0wA 82 :AERLLTD Number of specific fragments extracted= 3 number of extra gaps= 0 total=2136 Number of alignments=505 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1c0wA 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1c0wA 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKRE 1c0wA 62 :LQMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHACLDESERALLAAAGP 1c0wA 81 :LAERLLTDIIGLDINKVHDEACR T0373 137 :LLTRLAQFEEP 1c0wA 112 :VERRLVKVLKD Number of specific fragments extracted= 5 number of extra gaps= 0 total=2141 Number of alignments=506 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1c0wA 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1c0wA 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKR 1c0wA 62 :LQMTPTGRTLATAVMRKH T0373 112 :EE 1c0wA 95 :NK T0373 115 :LVRAMHAC 1c0wA 97 :VHDEACRW T0373 123 :LDES 1c0wA 108 :MSDE T0373 137 :LLTRLAQFEEP 1c0wA 112 :VERRLVKVLKD Number of specific fragments extracted= 7 number of extra gaps= 0 total=2148 Number of alignments=507 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1c0wA 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1c0wA 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1c0wA 88 :DIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=2151 Number of alignments=508 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 34 :QFSQLVVLGAIDR 1c0wA 8 :TEMYLRTIYELEE T0373 48 :GG 1c0wA 21 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1c0wA 24 :TPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1c0wA 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1c0wA 88 :DIIGLD Number of specific fragments extracted= 5 number of extra gaps= 0 total=2156 Number of alignments=509 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 33 :VQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1c0wA 7 :TTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 86 :PQDGR 1c0wA 57 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1c0wA 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDESERALLAAAGP 1c0wA 88 :DIIGLDINKVHDEACR T0373 137 :LLTRLAQFEEP 1c0wA 112 :VERRLVKVLKD Number of specific fragments extracted= 5 number of extra gaps= 0 total=2161 Number of alignments=510 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 32 :PVQFSQLVVLGAIDRL 1c0wA 3 :DLVDTTEMYLRTIYEL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1c0wA 22 :GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 85 :DPQDG 1c0wA 57 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1c0wA 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLD 1c0wA 88 :DIIG T0373 125 :ESERALLAAAG 1c0wA 95 :NKVHDEACRWE T0373 136 :PLLTRLAQFEEP 1c0wA 111 :EVERRLVKVLKD Number of specific fragments extracted= 7 number of extra gaps= 0 total=2168 Number of alignments=511 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 39 :VVLGAIDRLGGD 1c0wA 10 :MYLRTIYELEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1c0wA 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1c0wA 60 :RSLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLDES 1c0wA 86 :LTDIIGLD Number of specific fragments extracted= 4 number of extra gaps= 0 total=2172 Number of alignments=512 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 36 :SQLVVLGAIDR 1c0wA 10 :MYLRTIYELEE T0373 50 :D 1c0wA 21 :E T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1c0wA 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1c0wA 61 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1c0wA 86 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=2177 Number of alignments=513 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1c0wA 6 :DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1c0wA 61 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLDESERALLAAAGPL 1c0wA 86 :LTDIIGLDINKVHDEACRW Number of specific fragments extracted= 3 number of extra gaps= 0 total=2180 Number of alignments=514 # 1c0wA read from 1c0wA/merged-local-a2m # found chain 1c0wA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1c0wA 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 89 :G 1c0wA 60 :R T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1c0wA 61 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1c0wA 86 :LTDIIG T0373 132 :AAAGPLLTRLA 1c0wA 95 :NKVHDEACRWE Number of specific fragments extracted= 5 number of extra gaps= 0 total=2185 Number of alignments=515 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2ethA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 2ethA/merged-local-a2m # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKE T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 2ethA 99 :IFGEILSNFESLLKSVLEKFSEEDFKVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2188 Number of alignments=516 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERALLAAA 2ethA 114 :VLEKFSEEDFKVVSEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2191 Number of alignments=517 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 2 :DALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGR 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGK T0373 103 :NLYGNRAKREEWLVRAMHACLDESERALL 2ethA 98 :EIFGEILSNFESLLKSVLEKFSEEDFKVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2194 Number of alignments=518 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 6 :DLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 3 :ALEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKR 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNF T0373 113 :EWLVRAMHACLDESERALLAAA 2ethA 108 :ESLLKSVLEKFSEEDFKVVSEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2197 Number of alignments=519 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERALL 2ethA 114 :VLEKFSEEDFKVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2200 Number of alignments=520 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERALLA 2ethA 114 :VLEKFSEEDFKVVS Number of specific fragments extracted= 3 number of extra gaps= 0 total=2203 Number of alignments=521 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFES T0373 115 :LVRAMHACLDESERALLAA 2ethA 110 :LLKSVLEKFSEEDFKVVSE T0373 137 :LLTRLAQFEE 2ethA 129 :GFNRMVEALS Number of specific fragments extracted= 4 number of extra gaps= 0 total=2207 Number of alignments=522 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFES T0373 115 :LVRAMHACLDESERALLAA 2ethA 110 :LLKSVLEKFSEEDFKVVSE T0373 137 :LLTRLAQF 2ethA 129 :GFNRMVEA Number of specific fragments extracted= 4 number of extra gaps= 0 total=2211 Number of alignments=523 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 26 :REAQA 2ethA 25 :EEISD T0373 33 :VQFSQLVVLGAIDRL 2ethA 30 :MKTTELYAFLYVALF T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2ethA 45 :GPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFES T0373 115 :LVRAMHACLDESERALLAA 2ethA 110 :LLKSVLEKFSEEDFKVVSE T0373 137 :LLTRLAQFEEP 2ethA 129 :GFNRMVEALSR Number of specific fragments extracted= 5 number of extra gaps= 0 total=2216 Number of alignments=524 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2ethA)H0 T0373 3 :TNQDLQL 2ethA 1 :MDALEIF T0373 18 :TTLTRRLRREAQADP 2ethA 8 :KTLFSLVMRFSSYLP T0373 33 :VQFSQLVVLGAIDRLGG 2ethA 30 :MKTTELYAFLYVALFGP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 2ethA 47 :KKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFES T0373 115 :LVRAMHACLDESERALLAA 2ethA 110 :LLKSVLEKFSEEDFKVVSE T0373 137 :LLTRLAQF 2ethA 129 :GFNRMVEA Number of specific fragments extracted= 6 number of extra gaps= 0 total=2222 Number of alignments=525 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALF T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2ethA 45 :GPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVL T0373 121 :ACLDESERALLAA 2ethA 116 :EKFSEEDFKVVSE T0373 137 :LLTRLAQFEE 2ethA 129 :GFNRMVEALS Number of specific fragments extracted= 4 number of extra gaps= 0 total=2226 Number of alignments=526 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVALF T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2ethA 45 :GPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVL T0373 121 :ACLDESERALLAA 2ethA 116 :EKFSEEDFKVVSE T0373 137 :LLTRLAQFE 2ethA 129 :GFNRMVEAL Number of specific fragments extracted= 4 number of extra gaps= 0 total=2230 Number of alignments=527 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2ethA)H0 T0373 3 :TNQDLQLAAHLRSQVT 2ethA 1 :MDALEIFKTLFSLVMR T0373 24 :LRREAQA 2ethA 17 :FSSYLPS T0373 33 :VQFSQLVVLGAIDRL 2ethA 30 :MKTTELYAFLYVALF T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2ethA 45 :GPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVL T0373 121 :ACLDESERALLAA 2ethA 116 :EKFSEEDFKVVSE T0373 137 :LLTRLAQFEEP 2ethA 129 :GFNRMVEALSR Number of specific fragments extracted= 6 number of extra gaps= 0 total=2236 Number of alignments=528 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (2ethA)H0 T0373 3 :TNQDLQL 2ethA 1 :MDALEIF T0373 18 :TTLTRRLRREAQADP 2ethA 8 :KTLFSLVMRFSSYLP T0373 33 :VQFSQLVVLGAIDRL 2ethA 30 :MKTTELYAFLYVALF T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 2ethA 45 :GPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKSVL T0373 121 :ACLDESERALLAA 2ethA 116 :EKFSEEDFKVVSE T0373 137 :LLTRLAQF 2ethA 129 :GFNRMVEA Number of specific fragments extracted= 6 number of extra gaps= 0 total=2242 Number of alignments=529 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2ethA 4 :LEIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 44 :FGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERALL 2ethA 114 :VLEKFSEEDFKVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2245 Number of alignments=530 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 2ethA 5 :EIFKTLFSLVMRFSSYLPSNEEISDMKTTELYAFLYVAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 44 :FGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERALLAAA 2ethA 114 :VLEKFSEEDFKVVSEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2248 Number of alignments=531 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set T0373 28 :AQADPVQFSQLVVLGAIDR 2ethA 25 :EEISDMKTTELYAFLYVAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 44 :FGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERAL 2ethA 114 :VLEKFSEEDFKV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2251 Number of alignments=532 # 2ethA read from 2ethA/merged-local-a2m # found chain 2ethA in template set Warning: unaligning (T0373)F144 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2ethA)E140 Warning: unaligning (T0373)E145 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2ethA)E140 T0373 19 :TLTRRLRREAQADP 2ethA 6 :IFKTLFSLVMRFSS T0373 33 :VQFSQLVVLGAIDR 2ethA 30 :MKTTELYAFLYVAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 2ethA 44 :FGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTYRVVLTEKGKEIFGEILSNFESLLKS T0373 119 :MHACLDESERALLAAAGPLLTRLAQ 2ethA 114 :VLEKFSEEDFKVVSEGFNRMVEALS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2255 Number of alignments=533 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lj9A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lj9A expands to /projects/compbio/data/pdb/1lj9.pdb.gz 1lj9A:# T0373 read from 1lj9A/merged-local-a2m # 1lj9A read from 1lj9A/merged-local-a2m # adding 1lj9A to template set # found chain 1lj9A in template set Warning: unaligning (T0373)L7 because first residue in template chain is (1lj9A)T2 T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 3 :DILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKN T0373 104 :LYGNRAKREEWLVRAMHACLDESERALL 1lj9A 97 :VYPIIVRENQHSNQVALQGLSEVEISQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2258 Number of alignments=534 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 12 :HLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 7 :EIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKN T0373 104 :LYGNRAKREEWLVRAMHACLDESERALLAA 1lj9A 97 :VYPIIVRENQHSNQVALQGLSEVEISQLAD Number of specific fragments extracted= 3 number of extra gaps= 0 total=2261 Number of alignments=535 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 3 :DILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEG 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKG T0373 102 :RNLYGNRAKREEWLVRAMHACLDESERALL 1lj9A 95 :KNVYPIIVRENQHSNQVALQGLSEVEISQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2264 Number of alignments=536 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 12 :HLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 7 :EIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEW 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHS T0373 116 :VRAMHACLDESERALLAAA 1lj9A 109 :NQVALQGLSEVEISQLADY Number of specific fragments extracted= 3 number of extra gaps= 0 total=2267 Number of alignments=537 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 3 :DILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQV T0373 119 :MHACLDESERALL 1lj9A 112 :ALQGLSEVEISQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2270 Number of alignments=538 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 13 :LRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 8 :IGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQV T0373 119 :MHACLDESERALLA 1lj9A 112 :ALQGLSEVEISQLA Number of specific fragments extracted= 3 number of extra gaps= 0 total=2273 Number of alignments=539 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 3 :DILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQH T0373 115 :LVRAMHACLDESERALLAA 1lj9A 108 :SNQVALQGLSEVEISQLAD T0373 137 :LLTRLAQFEEP 1lj9A 127 :YLVRMRKNVSE Number of specific fragments extracted= 4 number of extra gaps= 0 total=2277 Number of alignments=540 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 4 :ILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQH T0373 115 :LVRAMHACLDESERALLAA 1lj9A 108 :SNQVALQGLSEVEISQLAD T0373 137 :LLTRLAQF 1lj9A 127 :YLVRMRKN Number of specific fragments extracted= 4 number of extra gaps= 0 total=2281 Number of alignments=541 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 4 :NQDLQL 1lj9A 3 :DILREI T0373 14 :RSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 9 :GMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQH T0373 115 :LVRAMHACLDESERALLAA 1lj9A 108 :SNQVALQGLSEVEISQLAD T0373 137 :LLTRLAQFEE 1lj9A 127 :YLVRMRKNVS Number of specific fragments extracted= 5 number of extra gaps= 0 total=2286 Number of alignments=542 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1lj9A)T2 T0373 4 :NQDLQL 1lj9A 3 :DILREI T0373 14 :RSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 9 :GMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQH T0373 115 :LVRAMHACLDESERALLAA 1lj9A 108 :SNQVALQGLSEVEISQLAD T0373 137 :LLTRLAQF 1lj9A 127 :YLVRMRKN Number of specific fragments extracted= 5 number of extra gaps= 0 total=2291 Number of alignments=543 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 3 :DILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVAL T0373 121 :ACLDESERALLAA 1lj9A 114 :QGLSEVEISQLAD T0373 137 :LLTRLAQFEEP 1lj9A 127 :YLVRMRKNVSE Number of specific fragments extracted= 4 number of extra gaps= 0 total=2295 Number of alignments=544 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 3 :DILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVAL T0373 121 :ACLDESERALLAA 1lj9A 114 :QGLSEVEISQLAD T0373 137 :LLTRLAQFE 1lj9A 127 :YLVRMRKNV Number of specific fragments extracted= 4 number of extra gaps= 0 total=2299 Number of alignments=545 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 4 :ILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVAL T0373 121 :ACLDESERALLAA 1lj9A 114 :QGLSEVEISQLAD T0373 137 :LLTRLAQFEE 1lj9A 127 :YLVRMRKNVS Number of specific fragments extracted= 4 number of extra gaps= 0 total=2303 Number of alignments=546 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 5 :Q 1lj9A 4 :I T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1lj9A 5 :LREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCENPG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1lj9A 45 :IIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQVAL T0373 121 :ACLDESERALLAA 1lj9A 114 :QGLSEVEISQLAD T0373 137 :LLTRLAQF 1lj9A 127 :YLVRMRKN Number of specific fragments extracted= 5 number of extra gaps= 0 total=2308 Number of alignments=547 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1lj9A 4 :ILREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lj9A 42 :NPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQV T0373 119 :MHACLDESERALL 1lj9A 112 :ALQGLSEVEISQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2311 Number of alignments=548 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1lj9A 5 :LREIGMIARALDSISNIEFKELSLTRGQYLYLVRVCE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lj9A 42 :NPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQV T0373 119 :MHACLDESERALLAAA 1lj9A 112 :ALQGLSEVEISQLADY Number of specific fragments extracted= 3 number of extra gaps= 0 total=2314 Number of alignments=549 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 15 :SQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1lj9A 10 :MIARALDSISNIEFKELSLTRGQYLYLVRVCE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lj9A 42 :NPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQV T0373 119 :MHACLDESERALLAAAGPLLTRLAQF 1lj9A 112 :ALQGLSEVEISQLADYLVRMRKNVSE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2317 Number of alignments=550 # 1lj9A read from 1lj9A/merged-local-a2m # found chain 1lj9A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1lj9A 6 :REIGMIARALDSISNIEFKELSLTRGQYLYLVRVCE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1lj9A 42 :NPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNKKIKRIYATEKGKNVYPIIVRENQHSNQV T0373 119 :MHACLDESERALLAAAGPLLTRL 1lj9A 112 :ALQGLSEVEISQLADYLVRMRKN Number of specific fragments extracted= 3 number of extra gaps= 0 total=2320 Number of alignments=551 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ulyA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ulyA expands to /projects/compbio/data/pdb/1uly.pdb.gz 1ulyA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 1ulyA/merged-local-a2m # 1ulyA read from 1ulyA/merged-local-a2m # adding 1ulyA to template set # found chain 1ulyA in template set T0373 37 :QLVVLGAI 1ulyA 22 :RRKILKLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRT 1ulyA 30 :RNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLV T0373 93 :RVSLSSEGR 1ulyA 78 :YYGRTADVF T0373 113 :EWLVRAMHACLDESERALLAAAGPLLTRLAQFEEP 1ulyA 87 :YINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEE Number of specific fragments extracted= 4 number of extra gaps= 0 total=2324 Number of alignments=552 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 37 :QLVVLGAI 1ulyA 22 :RRKILKLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRT 1ulyA 30 :RNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLV T0373 93 :RVSLSSEGR 1ulyA 78 :YYGRTADVF T0373 113 :EWLVRAMHACLDESERALLA 1ulyA 91 :YLGDEELRYIARSRLKTKID Number of specific fragments extracted= 4 number of extra gaps= 0 total=2328 Number of alignments=553 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 37 :QLVVLGAI 1ulyA 22 :RRKILKLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRT 1ulyA 30 :RNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLV T0373 93 :RVSLSSEGRRNLYGNRA 1ulyA 78 :YYGRTADVFYINLYLGD T0373 110 :KREEWLVRAMHACLDESER 1ulyA 96 :ELRYIARSRLKTKIDIFKR Number of specific fragments extracted= 4 number of extra gaps= 0 total=2332 Number of alignments=554 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 36 :SQLVVLGAI 1ulyA 21 :TRRKILKLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRT 1ulyA 30 :RNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLV T0373 93 :RVSLSSEGRRNLYGNRA 1ulyA 78 :YYGRTADVFYINLYLGD T0373 110 :KREEWLVRAMHACLDESER 1ulyA 96 :ELRYIARSRLKTKIDIFKR Number of specific fragments extracted= 4 number of extra gaps= 0 total=2336 Number of alignments=555 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1ulyA 31 :NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEM T0373 88 :DGR 1ulyA 72 :GNL T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1ulyA 76 :EKYYGRTADVFYINLYLGDEELRYIARSRLKTKID Number of specific fragments extracted= 3 number of extra gaps= 0 total=2339 Number of alignments=556 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1ulyA 30 :RNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEM T0373 88 :DGR 1ulyA 72 :GNL T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLVR 1ulyA 76 :EKYYGRTADVFYINLYLGDEELRYIAR Number of specific fragments extracted= 3 number of extra gaps= 0 total=2342 Number of alignments=557 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 41 :LGAIDRLGG 1ulyA 25 :ILKLLRNKE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ulyA 34 :MTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2344 Number of alignments=558 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 39 :VVLGAIDR 1ulyA 24 :KILKLLRN T0373 48 :GG 1ulyA 32 :KE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1ulyA 34 :MTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRT Number of specific fragments extracted= 3 number of extra gaps= 0 total=2347 Number of alignments=559 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 41 :LGAIDRLGG 1ulyA 25 :ILKLLRNKE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ulyA 34 :MTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE T0373 87 :QDGRRTRVSLS 1ulyA 72 :GNLVEKYYGRT T0373 98 :SEGRRNLYGNRAKREE 1ulyA 95 :EELRYIARSRLKTKID T0373 115 :LVRAMHACLDESERALLAAAGP 1ulyA 111 :IFKRLGYQFEENELLNIMDRMS T0373 140 :R 1ulyA 133 :Q Number of specific fragments extracted= 6 number of extra gaps= 0 total=2353 Number of alignments=560 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 35 :FSQLVVLGAIDR 1ulyA 20 :DTRRKILKLLRN T0373 48 :GG 1ulyA 32 :KE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ulyA 34 :MTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE T0373 87 :QDGRRTRVSLS 1ulyA 72 :GNLVEKYYGRT T0373 98 :SEGRRNLYGNRAKREE 1ulyA 95 :EELRYIARSRLKTKID T0373 115 :LVRA 1ulyA 111 :IFKR T0373 125 :ESERALLAA 1ulyA 122 :NELLNIMDR T0373 137 :LLTRLAQ 1ulyA 131 :MSQKEFD Number of specific fragments extracted= 8 number of extra gaps= 0 total=2361 Number of alignments=561 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 33 :VQFSQLVVLGAID 1ulyA 18 :LEDTRRKILKLLR T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1ulyA 31 :NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKR Number of specific fragments extracted= 2 number of extra gaps= 0 total=2363 Number of alignments=562 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 33 :VQFSQLVVLGAIDR 1ulyA 18 :LEDTRRKILKLLRN T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1ulyA 32 :KEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKR T0373 97 :SSEGRRNLYGNRAKREEWLVRAM 1ulyA 68 :TEMKGNLVEKYYGRTADVFYINL T0373 122 :CLDESERALL 1ulyA 91 :YLGDEELRYI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2367 Number of alignments=563 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 35 :FSQLVVLGAID 1ulyA 20 :DTRRKILKLLR T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ulyA 31 :NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE T0373 87 :QDGRRTRVSLS 1ulyA 72 :GNLVEKYYGRT T0373 98 :SEGRRNLYGNRAKREEWLVRAM 1ulyA 95 :EELRYIARSRLKTKIDIFKRLG T0373 121 :ACLDESERALLAAAGPL 1ulyA 117 :YQFEENELLNIMDRMSQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=2372 Number of alignments=564 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 6 :DLQLAAHLR 1ulyA 10 :DPEVIKVML T0373 34 :QFSQLVVLGAID 1ulyA 19 :EDTRRKILKLLR T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ulyA 31 :NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE T0373 87 :QDGRRTRVSLS 1ulyA 72 :GNLVEKYYGRT T0373 98 :SEGRRNLYGNRAKREEWLVRAM 1ulyA 95 :EELRYIARSRLKTKIDIFKRLG T0373 121 :ACLD 1ulyA 117 :YQFE T0373 125 :ESERALLAAAG 1ulyA 122 :NELLNIMDRMS T0373 136 :PLLTRLAQ 1ulyA 141 :RISKYIEE Number of specific fragments extracted= 8 number of extra gaps= 0 total=2380 Number of alignments=565 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 41 :LGAIDR 1ulyA 25 :ILKLLR T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1ulyA 31 :NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKR Number of specific fragments extracted= 2 number of extra gaps= 0 total=2382 Number of alignments=566 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 40 :VLGAI 1ulyA 25 :ILKLL T0373 46 :R 1ulyA 30 :R T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1ulyA 31 :NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKR Number of specific fragments extracted= 3 number of extra gaps= 0 total=2385 Number of alignments=567 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 41 :LGAIDR 1ulyA 25 :ILKLLR T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRT 1ulyA 31 :NKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLV T0373 93 :RVSLS 1ulyA 78 :YYGRT T0373 98 :SEGRRNLYGNRAKREEWLVR 1ulyA 95 :EELRYIARSRLKTKIDIFKR T0373 119 :MHACLDESERALLAAAGPL 1ulyA 115 :LGYQFEENELLNIMDRMSQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=2390 Number of alignments=568 # 1ulyA read from 1ulyA/merged-local-a2m # found chain 1ulyA in template set T0373 35 :FSQLVVLGAIDR 1ulyA 20 :DTRRKILKLLRN T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1ulyA 32 :KEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE T0373 87 :QDGRRTRVSLS 1ulyA 72 :GNLVEKYYGRT T0373 98 :SEGRRNLYGNRAKREEWLVR 1ulyA 95 :EELRYIARSRLKTKIDIFKR T0373 121 :ACLD 1ulyA 115 :LGYQ T0373 125 :ESERALLAAAGPLLTR 1ulyA 122 :NELLNIMDRMSQKEFD Number of specific fragments extracted= 6 number of extra gaps= 0 total=2396 Number of alignments=569 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ub9A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ub9A expands to /projects/compbio/data/pdb/1ub9.pdb.gz 1ub9A:# T0373 read from 1ub9A/merged-local-a2m # 1ub9A read from 1ub9A/merged-local-a2m # adding 1ub9A to template set # found chain 1ub9A in template set T0373 37 :QLVVLGAIDRLGG 1ub9A 18 :RLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2398 Number of alignments=570 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 36 :SQLVVLGAIDRLGG 1ub9A 17 :VRLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2400 Number of alignments=571 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1ub9A 29 :RKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVI Number of specific fragments extracted= 1 number of extra gaps= 0 total=2401 Number of alignments=572 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 40 :VLGAIDR 1ub9A 21 :IMIFLLP T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1ub9A 28 :RRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=2403 Number of alignments=573 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 37 :QLVVLGAIDRLG 1ub9A 18 :RLGIMIFLLPRR T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRR 1ub9A 30 :KAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGME Number of specific fragments extracted= 2 number of extra gaps= 0 total=2405 Number of alignments=574 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 37 :QLVVLGAIDRLG 1ub9A 18 :RLGIMIFLLPRR T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLY 1ub9A 30 :KAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAK Number of specific fragments extracted= 2 number of extra gaps= 0 total=2407 Number of alignments=575 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDRLGG 1ub9A 15 :NPVRLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKA T0373 115 :LVRAM 1ub9A 94 :VIDGL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2410 Number of alignments=576 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDRLGG 1ub9A 15 :NPVRLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKA T0373 115 :LVR 1ub9A 94 :VID Number of specific fragments extracted= 3 number of extra gaps= 0 total=2413 Number of alignments=577 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDRLGG 1ub9A 15 :NPVRLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKA T0373 115 :LVRA 1ub9A 94 :VIDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2416 Number of alignments=578 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDRLGG 1ub9A 15 :NPVRLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKA T0373 115 :LVRAM 1ub9A 94 :VIDGL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2419 Number of alignments=579 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDRLGG 1ub9A 15 :NPVRLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRA 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2421 Number of alignments=580 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDRLGG 1ub9A 15 :NPVRLGIMIFLLPRRK T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1ub9A 31 :APFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDG Number of specific fragments extracted= 2 number of extra gaps= 0 total=2423 Number of alignments=581 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 26 :REAQAD 1ub9A 6 :EIMKSH T0373 34 :QFSQLVVLGAIDRL 1ub9A 15 :NPVRLGIMIFLLPR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRA 1ub9A 29 :RKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2426 Number of alignments=582 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDRL 1ub9A 15 :NPVRLGIMIFLLPR T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRA 1ub9A 29 :RKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDGL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2428 Number of alignments=583 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDR 1ub9A 15 :NPVRLGIMIFLLP T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1ub9A 28 :RRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDG T0373 119 :M 1ub9A 98 :L Number of specific fragments extracted= 3 number of extra gaps= 0 total=2431 Number of alignments=584 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDR 1ub9A 15 :NPVRLGIMIFLLP T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1ub9A 28 :RRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDG Number of specific fragments extracted= 2 number of extra gaps= 0 total=2433 Number of alignments=585 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDR 1ub9A 15 :NPVRLGIMIFLLP T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1ub9A 28 :RRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDG Number of specific fragments extracted= 2 number of extra gaps= 0 total=2435 Number of alignments=586 # 1ub9A read from 1ub9A/merged-local-a2m # found chain 1ub9A in template set T0373 34 :QFSQLVVLGAIDR 1ub9A 15 :NPVRLGIMIFLLP T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1ub9A 28 :RRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVIADRPRTVVEITDFGMEEAKRFLSSLKAVIDG T0373 119 :M 1ub9A 98 :L Number of specific fragments extracted= 3 number of extra gaps= 0 total=2438 Number of alignments=587 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sd4A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sd4A expands to /projects/compbio/data/pdb/1sd4.pdb.gz 1sd4A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 1sd4A/merged-local-a2m # 1sd4A read from 1sd4A/merged-local-a2m # adding 1sd4A to template set # found chain 1sd4A in template set T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1sd4A 58 :IKRYKSENIYFYSSNIKEDDIKMKTAKTFLNK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2439 Number of alignments=588 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set T0373 37 :QLVVLGAIDRLG 1sd4A 12 :EWDVMNIIWDKK T0373 50 :DVTPSELAAA 1sd4A 24 :SVSANEIVVE T0373 60 :ERMRSSNLAALLRELERGGLIVRHAD 1sd4A 38 :KEVSDKTIRTLITRLYKKEIIKRYKS T0373 100 :GRRNLYGNRAKREEWLVRAMHACLDE 1sd4A 64 :ENIYFYSSNIKEDDIKMKTAKTFLNK Number of specific fragments extracted= 4 number of extra gaps= 0 total=2443 Number of alignments=589 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1sd4A 58 :IKRYKSENIYFYSSNIKEDDIKMKTAKTFLNK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2444 Number of alignments=590 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1sd4A 57 :IIKRYKSENIYFYSSNIKEDDIKMKTAKTFLNK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2445 Number of alignments=591 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1sd4A 58 :IKRYKSENIYFYSSNIKEDDIKMKTAKTFLNK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2446 Number of alignments=592 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set T0373 37 :QLVVLGAIDRLG 1sd4A 12 :EWDVMNIIWDKK T0373 50 :DVTPSELAAAER 1sd4A 24 :SVSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKS T0373 100 :GRRNLYGNRAKREEWLVRAMHACLDE 1sd4A 64 :ENIYFYSSNIKEDDIKMKTAKTFLNK Number of specific fragments extracted= 4 number of extra gaps= 0 total=2450 Number of alignments=593 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDRLGG 1sd4A 6 :VEISMAEWDVMNIIWDKKS T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sd4A 28 :NEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=2452 Number of alignments=594 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDRLGG 1sd4A 6 :VEISMAEWDVMNIIWDKKS T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sd4A 28 :NEIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=2454 Number of alignments=595 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDRLGG 1sd4A 6 :VEISMAEWDVMNIIWDKKS T0373 51 :VTPSELAAAER 1sd4A 25 :VSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKSEN T0373 92 :TRVSLS 1sd4A 66 :IYFYSS T0373 98 :SEGRRNLYGNRAKREE 1sd4A 81 :KTAKTFLNKLYGGDMK T0373 114 :WLVRAMHA 1sd4A 98 :LVLNFAKN T0373 123 :LDESERALLAA 1sd4A 108 :LNNKEIEELRD T0373 137 :LLTRL 1sd4A 119 :ILNDI Number of specific fragments extracted= 8 number of extra gaps= 0 total=2462 Number of alignments=596 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDRLGG 1sd4A 6 :VEISMAEWDVMNIIWDKKS T0373 51 :VTPSELAAAER 1sd4A 25 :VSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKSEN T0373 91 :RTRVSLS 1sd4A 66 :IYFYSSN T0373 98 :SEGRRNLYGNRAK 1sd4A 76 :DDIKMKTAKTFLN T0373 113 :E 1sd4A 89 :K T0373 114 :WLVRAMHAC 1sd4A 97 :SLVLNFAKN T0373 123 :LDESERALLAA 1sd4A 108 :LNNKEIEELRD T0373 137 :LLTR 1sd4A 119 :ILND Number of specific fragments extracted= 9 number of extra gaps= 0 total=2471 Number of alignments=597 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDR 1sd4A 6 :VEISMAEWDVMNIIWD T0373 48 :GGDVTPSELAAAER 1sd4A 22 :KKSVSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKSEN Number of specific fragments extracted= 3 number of extra gaps= 0 total=2474 Number of alignments=598 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDR 1sd4A 6 :VEISMAEWDVMNIIWD T0373 48 :GGDVTPSELAAAER 1sd4A 22 :KKSVSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKSEN T0373 91 :RTRV 1sd4A 66 :IYFY Number of specific fragments extracted= 4 number of extra gaps= 0 total=2478 Number of alignments=599 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDRL 1sd4A 6 :VEISMAEWDVMNIIWDK T0373 49 :GDVTPSELAAAER 1sd4A 23 :KSVSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKSEN T0373 91 :RTRVSLS 1sd4A 66 :IYFYSSN T0373 98 :SEGRRNLYGNR 1sd4A 81 :KTAKTFLNKLY T0373 109 :AKREEWLVRAMHACLDESERALLAA 1sd4A 94 :DMKSLVLNFAKNEELNNKEIEELRD T0373 141 :LAQFEEP 1sd4A 119 :ILNDISK Number of specific fragments extracted= 7 number of extra gaps= 0 total=2485 Number of alignments=600 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDRL 1sd4A 6 :VEISMAEWDVMNIIWDK T0373 49 :GDVTPSELAAAE 1sd4A 23 :KSVSANEIVVEI T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1sd4A 39 :EVSDKTIRTLITRLYKKEIIKRYKSEN T0373 91 :RTRVSLS 1sd4A 66 :IYFYSSN T0373 98 :SEGRRNLYGNR 1sd4A 76 :DDIKMKTAKTF T0373 109 :AKR 1sd4A 96 :KSL T0373 114 :WLVRAMHACLDESERALLAA 1sd4A 99 :VLNFAKNEELNNKEIEELRD T0373 137 :LLTR 1sd4A 119 :ILND Number of specific fragments extracted= 8 number of extra gaps= 0 total=2493 Number of alignments=601 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDR 1sd4A 6 :VEISMAEWDVMNIIWD T0373 48 :GGD 1sd4A 22 :KKS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sd4A 29 :EIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSEN Number of specific fragments extracted= 3 number of extra gaps= 0 total=2496 Number of alignments=602 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDR 1sd4A 6 :VEISMAEWDVMNIIWD T0373 48 :GGD 1sd4A 22 :KKS T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sd4A 29 :EIVVEIQKYKEVSDKTIRTLITRLYKKEIIKRYKSEN Number of specific fragments extracted= 3 number of extra gaps= 0 total=2499 Number of alignments=603 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1sd4A)Q5 T0373 31 :DPVQFSQLVVLGAIDR 1sd4A 6 :VEISMAEWDVMNIIWD T0373 48 :GGDVTPSELAAAER 1sd4A 22 :KKSVSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKSEN T0373 93 :RVS 1sd4A 68 :FYS T0373 97 :S 1sd4A 71 :S T0373 98 :SEGRRNLYGNR 1sd4A 81 :KTAKTFLNKLY Number of specific fragments extracted= 6 number of extra gaps= 0 total=2505 Number of alignments=604 # 1sd4A read from 1sd4A/merged-local-a2m # found chain 1sd4A in template set T0373 31 :DPVQFSQLVVLGAIDR 1sd4A 6 :VEISMAEWDVMNIIWD T0373 48 :GGDVTPSELAAAER 1sd4A 22 :KKSVSANEIVVEIQ T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1sd4A 40 :VSDKTIRTLITRLYKKEIIKRYKSEN T0373 91 :RTRVSLS 1sd4A 66 :IYFYSSN T0373 98 :SEGRRNLYGNR 1sd4A 76 :DDIKMKTAKTF T0373 109 :AKREEWLVR 1sd4A 96 :KSLVLNFAK T0373 120 :HACLDESERALLAAAGPL 1sd4A 105 :NEELNNKEIEELRDILND Number of specific fragments extracted= 7 number of extra gaps= 0 total=2512 Number of alignments=605 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2g7uA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2g7uA expands to /projects/compbio/data/pdb/2g7u.pdb.gz 2g7uA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 2g7uA/merged-local-a2m # 2g7uA read from 2g7uA/merged-local-a2m # adding 2g7uA to template set # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAG T0373 85 :DP 2g7uA 61 :SG T0373 89 :GR 2g7uA 63 :GR Number of specific fragments extracted= 3 number of extra gaps= 0 total=2515 Number of alignments=606 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 37 :QLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2g7uA 15 :GFAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAG T0373 85 :DP 2g7uA 61 :SG T0373 90 :RRTRVSLSS 2g7uA 63 :GRWSLTPRV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2518 Number of alignments=607 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAG T0373 85 :DP 2g7uA 61 :SG T0373 89 :GR 2g7uA 63 :GR Number of specific fragments extracted= 3 number of extra gaps= 0 total=2521 Number of alignments=608 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAG T0373 85 :DP 2g7uA 61 :SG T0373 90 :RRTRVS 2g7uA 63 :GRWSLT Number of specific fragments extracted= 3 number of extra gaps= 0 total=2524 Number of alignments=609 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAG Number of specific fragments extracted= 1 number of extra gaps= 0 total=2525 Number of alignments=610 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAGSG Number of specific fragments extracted= 1 number of extra gaps= 0 total=2526 Number of alignments=611 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLI 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYV Number of specific fragments extracted= 1 number of extra gaps= 0 total=2527 Number of alignments=612 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAGSGG T0373 93 :RVSLSSEGRRNLYGNRAKR 2g7uA 64 :RWSLTPRVLSIGQHYSESH Number of specific fragments extracted= 2 number of extra gaps= 0 total=2529 Number of alignments=613 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 47 :LGG 2g7uA 26 :RPN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2g7uA 29 :PTLAELATEAGLSRPAVRRILLTLQKLGYVAGSGG T0373 93 :RVSLSSEGRRNLYGNRAKRE 2g7uA 64 :RWSLTPRVLSIGQHYSESHA T0373 115 :LVRAMHA 2g7uA 84 :LIEAAMP T0373 130 :LLAA 2g7uA 91 :RLLE T0373 137 :L 2g7uA 95 :V Number of specific fragments extracted= 6 number of extra gaps= 0 total=2535 Number of alignments=614 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 2 :PTNQDLQLAAHLRS 2g7uA 7 :DYIQSIERGFAVLL T0373 47 :LGGD 2g7uA 22 :FDAQ T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 2g7uA 29 :PTLAELATEAGLSRPAVRRILLTLQKLGYVAGS T0373 86 :PQ 2g7uA 62 :GG T0373 93 :RVSLSSEGRRN 2g7uA 64 :RWSLTPRVLSI T0373 105 :YGNRAKREE 2g7uA 75 :GQHYSESHA T0373 115 :LVRAMHA 2g7uA 84 :LIEAAMP T0373 137 :LLTRLAQF 2g7uA 91 :RLLEVAEK Number of specific fragments extracted= 8 number of extra gaps= 0 total=2543 Number of alignments=615 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAGSGG T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 2g7uA 64 :RWSLTPRVLSIGQHYSESHALIEAAMP T0373 121 :ACLDESERALLAAAGPLLTR 2g7uA 91 :RLLEVAEKTQESASLGVLDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=2546 Number of alignments=616 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAGS T0373 88 :DG 2g7uA 62 :GG T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 2g7uA 64 :RWSLTPRVLSIGQHYSESHALIEAAMP T0373 121 :ACLDESERALLAAAGPLLT 2g7uA 91 :RLLEVAEKTQESASLGVLD Number of specific fragments extracted= 4 number of extra gaps= 0 total=2550 Number of alignments=617 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 3 :TNQDLQLAAHLRSQV 2g7uA 6 :RDYIQSIERGFAVLL T0373 27 :EAQADP 2g7uA 21 :AFDAQR T0373 48 :GG 2g7uA 27 :PN T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVR 2g7uA 29 :PTLAELATEAGLSRPAVRRILLTLQKLGYVAG T0373 85 :DPQ 2g7uA 61 :SGG T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVRAM 2g7uA 64 :RWSLTPRVLSIGQHYSESHALIEAAMP T0373 137 :LLTRLAQ 2g7uA 91 :RLLEVAE Number of specific fragments extracted= 7 number of extra gaps= 0 total=2557 Number of alignments=618 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 1 :MPTNQDLQLAAHLRS 2g7uA 6 :RDYIQSIERGFAVLL T0373 29 :Q 2g7uA 23 :D T0373 48 :GG 2g7uA 24 :AQ T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRH 2g7uA 28 :NPTLAELATEAGLSRPAVRRILLTLQKLGYVAGS T0373 86 :PQ 2g7uA 62 :GG T0373 93 :RVSLSSEGRRN 2g7uA 64 :RWSLTPRVLSI T0373 105 :YGNRAKREEWLVRAM 2g7uA 75 :GQHYSESHALIEAAM T0373 136 :PLLTRLAQF 2g7uA 90 :PRLLEVAEK Number of specific fragments extracted= 8 number of extra gaps= 0 total=2565 Number of alignments=619 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLI 2g7uA 16 :FAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYV Number of specific fragments extracted= 1 number of extra gaps= 0 total=2566 Number of alignments=620 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 37 :QLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2g7uA 15 :GFAVLLAFDAQRPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAGSGG T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 2g7uA 64 :RWSLTPRVLSIGQHYSESHALIEAA T0373 119 :MHACLD 2g7uA 89 :MPRLLE Number of specific fragments extracted= 3 number of extra gaps= 0 total=2569 Number of alignments=621 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2g7uA 26 :RPNPTLAELATEAGLSRPAVRRILLTLQKLGYVAGSGG T0373 93 :RVSLSS 2g7uA 64 :RWSLTP T0373 99 :EGRRNLYGNRAKREEWLVR 2g7uA 80 :ESHALIEAAMPRLLEVAEK Number of specific fragments extracted= 3 number of extra gaps= 0 total=2572 Number of alignments=622 # 2g7uA read from 2g7uA/merged-local-a2m # found chain 2g7uA in template set T0373 1 :MPTNQDLQLAAHLRSQ 2g7uA 6 :RDYIQSIERGFAVLLA T0373 47 :LGGD 2g7uA 22 :FDAQ T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2g7uA 29 :PTLAELATEAGLSRPAVRRILLTLQKLGYVAGSGG T0373 93 :RVSLSSEGRRNL 2g7uA 64 :RWSLTPRVLSIG T0373 121 :ACLD 2g7uA 76 :QHYS T0373 125 :ESERALLAAAGPLLTRLAQ 2g7uA 82 :HALIEAAMPRLLEVAEKTQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=2578 Number of alignments=623 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zybA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zybA expands to /projects/compbio/data/pdb/1zyb.pdb.gz 1zybA:Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 13, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 15, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 17, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 80, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 82, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 84, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 86, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 88, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 90, because occupancy 0.500 <= existing 0.500 in 1zybA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 223, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 225, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 227, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 229, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 231, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 427, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 429, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 431, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 433, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 435, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 528, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 530, because occupancy 0.500 <= existing 0.500 in 1zybA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 938, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 940, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 942, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 972, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 974, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1034, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1036, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1080, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1082, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1084, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1086, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1088, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1090, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1092, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1094, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1138, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1140, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1142, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1144, because occupancy 0.500 <= existing 0.500 in 1zybA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1240, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1242, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1244, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1246, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1278, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1280, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1282, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1284, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1286, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1288, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1290, because occupancy 0.500 <= existing 0.500 in 1zybA Skipped atom 1382, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1384, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1503, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1505, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1507, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1509, because occupancy 0.300 <= existing 0.700 in 1zybA Skipped atom 1511, because occupancy 0.300 <= existing 0.700 in 1zybA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 1zybA/merged-local-a2m # 1zybA read from 1zybA/merged-local-a2m # adding 1zybA to template set # found chain 1zybA in template set T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLI 1zybA 174 :KVKMDDLARCLDDTRLNISKTLNELQDNGLI Number of specific fragments extracted= 1 number of extra gaps= 0 total=2579 Number of alignments=624 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 34 :QFSQLVVLGAI 1zybA 143 :RLWDEPTLDLK T0373 45 :DRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 169 :GEKTFKVKMDDLARCLDDTRLNISKTLNELQDNGLIELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=2581 Number of alignments=625 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 174 :KVKMDDLARCLDDTRLNISKTLNELQDNGLIELH Number of specific fragments extracted= 1 number of extra gaps= 0 total=2582 Number of alignments=626 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 36 :SQLVVLGAI 1zybA 145 :WDEPTLDLK T0373 45 :DRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 169 :GEKTFKVKMDDLARCLDDTRLNISKTLNELQDNGLIELH Number of specific fragments extracted= 2 number of extra gaps= 0 total=2584 Number of alignments=627 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 174 :KVKMDDLARCLDDTRLNISKTLNELQDNGLIELH Number of specific fragments extracted= 1 number of extra gaps= 0 total=2585 Number of alignments=628 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 171 :KTFKVKMDDLARCLDDTRLNISKTLNELQDNGLIELH Number of specific fragments extracted= 1 number of extra gaps= 0 total=2586 Number of alignments=629 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 1 :MPTNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1zybA 118 :DLFRYDIFRLNYMNIVSNRAQNLYSRLWDEPTLDLKSKIIRFFLSHCEKP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHRKE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2588 Number of alignments=630 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 10 :AAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1zybA 127 :LNYMNIVSNRAQNLYSRLWDEPTLDLKSKIIRFFLSHCEKP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=2590 Number of alignments=631 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 6 :DLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1zybA 123 :DIFRLNYMNIVSNRAQNLYSRLWDEPTLDLKSKIIRFFLSHCEKP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELH T0373 89 :GRRTR 1zybA 208 :RKEIL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2593 Number of alignments=632 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 12 :HLRSQVTTLTRRLRREAQAD 1zybA 124 :IFRLNYMNIVSNRAQNLYSR T0373 32 :PVQFSQLVVLGAIDRL 1zybA 148 :PTLDLKSKIIRFFLSH T0373 48 :GGD 1zybA 168 :QGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELH T0373 89 :GRRTRV 1zybA 208 :RKEILI Number of specific fragments extracted= 5 number of extra gaps= 0 total=2598 Number of alignments=633 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHRKE Number of specific fragments extracted= 1 number of extra gaps= 0 total=2599 Number of alignments=634 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 13 :LRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1zybA 130 :MNIVSNRAQNLYSRLWDEPTLDLKSKIIRFFLSHCEKP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHR Number of specific fragments extracted= 2 number of extra gaps= 0 total=2601 Number of alignments=635 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLV 1zybA 122 :YDIFRLNYMNIVSNRAQNLYSRLWDEPTLDLKSKI T0373 41 :LGAIDRL 1zybA 157 :IRFFLSH T0373 48 :GG 1zybA 167 :PQ T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELH T0373 89 :GRRTRV 1zybA 208 :RKEILI Number of specific fragments extracted= 5 number of extra gaps= 0 total=2606 Number of alignments=636 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1zybA 123 :DIFRLNYMNIVSNRAQNLYSRLWDEPTLDLKSKIIRFFLSH T0373 48 :GGD 1zybA 168 :QGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELH T0373 89 :GRRTRV 1zybA 208 :RKEILI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2610 Number of alignments=637 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHRKE Number of specific fragments extracted= 1 number of extra gaps= 0 total=2611 Number of alignments=638 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 16 :QVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1zybA 133 :VSNRAQNLYSRLWDEPTLDLKSKIIRFFLSHCEKP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHR Number of specific fragments extracted= 2 number of extra gaps= 0 total=2613 Number of alignments=639 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 6 :DLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1zybA 123 :DIFRLNYMNIVSNRAQNLYSRLWDEPTLDLKSKIIRFFLSHCEKP T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHR Number of specific fragments extracted= 2 number of extra gaps= 0 total=2615 Number of alignments=640 # 1zybA read from 1zybA/merged-local-a2m # found chain 1zybA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1zybA 123 :DIFRLNYMNIVSNRAQNLYSRLWDEPTLDLKSKIIRFFLS T0373 48 :GGD 1zybA 168 :QGE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1zybA 175 :VKMDDLARCLDDTRLNISKTLNELQDNGLIELHR T0373 90 :RRTRV 1zybA 209 :KEILI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2619 Number of alignments=641 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jgsA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1jgsA expands to /projects/compbio/data/pdb/1jgs.pdb.gz 1jgsA:# T0373 read from 1jgsA/merged-local-a2m # 1jgsA read from 1jgsA/merged-local-a2m # adding 1jgsA to template set # found chain 1jgsA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1jgsA)L7 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 8 :FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALL 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2621 Number of alignments=642 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 9 :NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY Number of specific fragments extracted= 2 number of extra gaps= 0 total=2623 Number of alignments=643 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1jgsA)L7 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 8 :FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALL 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2625 Number of alignments=644 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 9 :NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY Number of specific fragments extracted= 2 number of extra gaps= 0 total=2627 Number of alignments=645 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1jgsA)L7 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLG 1jgsA 8 :FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAA T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALL 1jgsA 54 :CITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2629 Number of alignments=646 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLG 1jgsA 10 :EIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAA T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLA 1jgsA 54 :CITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2631 Number of alignments=647 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1jgsA)L7 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 8 :FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY T0373 137 :LLTRLA 1jgsA 138 :LLKKVL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2634 Number of alignments=648 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 9 :NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY T0373 137 :LLTRLA 1jgsA 138 :LLKKVL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2637 Number of alignments=649 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 3 :TN 1jgsA 12 :IP T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 14 :LGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY T0373 137 :LLT 1jgsA 138 :LLK Number of specific fragments extracted= 4 number of extra gaps= 0 total=2641 Number of alignments=650 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 2 :PTNQDLQL 1jgsA 11 :IIPLGRLI T0373 14 :RSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1jgsA 19 :HMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAAC T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1jgsA 55 :ITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKN T0373 126 :SERALLAA 1jgsA 133 :ATLEYLLK T0373 143 :QFE 1jgsA 141 :KVL Number of specific fragments extracted= 5 number of extra gaps= 0 total=2646 Number of alignments=651 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1jgsA 8 :FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRC T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 52 :AACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY T0373 137 :LLTRLA 1jgsA 138 :LLKKVL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2649 Number of alignments=652 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1jgsA 9 :NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCA T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 53 :ACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY T0373 137 :LLTRLA 1jgsA 138 :LLKKVL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2652 Number of alignments=653 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1jgsA)L7 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1jgsA 8 :FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCA T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAA 1jgsA 53 :ACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEY T0373 137 :LLTR 1jgsA 138 :LLKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=2655 Number of alignments=654 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set Warning: unaligning (T0373)P2 because first residue in template chain is (1jgsA)L7 Warning: unaligning (T0373)E146 because last residue in template chain is (1jgsA)P144 T0373 3 :TNQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1jgsA 8 :FNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCA T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1jgsA 53 :ACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQEL T0373 120 :HACLDESERALLAA 1jgsA 127 :LTADEVATLEYLLK T0373 143 :QFE 1jgsA 141 :KVL Number of specific fragments extracted= 4 number of extra gaps= 0 total=2659 Number of alignments=655 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1jgsA 12 :IPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRC T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALL 1jgsA 52 :AACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2661 Number of alignments=656 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 7 :LQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1jgsA 12 :IPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRC T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAAA 1jgsA 52 :AACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYL Number of specific fragments extracted= 2 number of extra gaps= 0 total=2663 Number of alignments=657 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 9 :LAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1jgsA 14 :LGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRC T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESER 1jgsA 52 :AACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=2665 Number of alignments=658 # 1jgsA read from 1jgsA/merged-local-a2m # found chain 1jgsA in template set T0373 2 :PTNQDLQ 1jgsA 11 :IIPLGRL T0373 13 :LRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1jgsA 18 :IHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRC T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDESERALLAAAGP 1jgsA 52 :AACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQELTKNLTADEVATLEYLLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=2668 Number of alignments=659 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xmaA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xmaA expands to /projects/compbio/data/pdb/1xma.pdb.gz 1xmaA:Skipped atom 237, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 239, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 241, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 243, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 245, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 436, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 438, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 440, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 722, because occupancy 0.350 <= existing 0.650 in 1xmaA Skipped atom 724, because occupancy 0.350 <= existing 0.650 in 1xmaA # T0373 read from 1xmaA/merged-local-a2m # 1xmaA read from 1xmaA/merged-local-a2m # adding 1xmaA to template set # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 32 :PVQFSQLVVLGAIDR 1xmaA 7 :IRGYVDTIILSLLIE T0373 49 :GDVTPSELAAAER 1xmaA 22 :GDSYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRHADP 1xmaA 43 :IKETTLYSAFARLEKNGYIKSYYGE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVRAMHAC 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTKKVINKFV Number of specific fragments extracted= 4 number of extra gaps= 0 total=2672 Number of alignments=660 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 34 :QFSQLVVLGAIDR 1xmaA 9 :GYVDTIILSLLIE T0373 49 :GDVTPSELAAAE 1xmaA 22 :GDSYGYEISKNI T0373 61 :RMRSSNLAALLRELERGGLIVRHADP 1xmaA 42 :VIKETTLYSAFARLEKNGYIKSYYGE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVRA 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTKKVI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2676 Number of alignments=661 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 70 :LLRELERGGLIVRHADPQ 1xmaA 51 :AFARLEKNGYIKSYYGEE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWL 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTK Number of specific fragments extracted= 2 number of extra gaps= 0 total=2678 Number of alignments=662 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 38 :LVVLGAIDR 1xmaA 13 :TIILSLLIE T0373 49 :GDVTPSELAAA 1xmaA 22 :GDSYGYEISKN T0373 60 :ERMRSSNLAALLRELERGGLIVRHADPQ 1xmaA 41 :YVIKETTLYSAFARLEKNGYIKSYYGEE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWEL Number of specific fragments extracted= 4 number of extra gaps= 0 total=2682 Number of alignments=663 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 58 :AAERMRSSNLAALLRELERGGLIVRHADPQ 1xmaA 39 :ELYVIKETTLYSAFARLEKNGYIKSYYGEE T0373 90 :RRTRVSLSSEGRRNLYGNRAKRE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2684 Number of alignments=664 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 58 :AAERMRSSNLAALLRELERGGLIVRHADPQ 1xmaA 39 :ELYVIKETTLYSAFARLEKNGYIKSYYGEE T0373 90 :RRTRVSLSSEGRRNLYGNRAKRE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2686 Number of alignments=665 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 35 :FSQLVVLGAIDR 1xmaA 10 :YVDTIILSLLIE T0373 48 :GG 1xmaA 22 :GD T0373 51 :VTPSELAAAER 1xmaA 24 :SYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRHADP 1xmaA 43 :IKETTLYSAFARLEKNGYIKSYYGE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWEL T0373 115 :LVRAMHAC 1xmaA 97 :TKKVINKF Number of specific fragments extracted= 6 number of extra gaps= 0 total=2692 Number of alignments=666 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)P86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xmaA)K72 Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 Warning: unaligning (T0373)D124 because last residue in template chain is (1xmaA)K106 T0373 35 :FSQLVVLGAIDR 1xmaA 10 :YVDTIILSLLIE T0373 48 :GG 1xmaA 22 :GD T0373 51 :VTPSELAAAER 1xmaA 24 :SYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRHA 1xmaA 43 :IKETTLYSAFARLEKNGYIKSYY T0373 85 :D 1xmaA 68 :E T0373 90 :RRTRVSLSSEGRRNLYGNRAKREE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWEL T0373 115 :LVRAMHACL 1xmaA 97 :TKKVINKFV Number of specific fragments extracted= 7 number of extra gaps= 0 total=2699 Number of alignments=667 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 58 :AAERMRSSNLAALLRELERGGLIVRHADPQ 1xmaA 39 :ELYVIKETTLYSAFARLEKNGYIKSYYGEE T0373 90 :RRTRVSLSSEGRRNLYGNRAKRE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2701 Number of alignments=668 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 34 :QFSQLVVLGAIDR 1xmaA 9 :GYVDTIILSLLIE T0373 49 :GDVTPSELAAAER 1xmaA 22 :GDSYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1xmaA 43 :IKETTLYSAFARLEKNGYIKSYYGEE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWL 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTK Number of specific fragments extracted= 4 number of extra gaps= 0 total=2705 Number of alignments=669 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 Warning: unaligning (T0373)D124 because last residue in template chain is (1xmaA)K106 T0373 35 :FSQLVVLGAIDR 1xmaA 10 :YVDTIILSLLIE T0373 49 :GDVTPSELAAAER 1xmaA 22 :GDSYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRHADP 1xmaA 43 :IKETTLYSAFARLEKNGYIKSYYGE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTKKVIN T0373 121 :ACL 1xmaA 103 :KFV Number of specific fragments extracted= 5 number of extra gaps= 0 total=2710 Number of alignments=670 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)P86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xmaA)K72 Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 Warning: unaligning (T0373)D124 because last residue in template chain is (1xmaA)K106 T0373 35 :FSQLVVLGAIDR 1xmaA 10 :YVDTIILSLLIE T0373 49 :GDVTPSELAAAER 1xmaA 22 :GDSYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRHA 1xmaA 43 :IKETTLYSAFARLEKNGYIKSYY T0373 85 :D 1xmaA 68 :E T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTKKVIN T0373 121 :ACL 1xmaA 103 :KFV Number of specific fragments extracted= 6 number of extra gaps= 0 total=2716 Number of alignments=671 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 58 :AAERMRSSNLAALLRELERGGLIVRHADPQ 1xmaA 39 :ELYVIKETTLYSAFARLEKNGYIKSYYGEE T0373 90 :RRTRVSLSSEGRRNLYGNRAKRE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2718 Number of alignments=672 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 T0373 59 :AERMRSSNLAALLRELERGGLIVRHADP 1xmaA 40 :LYVIKETTLYSAFARLEKNGYIKSYYGE T0373 90 :RRTRVSLSSEGRRNLYGNRAKRE 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2720 Number of alignments=673 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)P86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xmaA)K72 Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 Warning: unaligning (T0373)D124 because last residue in template chain is (1xmaA)K106 T0373 36 :SQLVVLGAIDR 1xmaA 11 :VDTIILSLLIE T0373 49 :GDVTPSELAAAER 1xmaA 22 :GDSYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRH 1xmaA 43 :IKETTLYSAFARLEKNGYIKSY T0373 84 :AD 1xmaA 67 :EE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVR 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTKKV T0373 119 :MHACL 1xmaA 101 :INKFV Number of specific fragments extracted= 6 number of extra gaps= 0 total=2726 Number of alignments=674 # 1xmaA read from 1xmaA/merged-local-a2m # found chain 1xmaA in template set Warning: unaligning (T0373)P86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1xmaA)K72 Warning: unaligning (T0373)G89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1xmaA)K72 Warning: unaligning (T0373)D124 because last residue in template chain is (1xmaA)K106 T0373 35 :FSQLVVLGAIDR 1xmaA 10 :YVDTIILSLLIE T0373 49 :GDVTPSELAAAER 1xmaA 22 :GDSYGYEISKNIR T0373 62 :MRSSNLAALLRELERGGLIVRH 1xmaA 43 :IKETTLYSAFARLEKNGYIKSY T0373 84 :AD 1xmaA 67 :EE T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVR 1xmaA 73 :RRTYYRITPEGIKYYKQKCEEWELTKKV T0373 119 :MHACL 1xmaA 101 :INKFV Number of specific fragments extracted= 6 number of extra gaps= 0 total=2732 Number of alignments=675 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z91A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1z91A/merged-local-a2m # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLV 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILG T0373 120 :HACLDESERALL 1z91A 121 :LSKQSGEDLKQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2735 Number of alignments=676 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 8 :QLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 13 :QLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLV 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILG T0373 120 :HACLDESERALLAA 1z91A 121 :LSKQSGEDLKQLKS Number of specific fragments extracted= 3 number of extra gaps= 0 total=2738 Number of alignments=677 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVRA 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGLS T0373 122 :CLDESERALL 1z91A 123 :KQSGEDLKQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2741 Number of alignments=678 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 5 :QDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 10 :LENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGT T0373 115 :LVRAM 1z91A 118 :ILGLS T0373 122 :CLDESERALLAAA 1z91A 123 :KQSGEDLKQLKSA Number of specific fragments extracted= 4 number of extra gaps= 0 total=2745 Number of alignments=679 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTIL T0373 119 :MHACLDESERALL 1z91A 120 :GLSKQSGEDLKQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2748 Number of alignments=680 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 6 :DLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 11 :ENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWL 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTIL T0373 119 :MHACLDESERALLAA 1z91A 120 :GLSKQSGEDLKQLKS Number of specific fragments extracted= 3 number of extra gaps= 0 total=2751 Number of alignments=681 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGT T0373 115 :LVR 1z91A 118 :ILG T0373 120 :HACLDESERALLAA 1z91A 121 :LSKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 5 number of extra gaps= 0 total=2756 Number of alignments=682 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGT T0373 115 :LVR 1z91A 118 :ILG T0373 120 :HACLDESERALLAA 1z91A 121 :LSKQSGEDLKQLKS T0373 137 :LLTRLAQF 1z91A 135 :ALYTLLET Number of specific fragments extracted= 5 number of extra gaps= 0 total=2761 Number of alignments=683 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREE 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGT T0373 115 :LVR 1z91A 118 :ILG T0373 120 :HACLDESERALLAA 1z91A 121 :LSKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 5 number of extra gaps= 0 total=2766 Number of alignments=684 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRN 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL T0373 104 :LYGNRAKREE 1z91A 111 :AVDIPGTILG T0373 120 :HACLDESERALLAA 1z91A 121 :LSKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 5 number of extra gaps= 0 total=2771 Number of alignments=685 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEHET T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z91A 55 :LTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGL T0373 121 :ACLDESERALLAA 1z91A 122 :SKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 4 number of extra gaps= 0 total=2775 Number of alignments=686 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEH T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z91A 53 :ETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGL T0373 121 :ACLDESERALLAA 1z91A 122 :SKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 4 number of extra gaps= 0 total=2779 Number of alignments=687 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEH T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z91A 53 :ETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGL T0373 121 :ACLDESERALLAA 1z91A 122 :SKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 4 number of extra gaps= 0 total=2783 Number of alignments=688 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 Warning: unaligning (T0373)E146 because last residue in template chain is (1z91A)H144 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRL 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWEH T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRN 1z91A 53 :ETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL T0373 104 :LYGNRAKREEW 1z91A 111 :AVDIPGTILGL T0373 121 :ACLDESERALLAA 1z91A 122 :SKQSGEDLKQLKS T0373 137 :LLTRLAQFE 1z91A 135 :ALYTLLETL Number of specific fragments extracted= 5 number of extra gaps= 0 total=2788 Number of alignments=689 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z91A 52 :HETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGL T0373 121 :ACLDESERALL 1z91A 122 :SKQSGEDLKQL Number of specific fragments extracted= 3 number of extra gaps= 0 total=2791 Number of alignments=690 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z91A 52 :HETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGL T0373 121 :ACLDESERALLAAA 1z91A 122 :SKQSGEDLKQLKSA Number of specific fragments extracted= 3 number of extra gaps= 0 total=2794 Number of alignments=691 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set Warning: unaligning (T0373)T3 because first residue in template chain is (1z91A)M8 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1z91A 9 :KLENQLSFLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRNLYGNRAKREEWLVR 1z91A 52 :HETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALLKEKAVDIPGTILGL T0373 121 :ACLDESERALLAA 1z91A 122 :SKQSGEDLKQLKS Number of specific fragments extracted= 3 number of extra gaps= 0 total=2797 Number of alignments=692 # 1z91A read from 1z91A/merged-local-a2m # found chain 1z91A in template set T0373 11 :AHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDR 1z91A 16 :FLLYASSREMTKQYKPLLDKLNITYPQYLALLLLWE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSEGRRN 1z91A 52 :HETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEEDERSVLISLTEDGALL T0373 104 :LYG 1z91A 111 :AVD T0373 111 :REEWLVR 1z91A 114 :IPGTILG T0373 120 :HACLDESERALLAAAGPLLTR 1z91A 121 :LSKQSGEDLKQLKSALYTLLE Number of specific fragments extracted= 5 number of extra gaps= 0 total=2802 Number of alignments=693 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hw5A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1hw5A expands to /projects/compbio/data/pdb/1hw5.pdb.gz 1hw5A:Skipped atom 179, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 181, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 183, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 185, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 187, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 302, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 304, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 306, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 308, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 310, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 649, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 651, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 653, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 655, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 657, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 715, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 717, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 719, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 721, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 723, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 725, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 727, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1001, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1003, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1005, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1007, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1009, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1011, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1013, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1076, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1078, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1080, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1082, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1084, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1375, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1377, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1379, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1381, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1383, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1385, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1387, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1474, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1476, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1478, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1480, because occupancy 0.500 <= existing 0.500 in 1hw5A Skipped atom 1482, because occupancy 0.500 <= existing 0.500 in 1hw5A # T0373 read from 1hw5A/merged-local-a2m # 1hw5A read from 1hw5A/merged-local-a2m # adding 1hw5A to template set # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLI 1hw5A 181 :ETVGRILKMLEDQNLI Number of specific fragments extracted= 2 number of extra gaps= 1 total=2804 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)G49 because of BadResidue code BAD_PEPTIDE in next template residue (1hw5A)K166 Warning: unaligning (T0373)D50 because of BadResidue code BAD_PEPTIDE at template residue (1hw5A)K166 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 30 :ADPVQFSQLVVLGAIDRLG 1hw5A 126 :VLAEKVGNLAFLDVTGRIA T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRH 1hw5A 181 :ETVGRILKMLEDQNLISAH Number of specific fragments extracted= 3 number of extra gaps= 2 total=2807 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)D50 because of BadResidue code BAD_PEPTIDE at template residue (1hw5A)K166 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRH 1hw5A 181 :ETVGRILKMLEDQNLISAH Number of specific fragments extracted= 2 number of extra gaps= 2 total=2809 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)D50 because of BadResidue code BAD_PEPTIDE at template residue (1hw5A)K166 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 37 :QLVVLGAIDRLGG 1hw5A 133 :NLAFLDVTGRIAQ T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRH 1hw5A 181 :ETVGRILKMLEDQNLISAH Number of specific fragments extracted= 3 number of extra gaps= 2 total=2812 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)D50 because of BadResidue code BAD_PEPTIDE at template residue (1hw5A)K166 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 20 :LTRRLRREAQADPVQFSQLVVLGAIDRLGG 1hw5A 116 :LSAQMARRLQVLAEKVGNLAFLDVTGRIAQ T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRHADP 1hw5A 181 :ETVGRILKMLEDQNLISAHGKT Number of specific fragments extracted= 3 number of extra gaps= 2 total=2815 Number of alignments=694 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)G49 because of BadResidue code BAD_PEPTIDE in next template residue (1hw5A)K166 Warning: unaligning (T0373)D50 because of BadResidue code BAD_PEPTIDE at template residue (1hw5A)K166 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 20 :LTRRLRREAQADPVQFSQLVVLGAIDRLG 1hw5A 116 :LSAQMARRLQVLAEKVGNLAFLDVTGRIA T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRHAD 1hw5A 181 :ETVGRILKMLEDQNLISAHGK Number of specific fragments extracted= 3 number of extra gaps= 2 total=2818 Number of alignments=695 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)G49 because of BadResidue code BAD_PEPTIDE in next template residue (1hw5A)K166 Warning: unaligning (T0373)D50 because of BadResidue code BAD_PEPTIDE at template residue (1hw5A)K166 Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 46 :RLG 1hw5A 162 :GMQ T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRH 1hw5A 181 :ETVGRILKMLEDQNLISAH Number of specific fragments extracted= 3 number of extra gaps= 2 total=2821 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLI 1hw5A 181 :ETVGRILKMLEDQNLI Number of specific fragments extracted= 2 number of extra gaps= 1 total=2823 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 12 :HLRSQVTTLTRRLRREAQADP 1hw5A 112 :ILMRLSAQMARRLQVLAEKVG T0373 33 :VQFSQLVVLGAIDRLGG 1hw5A 139 :VTGRIAQTLLNLAKQPD T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIV 1hw5A 181 :ETVGRILKMLEDQNLIS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2827 Number of alignments=696 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 4 :NQ 1hw5A 111 :DI T0373 9 :LAAHLRSQVTTLTRRLR 1hw5A 113 :LMRLSAQMARRLQVLAE T0373 26 :REAQADPVQFSQLVVLGAIDRLGGD 1hw5A 132 :GNLAFLDVTGRIAQTLLNLAKQPDA T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIV 1hw5A 181 :ETVGRILKMLEDQNLIS Number of specific fragments extracted= 5 number of extra gaps= 1 total=2832 Number of alignments=697 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 8 :QLAAHLRSQVTTLTRRLRR 1hw5A 111 :DILMRLSAQMARRLQVLAE T0373 27 :EAQADPVQFSQLVVLGAIDRLGG 1hw5A 133 :NLAFLDVTGRIAQTLLNLAKQPD T0373 50 :D 1hw5A 160 :P T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIV 1hw5A 181 :ETVGRILKMLEDQNLIS Number of specific fragments extracted= 5 number of extra gaps= 1 total=2837 Number of alignments=698 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLI 1hw5A 181 :ETVGRILKMLEDQNLI Number of specific fragments extracted= 2 number of extra gaps= 1 total=2839 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 12 :HLRSQVTTLTRRLRREAQADP 1hw5A 112 :ILMRLSAQMARRLQVLAEKVG T0373 33 :VQFSQLVVLGAIDRLGGD 1hw5A 139 :VTGRIAQTLLNLAKQPDA T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIV 1hw5A 181 :ETVGRILKMLEDQNLIS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2843 Number of alignments=699 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 4 :NQDLQLAAHLRSQ 1hw5A 111 :DILMRLSAQMARR T0373 18 :TTLTRRLRREAQADPVQFSQLVVLGAIDRLGGD 1hw5A 124 :LQVLAEKVGNLAFLDVTGRIAQTLLNLAKQPDA T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIV 1hw5A 181 :ETVGRILKMLEDQNLIS Number of specific fragments extracted= 4 number of extra gaps= 1 total=2847 Number of alignments=700 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLG 1hw5A 110 :PDILMRLSAQMARRLQVLAEKVGNLAFLDVTGRIAQTLLNLAKQP T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVR 1hw5A 181 :ETVGRILKMLEDQNLISA Number of specific fragments extracted= 3 number of extra gaps= 1 total=2850 Number of alignments=701 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLI 1hw5A 181 :ETVGRILKMLEDQNLI Number of specific fragments extracted= 2 number of extra gaps= 1 total=2852 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 28 :AQADPVQFSQLVVLGAIDRLGGD 1hw5A 134 :LAFLDVTGRIAQTLLNLAKQPDA T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIV 1hw5A 181 :ETVGRILKMLEDQNLIS Number of specific fragments extracted= 3 number of extra gaps= 1 total=2855 Number of alignments=702 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 7 :LQLAAHLRSQVTTLTRRLR 1hw5A 111 :DILMRLSAQMARRLQVLAE T0373 26 :REAQADPVQFSQLVVLGAIDRLGGD 1hw5A 132 :GNLAFLDVTGRIAQTLLNLAKQPDA T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRH 1hw5A 181 :ETVGRILKMLEDQNLISAH Number of specific fragments extracted= 4 number of extra gaps= 1 total=2859 Number of alignments=703 # 1hw5A read from 1hw5A/merged-local-a2m # found chain 1hw5A in template set Warning: unaligning (T0373)R63 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1hw5A)R180 Warning: unaligning (T0373)S64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1hw5A)R180 T0373 4 :NQDLQLAAHLRSQVTTLTRRLRREAQADPVQFSQLVVLGAIDRLGG 1hw5A 110 :PDILMRLSAQMARRLQVLAEKVGNLAFLDVTGRIAQTLLNLAKQPD T0373 51 :VTPSELAAAERM 1hw5A 167 :ITRQEIGQIVGC T0373 65 :SNLAALLRELERGGLIVRH 1hw5A 181 :ETVGRILKMLEDQNLISAH Number of specific fragments extracted= 3 number of extra gaps= 1 total=2862 Number of alignments=704 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1f5tA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1f5tA expands to /projects/compbio/data/pdb/1f5t.pdb.gz 1f5tA:# T0373 read from 1f5tA/merged-local-a2m # 1f5tA read from 1f5tA/merged-local-a2m # adding 1f5tA to template set # found chain 1f5tA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1f5tA 1012 :LRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 87 :QDGRRTRVSLSSEG 1f5tA 1065 :TPTGRTLATAVMRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=2864 Number of alignments=705 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1f5tA 1022 :GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRR 1f5tA 1060 :RSLQMTPTGRT Number of specific fragments extracted= 2 number of extra gaps= 0 total=2866 Number of alignments=706 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 43 :AIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1f5tA 1017 :ELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNL 1f5tA 1060 :RSLQMTPTGRTLA Number of specific fragments extracted= 2 number of extra gaps= 0 total=2868 Number of alignments=707 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1f5tA 1005 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKRE 1f5tA 1060 :RSLQMTPTGRTLATAVMRKHR T0373 115 :LVRAMHACLDESERALLAA 1f5tA 1081 :LAERLLTDIIGLDINKVHD T0373 137 :LLTRLAQFEEP 1f5tA 1100 :EADRWEHVMSD Number of specific fragments extracted= 4 number of extra gaps= 0 total=2872 Number of alignments=708 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1f5tA 1010 :MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKRE 1f5tA 1060 :RSLQMTPTGRTLATAVMRKHR T0373 115 :LVRAMHACL 1f5tA 1081 :LAERLLTDI Number of specific fragments extracted= 3 number of extra gaps= 0 total=2875 Number of alignments=709 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1f5tA 1009 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1f5tA 1058 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKRE 1f5tA 1062 :LQMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHACLD 1f5tA 1081 :LAERLLTDIIG Number of specific fragments extracted= 4 number of extra gaps= 0 total=2879 Number of alignments=710 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1f5tA 1010 :MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 1f5tA 1058 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKRE 1f5tA 1062 :LQMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHAC 1f5tA 1081 :LAERLLTDI T0373 123 :LDESERALLAA 1f5tA 1108 :MSDEVERRLVK Number of specific fragments extracted= 5 number of extra gaps= 0 total=2884 Number of alignments=711 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1f5tA 1005 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1f5tA 1062 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1f5tA 1088 :DIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=2887 Number of alignments=712 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 34 :QFSQLVVLGAIDR 1f5tA 1008 :TEMYLRTIYELEE T0373 48 :GG 1f5tA 1021 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1f5tA 1024 :TPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1f5tA 1062 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 1f5tA 1088 :DIIGLD Number of specific fragments extracted= 5 number of extra gaps= 0 total=2892 Number of alignments=713 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1f5tA 1006 :DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 86 :PQDGR 1f5tA 1057 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1f5tA 1062 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLD 1f5tA 1088 :DIIG T0373 125 :ESER 1f5tA 1098 :HDEA Number of specific fragments extracted= 5 number of extra gaps= 0 total=2897 Number of alignments=714 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1f5tA 1009 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 85 :DPQDG 1f5tA 1057 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKR 1f5tA 1062 :LQMTPTGRTLATAVMRKH T0373 113 :EWLVRAMHACLD 1f5tA 1080 :RLAERLLTDIIG T0373 125 :ESERALLAA 1f5tA 1098 :HDEADRWEH T0373 136 :PLLTRLAQ 1f5tA 1111 :EVERRLVK Number of specific fragments extracted= 6 number of extra gaps= 0 total=2903 Number of alignments=715 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 39 :VVLGAIDRLGGD 1f5tA 1010 :MYLRTIYELEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1f5tA 1025 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1f5tA 1060 :RSLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLDES 1f5tA 1086 :LTDIIGLD Number of specific fragments extracted= 4 number of extra gaps= 0 total=2907 Number of alignments=716 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 35 :FSQLVVLGAIDR 1f5tA 1009 :EMYLRTIYELEE T0373 50 :D 1f5tA 1021 :E T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1f5tA 1025 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1f5tA 1061 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1f5tA 1086 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=2912 Number of alignments=717 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 35 :F 1f5tA 1009 :E T0373 39 :VVLGAIDRLGGD 1f5tA 1010 :MYLRTIYELEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1f5tA 1025 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1f5tA 1061 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 1f5tA 1086 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=2917 Number of alignments=718 # 1f5tA read from 1f5tA/merged-local-a2m # found chain 1f5tA in template set T0373 35 :FSQLVVLGAIDR 1f5tA 1009 :EMYLRTIYELEE T0373 48 :GGD 1f5tA 1021 :EGV T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1f5tA 1025 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKR 1f5tA 1061 :SLQMTPTGRTLATAVMRKH T0373 113 :EWLVRAMHA 1f5tA 1080 :RLAERLLTD T0373 122 :CLDESERALLAA 1f5tA 1107 :VMSDEVERRLVK Number of specific fragments extracted= 6 number of extra gaps= 0 total=2923 Number of alignments=719 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1u2wA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1u2wA expands to /projects/compbio/data/pdb/1u2w.pdb.gz 1u2wA:# T0373 read from 1u2wA/merged-local-a2m # 1u2wA read from 1u2wA/merged-local-a2m # adding 1u2wA to template set # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEGRRNLY 1u2wA 95 :ALYSLGDEHIRQIM Number of specific fragments extracted= 2 number of extra gaps= 0 total=2925 Number of alignments=720 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 44 :IDRL 1u2wA 48 :TYAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEGRRNLYG 1u2wA 95 :ALYSLGDEHIRQIMM Number of specific fragments extracted= 3 number of extra gaps= 0 total=2928 Number of alignments=721 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 41 :LGAIDRL 1u2wA 45 :AKITYAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEGRRNLY 1u2wA 95 :ALYSLGDEHIRQIM Number of specific fragments extracted= 3 number of extra gaps= 0 total=2931 Number of alignments=722 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 44 :IDRL 1u2wA 48 :TYAL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEGRRNLY 1u2wA 95 :ALYSLGDEHIRQIM Number of specific fragments extracted= 3 number of extra gaps= 0 total=2934 Number of alignments=723 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEGRRNLY 1u2wA 95 :ALYSLGDEHIRQIM Number of specific fragments extracted= 2 number of extra gaps= 0 total=2936 Number of alignments=724 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 46 :RL 1u2wA 50 :AL T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEGRRNL 1u2wA 95 :ALYSLGDEHIRQI Number of specific fragments extracted= 3 number of extra gaps= 0 total=2939 Number of alignments=725 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 T0373 42 :GAIDRLGG 1u2wA 49 :YALCQDEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 57 :LCVCDIANILGVTIANASHHLRTLYKQGVVNF Number of specific fragments extracted= 2 number of extra gaps= 0 total=2941 Number of alignments=726 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 T0373 43 :AIDR 1u2wA 50 :ALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF Number of specific fragments extracted= 2 number of extra gaps= 0 total=2943 Number of alignments=727 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 35 :FSQLVVLGAIDR 1u2wA 42 :ENRAKITYALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSE 1u2wA 95 :ALYSLGDE T0373 103 :NLYGNRAKREE 1u2wA 103 :HIRQIMMIALA Number of specific fragments extracted= 4 number of extra gaps= 0 total=2947 Number of alignments=728 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 21 :TRRLRREAQ 1u2wA 32 :VSQILKAIA T0373 35 :FSQLVVLGAIDRLGG 1u2wA 42 :ENRAKITYALCQDEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 57 :LCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLS 1u2wA 95 :ALYSLG T0373 98 :SEGRRNLYGNRAK 1u2wA 102 :EHIRQIMMIALAH Number of specific fragments extracted= 5 number of extra gaps= 0 total=2952 Number of alignments=729 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 T0373 42 :GAIDR 1u2wA 49 :YALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF Number of specific fragments extracted= 2 number of extra gaps= 0 total=2954 Number of alignments=730 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 42 :GAIDR 1u2wA 49 :YALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEG 1u2wA 95 :ALYSLGDEH Number of specific fragments extracted= 3 number of extra gaps= 0 total=2957 Number of alignments=731 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 33 :VQFSQLVVLGAIDR 1u2wA 40 :ADENRAKITYALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEGRRNLYGNRAKR 1u2wA 95 :ALYSLGDEHIRQIMMIALAH Number of specific fragments extracted= 3 number of extra gaps= 0 total=2960 Number of alignments=732 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 2 :PTNQDLQLAAHLRS 1u2wA 12 :YDEEKVNRIQGDLQ T0373 21 :TRRLRREAQA 1u2wA 32 :VSQILKAIAD T0373 35 :FSQLVVLGAIDR 1u2wA 42 :ENRAKITYALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLS 1u2wA 95 :ALYSLG T0373 98 :SEGRRNLYGNRAK 1u2wA 102 :EHIRQIMMIALAH Number of specific fragments extracted= 6 number of extra gaps= 0 total=2966 Number of alignments=733 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set T0373 42 :GAIDR 1u2wA 49 :YALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLI 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVV Number of specific fragments extracted= 2 number of extra gaps= 0 total=2968 Number of alignments=734 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 T0373 43 :AIDR 1u2wA 50 :ALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF Number of specific fragments extracted= 2 number of extra gaps= 0 total=2970 Number of alignments=735 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 35 :FSQLVVLGAIDR 1u2wA 42 :ENRAKITYALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLSSEG 1u2wA 95 :ALYSLGDEH T0373 107 :NRAKREE 1u2wA 104 :IRQIMMI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2974 Number of alignments=736 # 1u2wA read from 1u2wA/merged-local-a2m # found chain 1u2wA in template set Warning: unaligning (T0373)H83 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1u2wA)L94 Warning: unaligning (T0373)R91 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1u2wA)L94 T0373 21 :TRRLRREAQ 1u2wA 32 :VSQILKAIA T0373 34 :QFSQLVVLGAIDR 1u2wA 41 :DENRAKITYALCQ T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1u2wA 54 :DEELCVCDIANILGVTIANASHHLRTLYKQGVVNF T0373 92 :TRVSLS 1u2wA 95 :ALYSLG T0373 98 :SEGRRNLYGNRAK 1u2wA 102 :EHIRQIMMIALAH Number of specific fragments extracted= 5 number of extra gaps= 0 total=2979 Number of alignments=737 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2co5A/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2co5A expands to /projects/compbio/data/pdb/2co5.pdb.gz 2co5A:Skipped atom 32, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 36, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 38, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 40, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 46, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 48, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 728, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 732, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 734, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 736, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 738, because occupancy 0.500 <= existing 0.500 in 2co5A Skipped atom 740, because occupancy 0.500 <= existing 0.500 in 2co5A # T0373 read from 2co5A/merged-local-a2m # 2co5A read from 2co5A/merged-local-a2m # adding 2co5A to template set # found chain 2co5A in template set Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 80 :IVRHAD 2co5A 59 :ILREEE T0373 89 :GR 2co5A 68 :GK Number of specific fragments extracted= 2 number of extra gaps= 1 total=2981 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=2981 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 80 :IVRHAD 2co5A 59 :ILREEE T0373 89 :GR 2co5A 68 :GK Number of specific fragments extracted= 2 number of extra gaps= 1 total=2983 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=2983 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)D88 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 80 :IVRHAD 2co5A 59 :ILREEE T0373 89 :GR 2co5A 68 :GK Number of specific fragments extracted= 2 number of extra gaps= 1 total=2985 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=2985 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 Warning: unaligning (T0373)A118 because of BadResidue code BAD_PEPTIDE in next template residue (2co5A)H95 T0373 60 :ERMRSSNLAALLRELERGGLIVRHA 2co5A 40 :IDISDGVLYPLIDSLIDDKILREEE T0373 91 :RTRVSLSSEGRRNLYGNRAKREE 2co5A 68 :GKVLFLTEKGMKEFEELHEFFKK T0373 115 :LVR 2co5A 91 :IVC Number of specific fragments extracted= 3 number of extra gaps= 2 total=2988 Number of alignments=738 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 37 :QLVVLGAIDRLGGD 2co5A 11 :YYIILKVLVINGSR T0373 51 :VTPSELAAAER 2co5A 29 :RLRSEILKRFD T0373 62 :MRSSNLAALLRELERGGLIVRHA 2co5A 42 :ISDGVLYPLIDSLIDDKILREEE T0373 91 :RTRVSLSSEGRRNLYGNRAKREE 2co5A 68 :GKVLFLTEKGMKEFEELHEFFKK T0373 115 :LV 2co5A 91 :IV Number of specific fragments extracted= 5 number of extra gaps= 1 total=2993 Number of alignments=739 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 35 :FSQLVVLGAIDRLGGDVT 2co5A 9 :INYYIILKVLVINGSRLE T0373 53 :PSELAAAER 2co5A 31 :RSEILKRFD T0373 62 :MRSSNLAALLRELERGGLIVRHA 2co5A 42 :ISDGVLYPLIDSLIDDKILREEE T0373 88 :DG 2co5A 68 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREE 2co5A 70 :VLFLTEKGMKEFEELHEFFKK T0373 115 :L 2co5A 91 :I Number of specific fragments extracted= 6 number of extra gaps= 1 total=2999 Number of alignments=740 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 35 :FSQLVVLGAIDRLGGDV 2co5A 9 :INYYIILKVLVINGSRL T0373 53 :PSELAAAER 2co5A 31 :RSEILKRFD T0373 62 :MRSSNLAALLRELERGGLIVRHA 2co5A 42 :ISDGVLYPLIDSLIDDKILREEE T0373 88 :DG 2co5A 68 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREE 2co5A 70 :VLFLTEKGMKEFEELHEFFKK T0373 115 :LV 2co5A 91 :IV Number of specific fragments extracted= 6 number of extra gaps= 1 total=3005 Number of alignments=741 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 Warning: unaligning (T0373)R117 because of BadResidue code BAD_PEPTIDE in next template residue (2co5A)H95 T0373 54 :SELAAAE 2co5A 32 :SEILKRF T0373 61 :RMRSSNLAALLRELERGGLIVRHA 2co5A 41 :DISDGVLYPLIDSLIDDKILREEE T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLV 2co5A 68 :GKVLFLTEKGMKEFEELHEFFKKIVC Number of specific fragments extracted= 3 number of extra gaps= 2 total=3008 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 37 :QLVVLGAIDRLGGD 2co5A 11 :YYIILKVLVINGSR T0373 51 :VTPSELAAAE 2co5A 29 :RLRSEILKRF T0373 61 :RMRSSNLAALLRELERGGLIVRHA 2co5A 41 :DISDGVLYPLIDSLIDDKILREEE T0373 88 :D 2co5A 68 :G T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLV 2co5A 69 :KVLFLTEKGMKEFEELHEFFKKIVC Number of specific fragments extracted= 5 number of extra gaps= 1 total=3013 Number of alignments=742 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 35 :FSQLVVLGAIDRLGGDVT 2co5A 9 :INYYIILKVLVINGSRLE T0373 53 :PSELAAAE 2co5A 31 :RSEILKRF T0373 61 :RMRSSNLAALLRELERGGLIVRHA 2co5A 41 :DISDGVLYPLIDSLIDDKILREEE T0373 88 :DG 2co5A 68 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREEW 2co5A 70 :VLFLTEKGMKEFEELHEFFKKI Number of specific fragments extracted= 5 number of extra gaps= 1 total=3018 Number of alignments=743 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 35 :FSQLVVLGAIDRLGGDVT 2co5A 9 :INYYIILKVLVINGSRLE T0373 53 :PSELAAAE 2co5A 31 :RSEILKRF T0373 61 :RMRSSNLAALLRELERGGLIVRHA 2co5A 41 :DISDGVLYPLIDSLIDDKILREEE T0373 88 :DG 2co5A 68 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREEWL 2co5A 70 :VLFLTEKGMKEFEELHEFFKKIV Number of specific fragments extracted= 5 number of extra gaps= 1 total=3023 Number of alignments=744 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 60 :ERMRSSNLAALLRELERGGLIVRHA 2co5A 40 :IDISDGVLYPLIDSLIDDKILREEE T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLV 2co5A 68 :GKVLFLTEKGMKEFEELHEFFKKIVC Number of specific fragments extracted= 2 number of extra gaps= 1 total=3025 Number of alignments=745 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 51 :VTPSELAAAER 2co5A 29 :RLRSEILKRFD T0373 62 :MRSSNLAALLRELERGGLIVRHA 2co5A 42 :ISDGVLYPLIDSLIDDKILREEE T0373 88 :D 2co5A 68 :G T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLV 2co5A 69 :KVLFLTEKGMKEFEELHEFFKKIVC Number of specific fragments extracted= 4 number of extra gaps= 1 total=3029 Number of alignments=746 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 36 :SQLVVLGAIDR 2co5A 10 :NYYIILKVLVI T0373 48 :GGD 2co5A 21 :NGS T0373 51 :VTPSELAAAER 2co5A 29 :RLRSEILKRFD T0373 62 :MRSSNLAALLRELERGGLIVRHA 2co5A 42 :ISDGVLYPLIDSLIDDKILREEE T0373 88 :DG 2co5A 68 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREEW 2co5A 70 :VLFLTEKGMKEFEELHEFFKKI Number of specific fragments extracted= 6 number of extra gaps= 1 total=3035 Number of alignments=747 # 2co5A read from 2co5A/merged-local-a2m # found chain 2co5A in template set Warning: unaligning (T0373)D85 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2co5A)P66 Warning: unaligning (T0373)P86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2co5A)P66 Warning: unaligning (T0373)Q87 because of BadResidue code BAD_PEPTIDE at template residue (2co5A)D67 T0373 35 :FSQLVVLGAIDRLGGD 2co5A 9 :INYYIILKVLVINGSR T0373 53 :PSELAAAER 2co5A 31 :RSEILKRFD T0373 62 :MRSSNLAALLRELERGGLIVRHA 2co5A 42 :ISDGVLYPLIDSLIDDKILREEE T0373 88 :DG 2co5A 68 :GK T0373 93 :RVSLSSEGRRNLYGNRAKREEWL 2co5A 70 :VLFLTEKGMKEFEELHEFFKKIV Number of specific fragments extracted= 5 number of extra gaps= 1 total=3040 Number of alignments=748 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bjaA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bjaA expands to /projects/compbio/data/pdb/1bja.pdb.gz 1bjaA:# T0373 read from 1bjaA/merged-local-a2m # 1bjaA read from 1bjaA/merged-local-a2m # adding 1bjaA to template set # found chain 1bjaA in template set T0373 31 :DPVQFSQLVVLGAIDRL 1bjaA 13 :DVLNEKTATILITIAKK T0373 49 :GDVTPSELAAAER 1bjaA 30 :DFITAAEVREVHP T0373 62 :MRSSNLAALLRELERGGLIVRHA 1bjaA 44 :LGNAVVNSNIGVLIKKGLVEKSG Number of specific fragments extracted= 3 number of extra gaps= 0 total=3043 Number of alignments=749 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 113 :EWLVRAMHACLDESERALL 1bjaA 5 :TYIIKASNDVLNEKTATIL Number of specific fragments extracted= 1 number of extra gaps= 0 total=3044 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3044 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 113 :EWLVRAMHACLDESERALL 1bjaA 5 :TYIIKASNDVLNEKTATIL Number of specific fragments extracted= 1 number of extra gaps= 0 total=3045 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3045 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 75 :ERGGLIVRHADPQ 1bjaA 81 :NAATLYAQENAPE Number of specific fragments extracted= 1 number of extra gaps= 0 total=3046 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3046 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 61 :RMRSSNLAALLRELERGGLIVRHADP 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKSGDG T0373 94 :VSLSSEGRRNLYGNRAKREE 1bjaA 69 :LIITGEAQDIISNAATLYAQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=3048 Number of alignments=750 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 37 :QLVVLGAIDRLGG 1bjaA 19 :TATILITIAKKDF T0373 51 :VTPSELAAAE 1bjaA 32 :ITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVRHADP 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKSGDG T0373 94 :VSLSSEGRRNLYGNRAKREE 1bjaA 69 :LIITGEAQDIISNAATLYAQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=3052 Number of alignments=751 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 22 :RRLRREAQAD 1bjaA 5 :TYIIKASNDV T0373 33 :VQFSQLVVLGAIDRLGG 1bjaA 15 :LNEKTATILITIAKKDF T0373 51 :VTPSELAAA 1bjaA 32 :ITAAEVREV T0373 60 :ERMRSSNLAALLRELERGGLIVRH 1bjaA 42 :PDLGNAVVNSNIGVLIKKGLVEKS T0373 87 :QDG 1bjaA 66 :GDG T0373 94 :VSLSSEGRRNLYGNRAKREE 1bjaA 69 :LIITGEAQDIISNAATLYAQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=3058 Number of alignments=752 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 23 :RLRREAQAD 1bjaA 6 :YIIKASNDV T0373 33 :VQFSQLVVLGAIDRLGG 1bjaA 15 :LNEKTATILITIAKKDF T0373 51 :VTPSELAAA 1bjaA 32 :ITAAEVREV T0373 60 :ERMRSSNLAALLRELERGGLIVRH 1bjaA 42 :PDLGNAVVNSNIGVLIKKGLVEKS T0373 87 :QD 1bjaA 66 :GD T0373 93 :RVSLSSEGRRNLYGNRAKREE 1bjaA 68 :GLIITGEAQDIISNAATLYAQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=3064 Number of alignments=753 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 33 :VQFSQLVVLGAIDR 1bjaA 15 :LNEKTATILITIAK T0373 48 :GGDVTPSELAAAE 1bjaA 29 :KDFITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVRHADP 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKSGDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=3067 Number of alignments=754 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 33 :VQFSQLVVLGAIDR 1bjaA 15 :LNEKTATILITIAK T0373 48 :GGDVTPSELAAAE 1bjaA 29 :KDFITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVRHADP 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKSGDG T0373 94 :VSLSSEGRRNLYGNRAK 1bjaA 69 :LIITGEAQDIISNAATL Number of specific fragments extracted= 4 number of extra gaps= 0 total=3071 Number of alignments=755 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 22 :RRLRREAQAD 1bjaA 5 :TYIIKASNDV T0373 33 :VQFSQLVVLGAIDRLGG 1bjaA 15 :LNEKTATILITIAKKDF T0373 51 :VTPSELAAAE 1bjaA 32 :ITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVRH 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKS T0373 86 :PQ 1bjaA 66 :GD T0373 89 :G 1bjaA 68 :G T0373 94 :VSLSSEGRRNLYGNRAKREE 1bjaA 69 :LIITGEAQDIISNAATLYAQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=3078 Number of alignments=756 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 22 :RRLRREAQAD 1bjaA 5 :TYIIKASNDV T0373 33 :VQFSQLVVLGAIDRLGG 1bjaA 15 :LNEKTATILITIAKKDF T0373 51 :VTPSELAAAE 1bjaA 32 :ITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVR 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEK T0373 85 :DPQ 1bjaA 65 :SGD T0373 93 :RVSLSSEGRRNLYGNRAKREE 1bjaA 68 :GLIITGEAQDIISNAATLYAQ Number of specific fragments extracted= 6 number of extra gaps= 0 total=3084 Number of alignments=757 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 33 :VQFSQLVVLGAIDR 1bjaA 15 :LNEKTATILITIAK T0373 48 :GGDVTPSELAAAE 1bjaA 29 :KDFITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVRHAD 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKSGD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3087 Number of alignments=758 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 37 :QLVVLGAIDR 1bjaA 19 :TATILITIAK T0373 48 :GGDVTPSELAAAE 1bjaA 29 :KDFITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVRHADP 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKSGDG T0373 94 :VSLSSEGRRNLYGNRAKREE 1bjaA 69 :LIITGEAQDIISNAATLYAQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=3091 Number of alignments=759 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 24 :LRREAQADPVQFSQLVVLGAIDR 1bjaA 6 :YIIKASNDVLNEKTATILITIAK T0373 48 :GGDVTPSELAAA 1bjaA 29 :KDFITAAEVREV T0373 60 :ERMRSSNLAALLRELERGGLIVRHAD 1bjaA 42 :PDLGNAVVNSNIGVLIKKGLVEKSGD T0373 93 :RVSLSSEGRRNLYGNRAKREEWL 1bjaA 68 :GLIITGEAQDIISNAATLYAQEN Number of specific fragments extracted= 4 number of extra gaps= 0 total=3095 Number of alignments=760 # 1bjaA read from 1bjaA/merged-local-a2m # found chain 1bjaA in template set T0373 32 :PVQFSQLVVLGAIDR 1bjaA 14 :VLNEKTATILITIAK T0373 48 :GGDVTPSELAAAE 1bjaA 29 :KDFITAAEVREVH T0373 61 :RMRSSNLAALLRELERGGLIVRHAD 1bjaA 43 :DLGNAVVNSNIGVLIKKGLVEKSGD T0373 93 :RVSLSSEGRRNLYGNRAKREEW 1bjaA 68 :GLIITGEAQDIISNAATLYAQE Number of specific fragments extracted= 4 number of extra gaps= 0 total=3099 Number of alignments=761 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xnpA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xnpA expands to /projects/compbio/data/pdb/1xnp.pdb.gz 1xnpA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 1xnpA/merged-local-a2m # 1xnpA read from 1xnpA/merged-local-a2m # adding 1xnpA to template set # found chain 1xnpA in template set T0373 37 :QLVVLGAI 1xnpA 17 :RRRILFLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 1xnpA 25 :TKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEKIP T0373 89 :GRR 1xnpA 68 :GRP T0373 92 :TRVSLSSEGRRNLY 1xnpA 72 :KYYMIKKGLRLEIL T0373 115 :LVRAMHACLDESERALL 1xnpA 86 :LTPTLFGSEMYEAKGVR Number of specific fragments extracted= 5 number of extra gaps= 0 total=3104 Number of alignments=762 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 37 :QLVVLGAI 1xnpA 17 :RRRILFLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 1xnpA 25 :TKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEKIP T0373 89 :GRR 1xnpA 68 :GRP T0373 92 :TRVSLSSEGRRNLY 1xnpA 72 :KYYMIKKGLRLEIL T0373 115 :LVRAMHACLDES 1xnpA 86 :LTPTLFGSEMYE Number of specific fragments extracted= 5 number of extra gaps= 0 total=3109 Number of alignments=763 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1xnpA 26 :KRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEKI Number of specific fragments extracted= 1 number of extra gaps= 0 total=3110 Number of alignments=764 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1xnpA 25 :TKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESR T0373 87 :QDGRRTRV 1xnpA 62 :VEKIPRGR Number of specific fragments extracted= 2 number of extra gaps= 0 total=3112 Number of alignments=765 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 39 :VVLGAIDR 1xnpA 19 :RILFLLTK T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1xnpA 27 :RPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRV Number of specific fragments extracted= 2 number of extra gaps= 0 total=3114 Number of alignments=766 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 36 :SQLVVLGAIDR 1xnpA 16 :TRRRILFLLTK T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1xnpA 27 :RPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEK T0373 87 :QDGRRTRVSLSSEGRRNLYGNRAKREE 1xnpA 66 :PRGRPRKYYMIKKGLRLEILLTPTLFG Number of specific fragments extracted= 3 number of extra gaps= 0 total=3117 Number of alignments=767 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 39 :VVLGAI 1xnpA 19 :RILFLL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1xnpA 25 :TKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVE T0373 86 :PQDGR 1xnpA 66 :PRGRP T0373 91 :RTRVSLSS 1xnpA 81 :RLEILLTP T0373 99 :EGRRNLYGNRAKREE 1xnpA 123 :KMRELAEFLHELNER T0373 115 :LVRAMHACLDESERALLAA 1xnpA 138 :IREIIEEKRELEEARILIE T0373 140 :RLAQF 1xnpA 157 :TYIEN Number of specific fragments extracted= 7 number of extra gaps= 0 total=3124 Number of alignments=768 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 6 :DLQLAA 1xnpA 5 :LNRLLD T0373 27 :E 1xnpA 11 :V T0373 31 :DP 1xnpA 12 :LG T0373 34 :QFSQLVVLGAID 1xnpA 14 :NETRRRILFLLT T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1xnpA 26 :KRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVE T0373 86 :PQ 1xnpA 66 :PR T0373 88 :DGRRTRVSLSS 1xnpA 78 :KGLRLEILLTP T0373 99 :EGRRN 1xnpA 109 :QAKEL T0373 104 :LYGNRAKREE 1xnpA 127 :LAEFLHELNE T0373 115 :LVRAMHAC 1xnpA 137 :RIREIIEE T0373 127 :ERALLAAAGPLLTRLAQ 1xnpA 145 :KRELEEARILIETYIEN Number of specific fragments extracted= 11 number of extra gaps= 0 total=3135 Number of alignments=769 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set Warning: unaligning (T0373)L20 because first residue in template chain is (1xnpA)M1 T0373 21 :TRRLRREAQADP 1xnpA 2 :GEELNRLLDVLG T0373 34 :QFSQLVVLGAID 1xnpA 14 :NETRRRILFLLT T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1xnpA 26 :KRPYFVSELSRELGVGQKAVLEHLRILEEAGLIES T0373 83 :HADPQDGRRTRVSL 1xnpA 63 :EKIPRGRPRKYYMI Number of specific fragments extracted= 4 number of extra gaps= 0 total=3139 Number of alignments=770 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 25 :RREAQADP 1xnpA 6 :NRLLDVLG T0373 34 :QFSQLVVLGAID 1xnpA 14 :NETRRRILFLLT T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1xnpA 26 :KRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRV T0373 85 :DPQDGRRTRVS 1xnpA 65 :IPRGRPRKYYM T0373 97 :SSEGRRNLYGNRAK 1xnpA 76 :IKKGLRLEILLTPT Number of specific fragments extracted= 5 number of extra gaps= 0 total=3144 Number of alignments=771 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 24 :LRREAQADP 1xnpA 5 :LNRLLDVLG T0373 34 :QFSQLVVLGAID 1xnpA 14 :NETRRRILFLLT T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1xnpA 26 :KRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRV T0373 85 :DPQDGRRTRVSLSS 1xnpA 65 :IPRGRPRKYYMIKK T0373 99 :EGRRNLYGNRAKREEWLVRAM 1xnpA 123 :KMRELAEFLHELNERIREIIE T0373 121 :ACLDESERALLAA 1xnpA 144 :EKRELEEARILIE T0373 140 :RLA 1xnpA 157 :TYI Number of specific fragments extracted= 7 number of extra gaps= 0 total=3151 Number of alignments=772 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 24 :LRREAQADP 1xnpA 5 :LNRLLDVLG T0373 34 :QFSQLVVLGAID 1xnpA 14 :NETRRRILFLLT T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1xnpA 26 :KRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVE T0373 86 :PQDGRRTRVSLSS 1xnpA 66 :PRGRPRKYYMIKK T0373 99 :EGRRN 1xnpA 109 :QAKEL T0373 104 :LYGNRAKREEWLVRAMHA 1xnpA 127 :LAEFLHELNERIREIIEE T0373 125 :ESERALLAAAGPLLTRLAQ 1xnpA 147 :ELEEARILIETYIENTMRR Number of specific fragments extracted= 7 number of extra gaps= 0 total=3158 Number of alignments=773 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 34 :QFSQLVVLGAIDR 1xnpA 14 :NETRRRILFLLTK T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIV 1xnpA 27 :RPYFVSELSRELGVGQKAVLEHLRILEEAGLIE Number of specific fragments extracted= 2 number of extra gaps= 0 total=3160 Number of alignments=774 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 36 :SQLVVLGAIDR 1xnpA 16 :TRRRILFLLTK T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1xnpA 27 :RPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEK T0373 87 :QDGRRTRVSLSSEGRR 1xnpA 66 :PRGRPRKYYMIKKGLR Number of specific fragments extracted= 3 number of extra gaps= 0 total=3163 Number of alignments=775 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 24 :LRREAQADPVQFS 1xnpA 5 :LNRLLDVLGNETR T0373 38 :LV 1xnpA 18 :RR T0373 41 :LGAIDR 1xnpA 20 :ILFLLT T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1xnpA 26 :KRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVE T0373 86 :PQDGRRTRVSL 1xnpA 66 :PRGRPRKYYMI Number of specific fragments extracted= 5 number of extra gaps= 0 total=3168 Number of alignments=776 # 1xnpA read from 1xnpA/merged-local-a2m # found chain 1xnpA in template set T0373 24 :LRREAQADP 1xnpA 5 :LNRLLDVLG T0373 34 :QFSQLVVLGAIDR 1xnpA 14 :NETRRRILFLLTK T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1xnpA 27 :RPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVE T0373 86 :PQDGRRTRVSL 1xnpA 66 :PRGRPRKYYMI T0373 97 :SS 1xnpA 87 :TP T0373 99 :EGRRN 1xnpA 109 :QAKEL T0373 104 :LYGNRAKREEWLVR 1xnpA 127 :LAEFLHELNERIRE T0373 119 :MHAC 1xnpA 141 :IIEE T0373 127 :ERALLA 1xnpA 145 :KRELEE Number of specific fragments extracted= 9 number of extra gaps= 0 total=3177 Number of alignments=777 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2dtr/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2dtr expands to /projects/compbio/data/pdb/2dtr.pdb.gz 2dtr:Warning: there is no chain 2dtr will retry with 2dtrA # T0373 read from 2dtr/merged-local-a2m # 2dtr read from 2dtr/merged-local-a2m # adding 2dtr to template set # found chain 2dtr in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2dtr 12 :LRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 87 :QDGRRTRVSLSSEG 2dtr 65 :TPTGRTLATAVMRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=3179 Number of alignments=778 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dtr 6 :DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 87 :QDGRR 2dtr 57 :ASDRS T0373 94 :VSLSSEGRR 2dtr 62 :LQMTPTGRT Number of specific fragments extracted= 3 number of extra gaps= 0 total=3182 Number of alignments=779 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 33 :VQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dtr 7 :TTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 88 :DGRR 2dtr 58 :SDRS T0373 94 :VSLSSEGRR 2dtr 62 :LQMTPTGRT T0373 103 :NLYGNRAKREEWLVRAMHACL 2dtr 74 :AVMRKHRLAERLLTDIIGLDI Number of specific fragments extracted= 4 number of extra gaps= 0 total=3186 Number of alignments=780 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2dtr 22 :GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRR 2dtr 60 :RSLQMTPTGRT Number of specific fragments extracted= 2 number of extra gaps= 0 total=3188 Number of alignments=781 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 40 :VLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2dtr 14 :TIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRN 2dtr 60 :RSLQMTPTGRTL Number of specific fragments extracted= 2 number of extra gaps= 0 total=3190 Number of alignments=782 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2dtr 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 2dtr 60 :RSLQMTPTGRTLATAVMRKHRL T0373 115 :LVRAMHACLDES 2dtr 82 :AERLLTDIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3193 Number of alignments=783 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2dtr 10 :MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 2dtr 60 :RSLQMTPTGRTLATAVMRKHRL T0373 115 :LVRAMHA 2dtr 82 :AERLLTD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3196 Number of alignments=784 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 2dtr 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGRR 2dtr 58 :SDRSL T0373 95 :SLSSEGRRNLYGNRAKRE 2dtr 63 :QMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHACLD 2dtr 81 :LAERLLTDIIG T0373 126 :SERALLAAAG 2dtr 96 :KVHDEACRWE T0373 136 :PLLTRLAQFEEP 2dtr 111 :EVERRLVKVLKD Number of specific fragments extracted= 6 number of extra gaps= 0 total=3202 Number of alignments=785 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 36 :SQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 2dtr 10 :MYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 2dtr 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKRE 2dtr 62 :LQMTPTGRTLATAVMRKHR T0373 114 :WLVRAMHAC 2dtr 81 :LAERLLTDI T0373 127 :ERALLAAAG 2dtr 97 :VHDEACRWE T0373 136 :PLLTRLAQFEEP 2dtr 111 :EVERRLVKVLKD Number of specific fragments extracted= 6 number of extra gaps= 0 total=3208 Number of alignments=786 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2dtr 5 :VDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 2dtr 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 2dtr 88 :DIIGLD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3211 Number of alignments=787 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 34 :QFSQLVVLGAIDR 2dtr 8 :TEMYLRTIYELEE T0373 48 :GG 2dtr 21 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2dtr 24 :TPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 2dtr 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLDES 2dtr 88 :DIIGLD Number of specific fragments extracted= 5 number of extra gaps= 0 total=3216 Number of alignments=788 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 2dtr 6 :DTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVA T0373 87 :QDGR 2dtr 58 :SDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 2dtr 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLD 2dtr 88 :DIIG T0373 126 :SERALLAAAG 2dtr 96 :KVHDEACRWE T0373 136 :PLLTRLAQFEEP 2dtr 111 :EVERRLVKVLKD Number of specific fragments extracted= 6 number of extra gaps= 0 total=3222 Number of alignments=789 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 2dtr 9 :EMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVV T0373 85 :DPQDG 2dtr 57 :ASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 2dtr 62 :LQMTPTGRTLATAVMRKHRLAERLLT T0373 121 :ACLD 2dtr 88 :DIIG T0373 125 :ESERALLAAAG 2dtr 95 :NKVHDEACRWE T0373 136 :PLLTRLAQFEEP 2dtr 111 :EVERRLVKVLKD Number of specific fragments extracted= 6 number of extra gaps= 0 total=3228 Number of alignments=790 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 39 :VVLGAIDRLGGD 2dtr 10 :MYLRTIYELEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 2dtr 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 2dtr 60 :RSLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLDES 2dtr 86 :LTDIIGLD Number of specific fragments extracted= 4 number of extra gaps= 0 total=3232 Number of alignments=791 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 35 :FSQLVVLGAIDR 2dtr 9 :EMYLRTIYELEE T0373 50 :D 2dtr 21 :E T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2dtr 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 2dtr 61 :SLQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 2dtr 86 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=3237 Number of alignments=792 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 34 :QFSQLVVLGAIDR 2dtr 8 :TEMYLRTIYELEE T0373 48 :GGD 2dtr 21 :EGV T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 2dtr 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRS T0373 94 :VSLSSEGRRNLYGNRAKREEWLVR 2dtr 62 :LQMTPTGRTLATAVMRKHRLAERL T0373 119 :MHACLD 2dtr 86 :LTDIIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=3242 Number of alignments=793 # 2dtr read from 2dtr/merged-local-a2m # found chain 2dtr in template set T0373 36 :SQLVVLGAIDR 2dtr 10 :MYLRTIYELEE T0373 48 :GGD 2dtr 21 :EGV T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 2dtr 25 :PLRARIAERLEQSGPTVSQTVARMERDGLVVVASDR T0373 93 :RVSLSSEGRRNLYGNRAKR 2dtr 61 :SLQMTPTGRTLATAVMRKH T0373 112 :EEWLVR 2dtr 98 :HDEACR T0373 119 :MHACLDES 2dtr 104 :WEHVMSDE T0373 130 :LLAAAGP 2dtr 112 :VERRLVK Number of specific fragments extracted= 7 number of extra gaps= 0 total=3249 Number of alignments=794 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z1dA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z1dA expands to /projects/compbio/data/pdb/1z1d.pdb.gz 1z1dA:# T0373 read from 1z1dA/merged-local-a2m # 1z1dA read from 1z1dA/merged-local-a2m # adding 1z1dA to template set # found chain 1z1dA in template set T0373 37 :QLVVLGAIDRLGGD 1z1dA 209 :QNQVLNLIKACPRP Number of specific fragments extracted= 1 number of extra gaps= 0 total=3250 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set T0373 35 :FSQLVVLGAIDRLGGD 1z1dA 207 :VAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLI 1z1dA 236 :HMSVSSIKQAVDFLSNEGHI Number of specific fragments extracted= 3 number of extra gaps= 0 total=3253 Number of alignments=795 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAER 1z1dA 225 :LNFQDLKNQLK T0373 62 :MRSSNLAALLRELERGGLI 1z1dA 237 :MSVSSIKQAVDFLSNEGHI Number of specific fragments extracted= 3 number of extra gaps= 0 total=3256 Number of alignments=796 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set T0373 35 :FSQLVVLGAIDRLGGD 1z1dA 207 :VAQNQVLNLIKACPRP T0373 51 :VTPSELAAAER 1z1dA 225 :LNFQDLKNQLK T0373 62 :MRSSNLAALLRELERGGLIVRHAD 1z1dA 237 :MSVSSIKQAVDFLSNEGHIYSTVD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3259 Number of alignments=797 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP Number of specific fragments extracted= 1 number of extra gaps= 0 total=3260 Number of alignments=798 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set T0373 33 :VQFSQLVVLGAIDRLGGD 1z1dA 205 :LTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVR 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYS Number of specific fragments extracted= 3 number of extra gaps= 0 total=3263 Number of alignments=799 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3266 Number of alignments=800 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQD 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=3269 Number of alignments=801 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3272 Number of alignments=802 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADP 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3275 Number of alignments=803 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3278 Number of alignments=804 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQD 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=3281 Number of alignments=805 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3284 Number of alignments=806 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRL 1z1dA 203 :NGLTVAQNQVLNLIKAC T0373 48 :GGDVTPSELAAAE 1z1dA 222 :PEGLNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD T0373 93 :RVS 1z1dA 263 :HFK Number of specific fragments extracted= 4 number of extra gaps= 0 total=3288 Number of alignments=807 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3291 Number of alignments=808 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3294 Number of alignments=809 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDR 1z1dA 203 :NGLTVAQNQVLNLIKA T0373 47 :LGGDVTPSELAAAE 1z1dA 221 :RPEGLNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQD 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDDH Number of specific fragments extracted= 3 number of extra gaps= 0 total=3297 Number of alignments=810 # 1z1dA read from 1z1dA/merged-local-a2m # found chain 1z1dA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1z1dA)A202 T0373 31 :DPVQFSQLVVLGAIDRLGGD 1z1dA 203 :NGLTVAQNQVLNLIKACPRP T0373 51 :VTPSELAAAE 1z1dA 225 :LNFQDLKNQL T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1z1dA 236 :HMSVSSIKQAVDFLSNEGHIYSTVDDD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3300 Number of alignments=811 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b1bA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b1bA expands to /projects/compbio/data/pdb/1b1b.pdb.gz 1b1bA:# T0373 read from 1b1bA/merged-local-a2m # 1b1bA read from 1b1bA/merged-local-a2m # adding 1b1bA to template set # found chain 1b1bA in template set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1b1bA 6 :DTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH T0373 94 :VSLSSEGRR 1b1bA 62 :LELTEKGRA Number of specific fragments extracted= 2 number of extra gaps= 0 total=3302 Number of alignments=812 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 32 :PVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1b1bA 6 :DTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRH T0373 94 :VSLSSEGRRNLYGNRA 1b1bA 62 :LELTEKGRALAIAVMR Number of specific fragments extracted= 2 number of extra gaps= 0 total=3304 Number of alignments=813 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 38 :LVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1b1bA 12 :LRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDR T0373 87 :QDGRRTRVSLSSEG 1b1bA 65 :TEKGRALAIAVMRK Number of specific fragments extracted= 2 number of extra gaps= 0 total=3306 Number of alignments=814 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 31 :DPVQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1b1bA 5 :VDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1b1bA 60 :RHLELTEKGRALAIAVMRKHRL T0373 115 :LVRAMHACLD 1b1bA 82 :AERLLVDVIG Number of specific fragments extracted= 3 number of extra gaps= 0 total=3309 Number of alignments=815 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 37 :QLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1b1bA 11 :YLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREE 1b1bA 60 :RHLELTEKGRALAIAVMRKHRL T0373 115 :LVRAMHACLD 1b1bA 82 :AERLLVDVIG Number of specific fragments extracted= 3 number of extra gaps= 0 total=3312 Number of alignments=816 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1b1bA 9 :EMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVA T0373 87 :QDGR 1b1bA 58 :GDRH T0373 94 :VSLSSEGRRNLYGNRAKRE 1b1bA 62 :LELTEKGRALAIAVMRKHR T0373 114 :WLVRAMHACLD 1b1bA 81 :LAERLLVDVIG T0373 125 :ESERALLAAA 1b1bA 95 :EEVHAEACRW T0373 136 :PLLTRLAQFEEP 1b1bA 111 :DVERRLVKVLNN Number of specific fragments extracted= 6 number of extra gaps= 0 total=3318 Number of alignments=817 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1b1bA 9 :EMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVA T0373 87 :QDGR 1b1bA 58 :GDRH T0373 94 :VSLSSEGRRNLYGNRAKRE 1b1bA 62 :LELTEKGRALAIAVMRKHR T0373 114 :WLVRAMHAC 1b1bA 81 :LAERLLVDV T0373 125 :ESERALLAAA 1b1bA 95 :EEVHAEACRW T0373 136 :PLLTRLAQFEEP 1b1bA 111 :DVERRLVKVLNN Number of specific fragments extracted= 6 number of extra gaps= 0 total=3324 Number of alignments=818 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHAD 1b1bA 30 :IAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVRAM 1b1bA 60 :RHLELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLD 1b1bA 88 :DVIG Number of specific fragments extracted= 3 number of extra gaps= 0 total=3327 Number of alignments=819 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 34 :QFSQLVVLGAIDR 1b1bA 8 :TEMYLRTIYDLEE T0373 48 :GG 1b1bA 21 :EG T0373 50 :DVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1b1bA 24 :TPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVRAM 1b1bA 60 :RHLELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLDESERAL 1b1bA 88 :DVIGLPWEEV Number of specific fragments extracted= 5 number of extra gaps= 0 total=3332 Number of alignments=820 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 33 :VQFSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1b1bA 7 :TTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRV T0373 86 :PQDGR 1b1bA 57 :AGDRH T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1b1bA 62 :LELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLD 1b1bA 88 :DVIG T0373 125 :ESERALLAAAG 1b1bA 95 :EEVHAEACRWE T0373 136 :PLLTRLAQFEEP 1b1bA 111 :DVERRLVKVLNN Number of specific fragments extracted= 6 number of extra gaps= 0 total=3338 Number of alignments=821 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 35 :FSQLVVLGAIDRLGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1b1bA 9 :EMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVA T0373 87 :QDGR 1b1bA 58 :GDRH T0373 94 :VSLSSEGRRNLYGNRAKREEWLVRAM 1b1bA 62 :LELTEKGRALAIAVMRKHRLAERLLV T0373 121 :ACLD 1b1bA 88 :DVIG T0373 125 :ESERALLAAA 1b1bA 95 :EEVHAEACRW T0373 136 :PLLTRLAQFEEP 1b1bA 111 :DVERRLVKVLNN Number of specific fragments extracted= 6 number of extra gaps= 0 total=3344 Number of alignments=822 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 39 :VVLGAIDRLGGD 1b1bA 10 :MYLRTIYDLEEE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1b1bA 25 :PLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1b1bA 60 :RHLELTEKGRALAIAVMRKHRLAERL T0373 119 :MHACLD 1b1bA 86 :LVDVIG Number of specific fragments extracted= 4 number of extra gaps= 0 total=3348 Number of alignments=823 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 37 :QLVVLGAIDR 1b1bA 11 :YLRTIYDLEE T0373 50 :D 1b1bA 21 :E T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1b1bA 25 :PLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGD T0373 92 :TRVSLSSEGRRNLYGNRAKREEWLVR 1b1bA 60 :RHLELTEKGRALAIAVMRKHRLAERL T0373 119 :MHACLD 1b1bA 86 :LVDVIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=3353 Number of alignments=824 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 34 :QFSQLVVLGAIDR 1b1bA 8 :TEMYLRTIYDLEE T0373 48 :GG 1b1bA 21 :EG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADP 1b1bA 25 :PLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDR T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1b1bA 61 :HLELTEKGRALAIAVMRKHRLAERL T0373 119 :MHACLD 1b1bA 86 :LVDVIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=3358 Number of alignments=825 # 1b1bA read from 1b1bA/merged-local-a2m # found chain 1b1bA in template set T0373 37 :QLVVLGAIDR 1b1bA 8 :TEMYLRTIYD T0373 47 :LGGD 1b1bA 20 :EEGV T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRH 1b1bA 25 :PLRARIAERLDQSGPTVSQTVSRMERDGLLRVA T0373 87 :QDG 1b1bA 58 :GDR T0373 93 :RVSLSSEGRRNLYGNRAKR 1b1bA 61 :HLELTEKGRALAIAVMRKH T0373 112 :EEWLVR 1b1bA 98 :HAEACR T0373 119 :MHACLDES 1b1bA 104 :WEHVMSED T0373 130 :LLAAAGP 1b1bA 112 :VERRLVK Number of specific fragments extracted= 8 number of extra gaps= 0 total=3366 Number of alignments=826 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r1uA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1r1uA expands to /projects/compbio/data/pdb/1r1u.pdb.gz 1r1uA:# T0373 read from 1r1uA/merged-local-a2m # 1r1uA read from 1r1uA/merged-local-a2m # adding 1r1uA to template set # found chain 1r1uA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1uA 37 :VSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKR T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1uA 74 :QGQSMIYSLDDIHVATMLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=3368 Number of alignments=827 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 38 :LVVLGA 1r1uA 32 :MELLSV T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1uA 38 :SEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKR T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1uA 74 :QGQSMIYSLDDIHVATMLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=3371 Number of alignments=828 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1uA 36 :SVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKR T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1uA 74 :QGQSMIYSLDDIHVATMLK Number of specific fragments extracted= 2 number of extra gaps= 0 total=3373 Number of alignments=829 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 41 :LGAI 1r1uA 32 :MELL T0373 47 :LGGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1uA 36 :SVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKR T0373 88 :DGRRTRVSLSSEGRRNLYG 1r1uA 74 :QGQSMIYSLDDIHVATMLK Number of specific fragments extracted= 3 number of extra gaps= 0 total=3376 Number of alignments=830 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1r1uA 37 :VSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=3377 Number of alignments=831 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 36 :SQLVVLG 1r1uA 30 :RIMELLS T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1r1uA 37 :VSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAK T0373 87 :QDGRRTRVSLSSEGRRNLY 1r1uA 73 :RQGQSMIYSLDDIHVATML Number of specific fragments extracted= 3 number of extra gaps= 0 total=3380 Number of alignments=832 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 48 :GG 1r1uA 38 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1uA 40 :ASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKR Number of specific fragments extracted= 3 number of extra gaps= 0 total=3383 Number of alignments=833 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 26 :REAQADP 1r1uA 18 :EIFKALG T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 48 :GG 1r1uA 38 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1uA 40 :ASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKR Number of specific fragments extracted= 4 number of extra gaps= 0 total=3387 Number of alignments=834 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 24 :LRREAQADP 1r1uA 16 :VTEIFKALG T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 48 :GG 1r1uA 38 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1r1uA 40 :ASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ T0373 91 :RTRVSLSSE 1r1uA 77 :SMIYSLDDI T0373 102 :RNLYGNRAKRE 1r1uA 86 :HVATMLKQAIH Number of specific fragments extracted= 6 number of extra gaps= 0 total=3393 Number of alignments=835 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 19 :TLTRRLRREAQ 1r1uA 14 :ERVTEIFKALG T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 48 :GG 1r1uA 38 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1r1uA 40 :ASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ T0373 91 :RTRVSLSS 1r1uA 77 :SMIYSLDD T0373 99 :EGRRNLYGNRAK 1r1uA 86 :HVATMLKQAIHH Number of specific fragments extracted= 6 number of extra gaps= 0 total=3399 Number of alignments=836 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set Warning: unaligning (T0373)V17 because first residue in template chain is (1r1uA)N9 T0373 18 :TTLTRRLRREAQADP 1r1uA 10 :TDTLERVTEIFKALG T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 48 :GG 1r1uA 38 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1r1uA 40 :ASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKR Number of specific fragments extracted= 4 number of extra gaps= 0 total=3403 Number of alignments=837 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 21 :TRRLRREAQADP 1r1uA 13 :LERVTEIFKALG T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 48 :GG 1r1uA 38 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1r1uA 40 :ASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=3407 Number of alignments=838 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 21 :TRRLRREAQADP 1r1uA 13 :LERVTEIFKALG T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 48 :GG 1r1uA 38 :SE T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1r1uA 40 :ASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ T0373 91 :RTRVSLSSEGR 1r1uA 77 :SMIYSLDDIHV T0373 102 :RNLYGNRAK 1r1uA 89 :TMLKQAIHH Number of specific fragments extracted= 6 number of extra gaps= 0 total=3413 Number of alignments=839 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 18 :TTLTRRLRREAQA 1r1uA 13 :LERVTEIFKALGD T0373 35 :FSQLVVLGAIDR 1r1uA 26 :YNRIRIMELLSV T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1r1uA 38 :SEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ T0373 91 :RTRVSLSS 1r1uA 77 :SMIYSLDD T0373 99 :EGRRNLYGNRA 1r1uA 86 :HVATMLKQAIH T0373 117 :R 1r1uA 97 :H Number of specific fragments extracted= 6 number of extra gaps= 0 total=3419 Number of alignments=840 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLI 1r1uA 38 :SEASVGHISHQLNLSQSNVSHQLKLLKSVHLV Number of specific fragments extracted= 2 number of extra gaps= 0 total=3421 Number of alignments=841 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 35 :FSQLVVLGAIDR 1r1uA 26 :YNRIRIMELLSV T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVR 1r1uA 38 :SEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKA Number of specific fragments extracted= 2 number of extra gaps= 0 total=3423 Number of alignments=842 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 21 :TRRLRREAQADP 1r1uA 13 :LERVTEIFKALG T0373 34 :QFSQLVVLGAIDR 1r1uA 25 :DYNRIRIMELLSV T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 1r1uA 38 :SEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQS T0373 92 :TRVSLSSE 1r1uA 78 :MIYSLDDI T0373 106 :GNRAKREEWLV 1r1uA 86 :HVATMLKQAIH Number of specific fragments extracted= 5 number of extra gaps= 0 total=3428 Number of alignments=843 # 1r1uA read from 1r1uA/merged-local-a2m # found chain 1r1uA in template set T0373 22 :RRLRREAQADPVQFSQLVVLGAIDR 1r1uA 13 :LERVTEIFKALGDYNRIRIMELLSV T0373 49 :GDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1r1uA 38 :SEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQ T0373 91 :RTRVSLSSE 1r1uA 77 :SMIYSLDDI T0373 106 :GNRAKREEWLVR 1r1uA 86 :HVATMLKQAIHH T0373 119 :M 1r1uA 98 :A Number of specific fragments extracted= 5 number of extra gaps= 0 total=3433 Number of alignments=844 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sfxA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0373 read from 1sfxA/merged-local-a2m # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 40 :VLGAIDR 1sfxA 24 :IYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREI T0373 86 :PQDGR 1sfxA 68 :VEKGW Number of specific fragments extracted= 3 number of extra gaps= 0 total=3436 Number of alignments=845 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 38 :LVVLGAIDR 1sfxA 22 :VRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHA 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREI T0373 86 :PQDGRR 1sfxA 68 :VEKGWV Number of specific fragments extracted= 3 number of extra gaps= 0 total=3439 Number of alignments=846 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIV T0373 88 :DGRRTRVSLSSEGRRNLYGNRAKREEWLVRAMHACLDE 1sfxA 69 :EKGWVGYIYSAEKPEKVLKEFKSSILGEIERIEKMFTD Number of specific fragments extracted= 2 number of extra gaps= 0 total=3441 Number of alignments=847 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 40 :VLGAIDR 1sfxA 24 :IYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIV T0373 88 :DGRRTRVSLSSEGRRNLYGNR 1sfxA 69 :EKGWVGYIYSAEKPEKVLKEF Number of specific fragments extracted= 3 number of extra gaps= 0 total=3444 Number of alignments=848 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set Warning: unaligning (T0373)Q16 because first residue in template chain is (1sfxA)H0 T0373 17 :VTTLTRRLRREAQADPVQFSQLVVLGAIDR 1sfxA 1 :MSNPLGELVKALEKLSFKPSDVRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRR 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVG T0373 93 :RVSLSSEGRRNLYGNRAKREEWL 1sfxA 75 :YIYSAEKPEKVLKEFKSSILGEI Number of specific fragments extracted= 3 number of extra gaps= 0 total=3447 Number of alignments=849 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 24 :LRREAQADPVQFSQLVVLGAIDR 1sfxA 8 :LVKALEKLSFKPSDVRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRR 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVG T0373 93 :RVSLSSEGRRNLYGNRAKREEWL 1sfxA 75 :YIYSAEKPEKVLKEFKSSILGEI Number of specific fragments extracted= 3 number of extra gaps= 0 total=3450 Number of alignments=850 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 26 :REAQADPVQFSQLVVLGAIDRLGG 1sfxA 10 :KALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEK T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 1sfxA 71 :GWVGYIYSAEKPEKVLKEFKSSILG T0373 115 :LVRAMHACLDES 1sfxA 96 :EIERIEKMFTDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=3454 Number of alignments=851 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 26 :REAQADPVQFSQLVVLGAIDRLGG 1sfxA 10 :KALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEK T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 1sfxA 71 :GWVGYIYSAEKPEKVLKEFKSSILG T0373 115 :LVRAMHACLDE 1sfxA 96 :EIERIEKMFTD Number of specific fragments extracted= 4 number of extra gaps= 0 total=3458 Number of alignments=852 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 2 :PTNQDLQ 1sfxA 1 :MSNPLGE T0373 24 :LRREAQADPVQFSQLVVLGAIDRLGG 1sfxA 8 :LVKALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEK T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREE 1sfxA 71 :GWVGYIYSAEKPEKVLKEFKSSILG T0373 115 :LVRAMHACLD 1sfxA 96 :EIERIEKMFT Number of specific fragments extracted= 5 number of extra gaps= 0 total=3463 Number of alignments=853 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 2 :PTNQDLQL 1sfxA 1 :MSNPLGEL T0373 25 :RREAQADPVQFSQLVVLGAIDRLGG 1sfxA 9 :VKALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSE 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKP T0373 102 :RNLYGNRAKREEWLVRAMHACLD 1sfxA 83 :EKVLKEFKSSILGEIERIEKMFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=3467 Number of alignments=854 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 26 :REAQADPVQFSQLVVLGAIDRLGG 1sfxA 10 :KALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEK T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1sfxA 71 :GWVGYIYSAEKPEKVLKEFKSSILGEIERIE T0373 121 :ACLDES 1sfxA 102 :KMFTDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=3471 Number of alignments=855 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 24 :LRREAQADPVQFSQLVVLGAIDRLGG 1sfxA 8 :LVKALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQ 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEK T0373 89 :GRRTRVSLSSEGRRNLYGNRAKREEWLVRAM 1sfxA 71 :GWVGYIYSAEKPEKVLKEFKSSILGEIERIE T0373 121 :ACLDE 1sfxA 102 :KMFTD Number of specific fragments extracted= 4 number of extra gaps= 0 total=3475 Number of alignments=856 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 2 :PTNQDLQL 1sfxA 1 :MSNPLGEL T0373 25 :RREAQADPVQFSQLVVLGAIDRLGG 1sfxA 9 :VKALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDG 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGW T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLVRAM 1sfxA 73 :VGYIYSAEKPEKVLKEFKSSILGEIERIE T0373 121 :ACLD 1sfxA 102 :KMFT Number of specific fragments extracted= 5 number of extra gaps= 0 total=3480 Number of alignments=857 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 1 :MPTNQDLQLA 1sfxA 0 :HMSNPLGELV T0373 26 :REAQADPVQFSQLVVLGAIDRLGG 1sfxA 10 :KALEKLSFKPSDVRIYSLLLERGG T0373 51 :VTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSE 1sfxA 34 :MRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKP T0373 102 :RNLYGNRAKREEWLVRAMHACLD 1sfxA 83 :EKVLKEFKSSILGEIERIEKMFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=3484 Number of alignments=858 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 26 :REAQADPVQFSQLVVLGAIDR 1sfxA 10 :KALEKLSFKPSDVRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRH 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRRE Number of specific fragments extracted= 2 number of extra gaps= 0 total=3486 Number of alignments=859 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 25 :RREAQADPVQFSQLVVLGAIDR 1sfxA 9 :VKALEKLSFKPSDVRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKG T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVR 1sfxA 72 :WVGYIYSAEKPEKVLKEFKSSILGEIER T0373 119 :MHA 1sfxA 100 :IEK Number of specific fragments extracted= 4 number of extra gaps= 0 total=3490 Number of alignments=860 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 22 :RRLRREAQADPVQFSQLVVLGAIDR 1sfxA 6 :GELVKALEKLSFKPSDVRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQD 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKG T0373 90 :RRTRVSLSSEGRRNLYGNRAKREEWLVR 1sfxA 72 :WVGYIYSAEKPEKVLKEFKSSILGEIER T0373 119 :MHACLDE 1sfxA 100 :IEKMFTD Number of specific fragments extracted= 4 number of extra gaps= 0 total=3494 Number of alignments=861 # 1sfxA read from 1sfxA/merged-local-a2m # found chain 1sfxA in training set T0373 22 :RRLRREAQADPVQFSQLVVLGAIDR 1sfxA 6 :GELVKALEKLSFKPSDVRIYSLLLE T0373 48 :GGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHADPQDGRRTRVSLSSE 1sfxA 31 :RGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGWVGYIYSAEKP T0373 102 :RNLYGNRAKREEWLVRAMHACLDE 1sfxA 83 :EKVLKEFKSSILGEIERIEKMFTD Number of specific fragments extracted= 3 number of extra gaps= 0 total=3497 Number of alignments=862 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tbxA/merged-local-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tbxA expands to /projects/compbio/data/pdb/1tbx.pdb.gz 1tbxA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0373 read from 1tbxA/merged-local-a2m # 1tbxA read from 1tbxA/merged-local-a2m # adding 1tbxA to template set # found chain 1tbxA in template set T0373 99 :EGRRNLY 1tbxA 62 :RGEKRLY Number of specific fragments extracted= 1 number of extra gaps= 0 total=3498 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 38 :LVVLGAIDRLGGDVTPSE 1tbxA 11 :AIVLAYLYDNEGIATYDL T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHAD 1tbxA 32 :VNAEFPMSTATFYDAKKFLIQEGFVKERQE T0373 88 :DG 1tbxA 62 :RG T0373 91 :RTRVSLSSEGRR 1tbxA 64 :EKRLYLTEKGKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=3502 Number of alignments=863 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 99 :EGRRNLY 1tbxA 62 :RGEKRLY Number of specific fragments extracted= 1 number of extra gaps= 0 total=3503 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 38 :LVVLGAIDRLGGDVTPSE 1tbxA 11 :AIVLAYLYDNEGIATYDL T0373 56 :LAAAERMRSSNLAALLRELERGGLIVRHAD 1tbxA 32 :VNAEFPMSTATFYDAKKFLIQEGFVKERQE T0373 88 :DG 1tbxA 62 :RG T0373 91 :RTRVSLSSEGRR 1tbxA 64 :EKRLYLTEKGKL Number of specific fragments extracted= 4 number of extra gaps= 0 total=3507 Number of alignments=864 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 61 :RMRSSNLAALLRELERGGLIVRHADPQ 1tbxA 37 :PMSTATFYDAKKFLIQEGFVKERQERG T0373 91 :RTRVSLSSEGR 1tbxA 64 :EKRLYLTEKGK Number of specific fragments extracted= 2 number of extra gaps= 0 total=3509 Number of alignments=865 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 58 :AAERMRSSNLAALLRELERGGLIVRHADPQ 1tbxA 34 :AEFPMSTATFYDAKKFLIQEGFVKERQERG T0373 91 :RTRVSLSSEGR 1tbxA 64 :EKRLYLTEKGK Number of specific fragments extracted= 2 number of extra gaps= 0 total=3511 Number of alignments=866 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 35 :FSQLVVLGAIDRLGG 1tbxA 8 :YPEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGR 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERGEKR T0373 94 :VSLSSEGR 1tbxA 67 :LYLTEKGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=3515 Number of alignments=867 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tbxA)F6 T0373 34 :QFSQLVVLGAIDRLGG 1tbxA 7 :FYPEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERG T0373 91 :RTRVSLSSEGRRNLYG 1tbxA 64 :EKRLYLTEKGKLFAIS Number of specific fragments extracted= 4 number of extra gaps= 1 total=3519 Number of alignments=868 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1tbxA)S3 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tbxA)F6 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tbxA)F6 T0373 31 :D 1tbxA 4 :T T0373 34 :QFSQLVVLGAIDRLGG 1tbxA 7 :FYPEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERG T0373 91 :RTRVSLSSEGRRNLYGNRAKREE 1tbxA 64 :EKRLYLTEKGKLFAISLKTAIET T0373 115 :LVRA 1tbxA 87 :YKQI Number of specific fragments extracted= 6 number of extra gaps= 1 total=3525 Number of alignments=869 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 36 :SQLVVLGAIDRLGG 1tbxA 9 :PEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERG T0373 91 :RTRVSLSSEGRRNLYGNRAKREE 1tbxA 64 :EKRLYLTEKGKLFAISLKTAIET T0373 115 :LVRAMHA 1tbxA 87 :YKQIKKR Number of specific fragments extracted= 5 number of extra gaps= 0 total=3530 Number of alignments=870 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 35 :FSQLVVLGAIDRLGG 1tbxA 8 :YPEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGR 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERGEKR T0373 94 :VSLSSEGR 1tbxA 67 :LYLTEKGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=3534 Number of alignments=871 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tbxA)F6 T0373 34 :QFSQLVVLGAIDRLGG 1tbxA 7 :FYPEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGR 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERGEKR T0373 94 :VSLSSEGRRNLYGNR 1tbxA 67 :LYLTEKGKLFAISLK Number of specific fragments extracted= 4 number of extra gaps= 1 total=3538 Number of alignments=872 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set Warning: unaligning (T0373)A30 because first residue in template chain is (1tbxA)S3 Warning: unaligning (T0373)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tbxA)F6 Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tbxA)F6 T0373 31 :D 1tbxA 4 :T T0373 34 :QFSQLVVLGAIDRLGG 1tbxA 7 :FYPEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERG T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLVR 1tbxA 64 :EKRLYLTEKGKLFAISLKTAIETYKQI Number of specific fragments extracted= 5 number of extra gaps= 1 total=3543 Number of alignments=873 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 36 :SQLVVLGAIDRLGG 1tbxA 9 :PEAIVLAYLYDNEG T0373 51 :VTPSELAAAER 1tbxA 23 :IATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQ 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERG T0373 91 :RTRVSLSSEGRRNLYGNRAKREEWLVRAM 1tbxA 64 :EKRLYLTEKGKLFAISLKTAIETYKQIKK T0373 121 :A 1tbxA 93 :R Number of specific fragments extracted= 5 number of extra gaps= 0 total=3548 Number of alignments=874 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 35 :FSQLVVLGAIDR 1tbxA 8 :YPEAIVLAYLYD T0373 48 :GGDVTPSELAAAER 1tbxA 20 :NEGIATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGR 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERGEKR T0373 94 :VSLSSEGR 1tbxA 67 :LYLTEKGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=3552 Number of alignments=875 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set Warning: unaligning (T0373)V33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tbxA)F6 T0373 34 :QFSQLVVLGAIDR 1tbxA 7 :FYPEAIVLAYLYD T0373 48 :GGDVTPSELAAAER 1tbxA 20 :NEGIATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGR 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERGEKR T0373 94 :VSLSSEGRRNL 1tbxA 67 :LYLTEKGKLFA Number of specific fragments extracted= 4 number of extra gaps= 1 total=3556 Number of alignments=876 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 35 :FSQLVVLGAIDR 1tbxA 8 :YPEAIVLAYLYD T0373 48 :GGDVTPSELAAAER 1tbxA 20 :NEGIATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDGR 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERGEKR T0373 94 :VSLSSEGRRNLYGNRAKREEWLVR 1tbxA 67 :LYLTEKGKLFAISLKTAIETYKQI T0373 119 :M 1tbxA 91 :K Number of specific fragments extracted= 5 number of extra gaps= 0 total=3561 Number of alignments=877 # 1tbxA read from 1tbxA/merged-local-a2m # found chain 1tbxA in template set T0373 36 :SQLVVLGAIDR 1tbxA 9 :PEAIVLAYLYD T0373 48 :GGDVTPSELAAAER 1tbxA 20 :NEGIATYDLYKKVN T0373 62 :MRSSNLAALLRELERGGLIVRHADPQDG 1tbxA 38 :MSTATFYDAKKFLIQEGFVKERQERGEK T0373 93 :RVSLSSEGRRNLYGNRAKREEWLVR 1tbxA 66 :RLYLTEKGKLFAISLKTAIETYKQI T0373 119 :MHACL 1tbxA 91 :KKRHH Number of specific fragments extracted= 5 number of extra gaps= 0 total=3566 Number of alignments=878 # command:NUMB_ALIGNS: 878 evalue: 0 0.0000, weight 41.9690 evalue: 1 0.0000, weight 40.5950 evalue: 2 0.0000, weight 40.3018 evalue: 3 0.0000, weight 39.2730 evalue: 4 0.0000, weight 37.4072 evalue: 5 0.0000, weight 34.7076 evalue: 6 0.0000, weight 25.6032 evalue: 7 0.0000, weight 25.3856 evalue: 8 0.0000, weight 18.3234 evalue: 9 0.0000, weight 15.4130 evalue: 10 0.0000, weight 52.0090 evalue: 11 0.0000, weight 48.7676 evalue: 12 0.0000, weight 48.1359 evalue: 13 0.0000, weight 46.6673 evalue: 14 0.0000, weight 44.9772 evalue: 15 0.0000, weight 44.6763 evalue: 16 0.0000, weight 33.2471 evalue: 17 0.0000, weight 29.6481 evalue: 18 0.0000, weight 24.6152 evalue: 19 0.0000, weight 24.0015 evalue: 20 0.0000, weight 40.9886 evalue: 21 0.0000, weight 39.3451 evalue: 22 0.0000, weight 38.6865 evalue: 23 0.0000, weight 38.4347 evalue: 24 0.0000, weight 36.7005 evalue: 25 0.0000, weight 33.3157 evalue: 26 0.0000, weight 24.2293 evalue: 27 0.0000, weight 22.6164 evalue: 28 0.0000, weight 18.7691 evalue: 29 0.0000, weight 16.4393 evalue: 30 0.0000, weight 44.4862 evalue: 31 0.0000, weight 42.3849 evalue: 32 0.0000, weight 42.0541 evalue: 33 0.0000, weight 41.1679 evalue: 34 0.0000, weight 39.3149 evalue: 35 0.0000, weight 37.0801 evalue: 36 0.0000, weight 26.8407 evalue: 37 0.0000, weight 26.2300 evalue: 38 0.0000, weight 20.2221 evalue: 39 0.0000, weight 17.8400 evalue: 40 0.0000, weight 11.7886 evalue: 41 0.0000, weight 11.7886 evalue: 42 0.0000, weight 11.7886 evalue: 43 0.0000, weight 11.7886 evalue: 44 0.0000, weight 11.7886 evalue: 45 0.0000, weight 11.7886 evalue: 46 0.0000, weight 11.7886 evalue: 47 0.0000, weight 14.3662 evalue: 48 0.0000, weight 14.3662 evalue: 49 0.0000, weight 14.3662 evalue: 50 0.0000, weight 14.3662 evalue: 51 0.0000, weight 14.3662 evalue: 52 0.0000, weight 14.3662 evalue: 53 0.0000, weight 14.3662 evalue: 54 0.0000, weight 14.3662 evalue: 55 0.0000, weight 14.3662 evalue: 56 0.0000, weight 14.3662 evalue: 57 0.0000, weight 14.3662 evalue: 58 0.0000, weight 14.3662 evalue: 59 0.0000, weight 14.3662 evalue: 60 0.0000, weight 14.3662 evalue: 61 0.0000, weight 14.3662 evalue: 62 0.0000, weight 14.3662 evalue: 63 0.0000, weight 14.3662 evalue: 64 0.0000, weight 14.3662 evalue: 65 0.0000, weight 41.1679 evalue: 66 0.0000, weight 41.1679 evalue: 67 0.0000, weight 41.1679 evalue: 68 0.0000, weight 41.1679 evalue: 69 0.0000, weight 41.1679 evalue: 70 0.0000, weight 41.1679 evalue: 71 0.0000, weight 41.1679 evalue: 72 0.0000, weight 41.1679 evalue: 73 0.0000, weight 41.1679 evalue: 74 0.0000, weight 41.1679 evalue: 75 0.0000, weight 41.1679 evalue: 76 0.0000, weight 41.1679 evalue: 77 0.0000, weight 41.1679 evalue: 78 0.0000, weight 41.1679 evalue: 79 0.0000, weight 41.1679 evalue: 80 0.0000, weight 41.1679 evalue: 81 0.0000, weight 41.1679 evalue: 82 0.0000, weight 41.1679 evalue: 83 0.0000, weight 14.6848 evalue: 84 0.0000, weight 14.6848 evalue: 85 0.0000, weight 14.6848 evalue: 86 0.0000, weight 14.6848 evalue: 87 0.0000, weight 14.6848 evalue: 88 0.0000, weight 14.6848 evalue: 89 0.0000, weight 14.6848 evalue: 90 0.0000, weight 14.6848 evalue: 91 0.0000, weight 14.6848 evalue: 92 0.0000, weight 14.6848 evalue: 93 0.0000, weight 14.6848 evalue: 94 0.0000, weight 14.6848 evalue: 95 0.0000, weight 14.6848 evalue: 96 0.0000, weight 14.6848 evalue: 97 0.0000, weight 14.6848 evalue: 98 0.0000, weight 14.6848 evalue: 99 0.0000, weight 14.6848 evalue: 100 0.0000, weight 14.6848 evalue: 101 0.0003, weight 8.7782 evalue: 102 0.0003, weight 8.7782 evalue: 103 0.0003, weight 8.7782 evalue: 104 0.0003, weight 8.7782 evalue: 105 0.0003, weight 8.7782 evalue: 106 0.0003, weight 8.7782 evalue: 107 0.0003, weight 8.7782 evalue: 108 0.0003, weight 8.7782 evalue: 109 0.0003, weight 8.7782 evalue: 110 0.0003, weight 8.7782 evalue: 111 0.0003, weight 8.7782 evalue: 112 0.0003, weight 8.7782 evalue: 113 0.0003, weight 8.7782 evalue: 114 0.0003, weight 8.7782 evalue: 115 0.0003, weight 8.7782 evalue: 116 0.0003, weight 8.7782 evalue: 117 0.0003, weight 8.7782 evalue: 118 0.0003, weight 8.7782 evalue: 119 0.0000, weight 11.6775 evalue: 120 0.0000, weight 11.6775 evalue: 121 0.0000, weight 11.6775 evalue: 122 0.0000, weight 11.6775 evalue: 123 0.0000, weight 11.6775 evalue: 124 0.0000, weight 11.6775 evalue: 125 0.0000, weight 11.6775 evalue: 126 0.0000, weight 11.6775 evalue: 127 0.0000, weight 11.6775 evalue: 128 0.0000, weight 11.6775 evalue: 129 0.0000, weight 11.6775 evalue: 130 0.0000, weight 11.6775 evalue: 131 0.0200, weight 4.4643 evalue: 132 0.0200, weight 4.4643 evalue: 133 0.0200, weight 4.4643 evalue: 134 0.0200, weight 4.4643 evalue: 135 0.0200, weight 4.4643 evalue: 136 0.0200, weight 4.4643 evalue: 137 0.0200, weight 4.4643 evalue: 138 0.0200, weight 4.4643 evalue: 139 0.0200, weight 4.4643 evalue: 140 0.0200, weight 4.4643 evalue: 141 0.0200, weight 4.4643 evalue: 142 0.0200, weight 4.4643 evalue: 143 0.0200, weight 4.4643 evalue: 144 0.0200, weight 4.4643 evalue: 145 0.0200, weight 4.4643 evalue: 146 0.0000, weight 42.0541 evalue: 147 0.0000, weight 42.0541 evalue: 148 0.0000, weight 42.0541 evalue: 149 0.0000, weight 42.0541 evalue: 150 0.0000, weight 42.0541 evalue: 151 0.0000, weight 42.0541 evalue: 152 0.0000, weight 42.0541 evalue: 153 0.0000, weight 42.0541 evalue: 154 0.0000, weight 42.0541 evalue: 155 0.0000, weight 42.0541 evalue: 156 0.0000, weight 42.0541 evalue: 157 0.0000, weight 42.0541 evalue: 158 0.0000, weight 42.0541 evalue: 159 0.0000, weight 42.0541 evalue: 160 0.0000, weight 42.0541 evalue: 161 0.0000, weight 42.0541 evalue: 162 0.0000, weight 42.0541 evalue: 163 0.0000, weight 42.0541 evalue: 164 0.0000, weight 16.6507 evalue: 165 0.0000, weight 16.6507 evalue: 166 0.0000, weight 16.6507 evalue: 167 0.0000, weight 16.6507 evalue: 168 0.0000, weight 16.6507 evalue: 169 0.0000, weight 16.6507 evalue: 170 0.0000, weight 16.6507 evalue: 171 0.0000, weight 16.6507 evalue: 172 0.0000, weight 16.6507 evalue: 173 0.0000, weight 16.6507 evalue: 174 0.0000, weight 16.6507 evalue: 175 0.0000, weight 16.6507 evalue: 176 0.0000, weight 16.6507 evalue: 177 0.0000, weight 16.6507 evalue: 178 0.0000, weight 16.6507 evalue: 179 0.0000, weight 16.6507 evalue: 180 0.0000, weight 16.6507 evalue: 181 0.0000, weight 16.6507 evalue: 182 0.0441, weight 3.6877 evalue: 183 0.0441, weight 3.6877 evalue: 184 0.0441, weight 3.6877 evalue: 185 0.0441, weight 3.6877 evalue: 186 0.0441, weight 3.6877 evalue: 187 0.0441, weight 3.6877 evalue: 188 0.0441, weight 3.6877 evalue: 189 0.0441, weight 3.6877 evalue: 190 0.0441, weight 3.6877 evalue: 191 0.0441, weight 3.6877 evalue: 192 0.0441, weight 3.6877 evalue: 193 0.0441, weight 3.6877 evalue: 194 0.0441, weight 3.6877 evalue: 195 0.0441, weight 3.6877 evalue: 196 0.0441, weight 3.6877 evalue: 197 0.0000, weight 44.4862 evalue: 198 0.0000, weight 44.4862 evalue: 199 0.0000, weight 44.4862 evalue: 200 0.0000, weight 44.4862 evalue: 201 0.0000, weight 44.4862 evalue: 202 0.0000, weight 44.4862 evalue: 203 0.0000, weight 44.4862 evalue: 204 0.0000, weight 44.4862 evalue: 205 0.0000, weight 44.4862 evalue: 206 0.0000, weight 44.4862 evalue: 207 0.0000, weight 44.4862 evalue: 208 0.0000, weight 44.4862 evalue: 209 0.0000, weight 44.4862 evalue: 210 0.0000, weight 44.4862 evalue: 211 0.0000, weight 44.4862 evalue: 212 0.0000, weight 44.4862 evalue: 213 0.0000, weight 44.4862 evalue: 214 0.0000, weight 44.4862 evalue: 215 0.0000, weight 26.9287 evalue: 216 0.0000, weight 26.9287 evalue: 217 0.0000, weight 26.9287 evalue: 218 0.0000, weight 26.9287 evalue: 219 0.0000, weight 26.9287 evalue: 220 0.0000, weight 26.9287 evalue: 221 0.0000, weight 26.9287 evalue: 222 0.0000, weight 26.9287 evalue: 223 0.0000, weight 26.9287 evalue: 224 0.0000, weight 26.9287 evalue: 225 0.0000, weight 26.9287 evalue: 226 0.0000, weight 26.9287 evalue: 227 0.0000, weight 26.9287 evalue: 228 0.0000, weight 26.9287 evalue: 229 0.0000, weight 26.9287 evalue: 230 0.0000, weight 26.9287 evalue: 231 0.0000, weight 20.2221 evalue: 232 0.0000, weight 20.2221 evalue: 233 0.0000, weight 20.2221 evalue: 234 0.0000, weight 20.2221 evalue: 235 0.0000, weight 20.2221 evalue: 236 0.0000, weight 20.2221 evalue: 237 0.0000, weight 20.2221 evalue: 238 0.0000, weight 20.2221 evalue: 239 0.0000, weight 20.2221 evalue: 240 0.0000, weight 20.2221 evalue: 241 0.0000, weight 20.2221 evalue: 242 0.0000, weight 20.2221 evalue: 243 0.0000, weight 20.2221 evalue: 244 0.0000, weight 20.2221 evalue: 245 0.0000, weight 20.2221 evalue: 246 0.0000, weight 20.2221 evalue: 247 0.0000, weight 20.2221 evalue: 248 0.0000, weight 20.2221 evalue: 249 0.0000, weight 12.7606 evalue: 250 0.0000, weight 12.7606 evalue: 251 0.0000, weight 12.7606 evalue: 252 0.0000, weight 12.7606 evalue: 253 0.0000, weight 12.7606 evalue: 254 0.0000, weight 12.7606 evalue: 255 0.0000, weight 12.7606 evalue: 256 0.0000, weight 12.7606 evalue: 257 0.0000, weight 12.7606 evalue: 258 0.0000, weight 12.7606 evalue: 259 0.0000, weight 12.7606 evalue: 260 0.0000, weight 12.7606 evalue: 261 0.0000, weight 12.7606 evalue: 262 0.0000, weight 12.7606 evalue: 263 0.0000, weight 12.7606 evalue: 264 0.0000, weight 12.7606 evalue: 265 0.0000, weight 12.7606 evalue: 266 0.0000, weight 12.7606 evalue: 267 0.0079, weight 5.3900 evalue: 268 0.0079, weight 5.3900 evalue: 269 0.0079, weight 5.3900 evalue: 270 0.0079, weight 5.3900 evalue: 271 0.0079, weight 5.3900 evalue: 272 0.0079, weight 5.3900 evalue: 273 0.0079, weight 5.3900 evalue: 274 0.0079, weight 5.3900 evalue: 275 0.0079, weight 5.3900 evalue: 276 0.0079, weight 5.3900 evalue: 277 0.0079, weight 5.3900 evalue: 278 0.0079, weight 5.3900 evalue: 279 0.0079, weight 5.3900 evalue: 280 0.0079, weight 5.3900 evalue: 281 0.0079, weight 5.3900 evalue: 282 0.0018, weight 6.8418 evalue: 283 0.0018, weight 6.8418 evalue: 284 0.0018, weight 6.8418 evalue: 285 0.0018, weight 6.8418 evalue: 286 0.0018, weight 6.8418 evalue: 287 0.0018, weight 6.8418 evalue: 288 0.0018, weight 6.8418 evalue: 289 0.0018, weight 6.8418 evalue: 290 0.0018, weight 6.8418 evalue: 291 0.0018, weight 6.8418 evalue: 292 0.0018, weight 6.8418 evalue: 293 0.0018, weight 6.8418 evalue: 294 0.0018, weight 6.8418 evalue: 295 0.0018, weight 6.8418 evalue: 296 0.0018, weight 6.8418 evalue: 297 0.0004, weight 8.2483 evalue: 298 0.0004, weight 8.2483 evalue: 299 0.0004, weight 8.2483 evalue: 300 0.0004, weight 8.2483 evalue: 301 0.0004, weight 8.2483 evalue: 302 0.0004, weight 8.2483 evalue: 303 0.0004, weight 8.2483 evalue: 304 0.0004, weight 8.2483 evalue: 305 0.0004, weight 8.2483 evalue: 306 0.0004, weight 8.2483 evalue: 307 0.0004, weight 8.2483 evalue: 308 0.0004, weight 8.2483 evalue: 309 0.0004, weight 8.2483 evalue: 310 0.0004, weight 8.2483 evalue: 311 0.0004, weight 8.2483 evalue: 312 0.0004, weight 8.2483 evalue: 313 0.0000, weight 26.2300 evalue: 314 0.0000, weight 26.2300 evalue: 315 0.0000, weight 26.2300 evalue: 316 0.0000, weight 26.2300 evalue: 317 0.0000, weight 26.2300 evalue: 318 0.0000, weight 26.2300 evalue: 319 0.0000, weight 26.2300 evalue: 320 0.0000, weight 26.2300 evalue: 321 0.0000, weight 26.2300 evalue: 322 0.0000, weight 26.2300 evalue: 323 0.0000, weight 26.2300 evalue: 324 0.0000, weight 26.2300 evalue: 325 0.0000, weight 26.2300 evalue: 326 0.0000, weight 26.2300 evalue: 327 0.0000, weight 26.2300 evalue: 328 0.0000, weight 26.2300 evalue: 329 0.0000, weight 26.2300 evalue: 330 0.0000, weight 26.2300 evalue: 331 0.0018, weight 6.8847 evalue: 332 0.0018, weight 6.8847 evalue: 333 0.0018, weight 6.8847 evalue: 334 0.0018, weight 6.8847 evalue: 335 0.0018, weight 6.8847 evalue: 336 0.0018, weight 6.8847 evalue: 337 0.0018, weight 6.8847 evalue: 338 0.0018, weight 6.8847 evalue: 339 0.0018, weight 6.8847 evalue: 340 0.0018, weight 6.8847 evalue: 341 0.0018, weight 6.8847 evalue: 342 0.0018, weight 6.8847 evalue: 343 0.0018, weight 6.8847 evalue: 344 0.0018, weight 6.8847 evalue: 345 0.0018, weight 6.8847 evalue: 346 0.0018, weight 6.8847 evalue: 347 0.0018, weight 6.8847 evalue: 348 0.0000, weight 13.4504 evalue: 349 0.0000, weight 13.4504 evalue: 350 0.0000, weight 13.4504 evalue: 351 0.0000, weight 13.4504 evalue: 352 0.0000, weight 13.4504 evalue: 353 0.0000, weight 13.4504 evalue: 354 0.0000, weight 13.4504 evalue: 355 0.0000, weight 13.4504 evalue: 356 0.0000, weight 13.4504 evalue: 357 0.0000, weight 13.4504 evalue: 358 0.0000, weight 13.4504 evalue: 359 0.0000, weight 13.4504 evalue: 360 0.0000, weight 13.4504 evalue: 361 0.0000, weight 13.4504 evalue: 362 0.0000, weight 13.4504 evalue: 363 0.0000, weight 13.4504 evalue: 364 0.0000, weight 13.4504 evalue: 365 0.0000, weight 13.4504 evalue: 366 0.0862, weight 3.0418 evalue: 367 0.0862, weight 3.0418 evalue: 368 0.0862, weight 3.0418 evalue: 369 0.0862, weight 3.0418 evalue: 370 0.0862, weight 3.0418 evalue: 371 0.0862, weight 3.0418 evalue: 372 0.0862, weight 3.0418 evalue: 373 0.0862, weight 3.0418 evalue: 374 0.0862, weight 3.0418 evalue: 375 0.0862, weight 3.0418 evalue: 376 0.0862, weight 3.0418 evalue: 377 0.0862, weight 3.0418 evalue: 378 0.0862, weight 3.0418 evalue: 379 0.0862, weight 3.0418 evalue: 380 0.0862, weight 3.0418 evalue: 381 0.0003, weight 8.6268 evalue: 382 0.0003, weight 8.6268 evalue: 383 0.0003, weight 8.6268 evalue: 384 0.0003, weight 8.6268 evalue: 385 0.0003, weight 8.6268 evalue: 386 0.0003, weight 8.6268 evalue: 387 0.0003, weight 8.6268 evalue: 388 0.0003, weight 8.6268 evalue: 389 0.0003, weight 8.6268 evalue: 390 0.0003, weight 8.6268 evalue: 391 0.0003, weight 8.6268 evalue: 392 0.0003, weight 8.6268 evalue: 393 0.0003, weight 8.6268 evalue: 394 0.0003, weight 8.6268 evalue: 395 0.0003, weight 8.6268 evalue: 396 0.0001, weight 9.6406 evalue: 397 0.0001, weight 9.6406 evalue: 398 0.0001, weight 9.6406 evalue: 399 0.0001, weight 9.6406 evalue: 400 0.0001, weight 9.6406 evalue: 401 0.0001, weight 9.6406 evalue: 402 0.0001, weight 9.6406 evalue: 403 0.0001, weight 9.6406 evalue: 404 0.0001, weight 9.6406 evalue: 405 0.0001, weight 9.6406 evalue: 406 0.0001, weight 9.6406 evalue: 407 0.0001, weight 9.6406 evalue: 408 0.0001, weight 9.6406 evalue: 409 0.0001, weight 9.6406 evalue: 410 0.0001, weight 9.6406 evalue: 411 0.0001, weight 9.6406 evalue: 412 0.0001, weight 9.6406 evalue: 413 0.0096, weight 5.1912 evalue: 414 0.0096, weight 5.1912 evalue: 415 0.0096, weight 5.1912 evalue: 416 0.0096, weight 5.1912 evalue: 417 0.0096, weight 5.1912 evalue: 418 0.0096, weight 5.1912 evalue: 419 0.0096, weight 5.1912 evalue: 420 0.0096, weight 5.1912 evalue: 421 0.0096, weight 5.1912 evalue: 422 0.0096, weight 5.1912 evalue: 423 0.0096, weight 5.1912 evalue: 424 0.0096, weight 5.1912 evalue: 425 0.0096, weight 5.1912 evalue: 426 0.0096, weight 5.1912 evalue: 427 0.0096, weight 5.1912 evalue: 428 0.0000, weight 42.3849 evalue: 429 0.0000, weight 42.3849 evalue: 430 0.0000, weight 42.3849 evalue: 431 0.0000, weight 42.3849 evalue: 432 0.0000, weight 42.3849 evalue: 433 0.0000, weight 42.3849 evalue: 434 0.0000, weight 42.3849 evalue: 435 0.0000, weight 42.3849 evalue: 436 0.0000, weight 42.3849 evalue: 437 0.0000, weight 42.3849 evalue: 438 0.0000, weight 42.3849 evalue: 439 0.0000, weight 42.3849 evalue: 440 0.0000, weight 42.3849 evalue: 441 0.0000, weight 42.3849 evalue: 442 0.0000, weight 42.3849 evalue: 443 0.0000, weight 42.3849 evalue: 444 0.0000, weight 42.3849 evalue: 445 0.0000, weight 42.3849 evalue: 446 0.0004, weight 8.3861 evalue: 447 0.0004, weight 8.3861 evalue: 448 0.0004, weight 8.3861 evalue: 449 0.0004, weight 8.3861 evalue: 450 0.0004, weight 8.3861 evalue: 451 0.0004, weight 8.3861 evalue: 452 0.0004, weight 8.3861 evalue: 453 0.0004, weight 8.3861 evalue: 454 0.0004, weight 8.3861 evalue: 455 0.0004, weight 8.3861 evalue: 456 0.0004, weight 8.3861 evalue: 457 0.0004, weight 8.3861 evalue: 458 0.0004, weight 8.3861 evalue: 459 0.0004, weight 8.3861 evalue: 460 0.0004, weight 8.3861 evalue: 461 0.0004, weight 8.3861 evalue: 462 0.0004, weight 8.3861 evalue: 463 0.0004, weight 8.3861 evalue: 464 0.0000, weight 26.8407 evalue: 465 0.0000, weight 26.8407 evalue: 466 0.0000, weight 26.8407 evalue: 467 0.0000, weight 26.8407 evalue: 468 0.0000, weight 26.8407 evalue: 469 0.0000, weight 26.8407 evalue: 470 0.0000, weight 26.8407 evalue: 471 0.0000, weight 26.8407 evalue: 472 0.0000, weight 26.8407 evalue: 473 0.0000, weight 26.8407 evalue: 474 0.0000, weight 26.8407 evalue: 475 0.0000, weight 26.8407 evalue: 476 0.0000, weight 26.8407 evalue: 477 0.0000, weight 26.8407 evalue: 478 0.0000, weight 26.8407 evalue: 479 0.0000, weight 26.8407 evalue: 480 0.0000, weight 26.8407 evalue: 481 0.0000, weight 26.8407 evalue: 482 0.0001, weight 10.4434 evalue: 483 0.0001, weight 10.4434 evalue: 484 0.0001, weight 10.4434 evalue: 485 0.0001, weight 10.4434 evalue: 486 0.0001, weight 10.4434 evalue: 487 0.0001, weight 10.4434 evalue: 488 0.0001, weight 10.4434 evalue: 489 0.0001, weight 10.4434 evalue: 490 0.0001, weight 10.4434 evalue: 491 0.0001, weight 10.4434 evalue: 492 0.0001, weight 10.4434 evalue: 493 0.0001, weight 10.4434 evalue: 494 0.0001, weight 10.4434 evalue: 495 0.0001, weight 10.4434 evalue: 496 0.0001, weight 10.4434 evalue: 497 0.0001, weight 10.4434 evalue: 498 0.0001, weight 10.4434 evalue: 499 0.0001, weight 10.4434 evalue: 500 0.0119, weight 4.9812 evalue: 501 0.0119, weight 4.9812 evalue: 502 0.0119, weight 4.9812 evalue: 503 0.0119, weight 4.9812 evalue: 504 0.0119, weight 4.9812 evalue: 505 0.0119, weight 4.9812 evalue: 506 0.0119, weight 4.9812 evalue: 507 0.0119, weight 4.9812 evalue: 508 0.0119, weight 4.9812 evalue: 509 0.0119, weight 4.9812 evalue: 510 0.0119, weight 4.9812 evalue: 511 0.0119, weight 4.9812 evalue: 512 0.0119, weight 4.9812 evalue: 513 0.0119, weight 4.9812 evalue: 514 0.0119, weight 4.9812 evalue: 515 0.0000, weight 39.3149 evalue: 516 0.0000, weight 39.3149 evalue: 517 0.0000, weight 39.3149 evalue: 518 0.0000, weight 39.3149 evalue: 519 0.0000, weight 39.3149 evalue: 520 0.0000, weight 39.3149 evalue: 521 0.0000, weight 39.3149 evalue: 522 0.0000, weight 39.3149 evalue: 523 0.0000, weight 39.3149 evalue: 524 0.0000, weight 39.3149 evalue: 525 0.0000, weight 39.3149 evalue: 526 0.0000, weight 39.3149 evalue: 527 0.0000, weight 39.3149 evalue: 528 0.0000, weight 39.3149 evalue: 529 0.0000, weight 39.3149 evalue: 530 0.0000, weight 39.3149 evalue: 531 0.0000, weight 39.3149 evalue: 532 0.0000, weight 39.3149 evalue: 533 0.0000, weight 39.2032 evalue: 534 0.0000, weight 39.2032 evalue: 535 0.0000, weight 39.2032 evalue: 536 0.0000, weight 39.2032 evalue: 537 0.0000, weight 39.2032 evalue: 538 0.0000, weight 39.2032 evalue: 539 0.0000, weight 39.2032 evalue: 540 0.0000, weight 39.2032 evalue: 541 0.0000, weight 39.2032 evalue: 542 0.0000, weight 39.2032 evalue: 543 0.0000, weight 39.2032 evalue: 544 0.0000, weight 39.2032 evalue: 545 0.0000, weight 39.2032 evalue: 546 0.0000, weight 39.2032 evalue: 547 0.0000, weight 39.2032 evalue: 548 0.0000, weight 39.2032 evalue: 549 0.0000, weight 39.2032 evalue: 550 0.0000, weight 39.2032 evalue: 551 0.0000, weight 13.1399 evalue: 552 0.0000, weight 13.1399 evalue: 553 0.0000, weight 13.1399 evalue: 554 0.0000, weight 13.1399 evalue: 555 0.0000, weight 13.1399 evalue: 556 0.0000, weight 13.1399 evalue: 557 0.0000, weight 13.1399 evalue: 558 0.0000, weight 13.1399 evalue: 559 0.0000, weight 13.1399 evalue: 560 0.0000, weight 13.1399 evalue: 561 0.0000, weight 13.1399 evalue: 562 0.0000, weight 13.1399 evalue: 563 0.0000, weight 13.1399 evalue: 564 0.0000, weight 13.1399 evalue: 565 0.0000, weight 13.1399 evalue: 566 0.0000, weight 13.1399 evalue: 567 0.0000, weight 13.1399 evalue: 568 0.0000, weight 13.1399 evalue: 569 0.0000, weight 22.0796 evalue: 570 0.0000, weight 22.0796 evalue: 571 0.0000, weight 22.0796 evalue: 572 0.0000, weight 22.0796 evalue: 573 0.0000, weight 22.0796 evalue: 574 0.0000, weight 22.0796 evalue: 575 0.0000, weight 22.0796 evalue: 576 0.0000, weight 22.0796 evalue: 577 0.0000, weight 22.0796 evalue: 578 0.0000, weight 22.0796 evalue: 579 0.0000, weight 22.0796 evalue: 580 0.0000, weight 22.0796 evalue: 581 0.0000, weight 22.0796 evalue: 582 0.0000, weight 22.0796 evalue: 583 0.0000, weight 22.0796 evalue: 584 0.0000, weight 22.0796 evalue: 585 0.0000, weight 22.0796 evalue: 586 0.0000, weight 22.0796 evalue: 587 0.0000, weight 14.3707 evalue: 588 0.0000, weight 14.3707 evalue: 589 0.0000, weight 14.3707 evalue: 590 0.0000, weight 14.3707 evalue: 591 0.0000, weight 14.3707 evalue: 592 0.0000, weight 14.3707 evalue: 593 0.0000, weight 14.3707 evalue: 594 0.0000, weight 14.3707 evalue: 595 0.0000, weight 14.3707 evalue: 596 0.0000, weight 14.3707 evalue: 597 0.0000, weight 14.3707 evalue: 598 0.0000, weight 14.3707 evalue: 599 0.0000, weight 14.3707 evalue: 600 0.0000, weight 14.3707 evalue: 601 0.0000, weight 14.3707 evalue: 602 0.0000, weight 14.3707 evalue: 603 0.0000, weight 14.3707 evalue: 604 0.0000, weight 14.3707 evalue: 605 0.0003, weight 8.7933 evalue: 606 0.0003, weight 8.7933 evalue: 607 0.0003, weight 8.7933 evalue: 608 0.0003, weight 8.7933 evalue: 609 0.0003, weight 8.7933 evalue: 610 0.0003, weight 8.7933 evalue: 611 0.0003, weight 8.7933 evalue: 612 0.0003, weight 8.7933 evalue: 613 0.0003, weight 8.7933 evalue: 614 0.0003, weight 8.7933 evalue: 615 0.0003, weight 8.7933 evalue: 616 0.0003, weight 8.7933 evalue: 617 0.0003, weight 8.7933 evalue: 618 0.0003, weight 8.7933 evalue: 619 0.0003, weight 8.7933 evalue: 620 0.0003, weight 8.7933 evalue: 621 0.0003, weight 8.7933 evalue: 622 0.0003, weight 8.7933 evalue: 623 0.0004, weight 8.4085 evalue: 624 0.0004, weight 8.4085 evalue: 625 0.0004, weight 8.4085 evalue: 626 0.0004, weight 8.4085 evalue: 627 0.0004, weight 8.4085 evalue: 628 0.0004, weight 8.4085 evalue: 629 0.0004, weight 8.4085 evalue: 630 0.0004, weight 8.4085 evalue: 631 0.0004, weight 8.4085 evalue: 632 0.0004, weight 8.4085 evalue: 633 0.0004, weight 8.4085 evalue: 634 0.0004, weight 8.4085 evalue: 635 0.0004, weight 8.4085 evalue: 636 0.0004, weight 8.4085 evalue: 637 0.0004, weight 8.4085 evalue: 638 0.0004, weight 8.4085 evalue: 639 0.0004, weight 8.4085 evalue: 640 0.0004, weight 8.4085 evalue: 641 0.0000, weight 41.5381 evalue: 642 0.0000, weight 41.5381 evalue: 643 0.0000, weight 41.5381 evalue: 644 0.0000, weight 41.5381 evalue: 645 0.0000, weight 41.5381 evalue: 646 0.0000, weight 41.5381 evalue: 647 0.0000, weight 41.5381 evalue: 648 0.0000, weight 41.5381 evalue: 649 0.0000, weight 41.5381 evalue: 650 0.0000, weight 41.5381 evalue: 651 0.0000, weight 41.5381 evalue: 652 0.0000, weight 41.5381 evalue: 653 0.0000, weight 41.5381 evalue: 654 0.0000, weight 41.5381 evalue: 655 0.0000, weight 41.5381 evalue: 656 0.0000, weight 41.5381 evalue: 657 0.0000, weight 41.5381 evalue: 658 0.0000, weight 41.5381 evalue: 659 0.0003, weight 8.7329 evalue: 660 0.0003, weight 8.7329 evalue: 661 0.0003, weight 8.7329 evalue: 662 0.0003, weight 8.7329 evalue: 663 0.0003, weight 8.7329 evalue: 664 0.0003, weight 8.7329 evalue: 665 0.0003, weight 8.7329 evalue: 666 0.0003, weight 8.7329 evalue: 667 0.0003, weight 8.7329 evalue: 668 0.0003, weight 8.7329 evalue: 669 0.0003, weight 8.7329 evalue: 670 0.0003, weight 8.7329 evalue: 671 0.0003, weight 8.7329 evalue: 672 0.0003, weight 8.7329 evalue: 673 0.0003, weight 8.7329 evalue: 674 0.0003, weight 8.7329 evalue: 675 0.0000, weight 37.0801 evalue: 676 0.0000, weight 37.0801 evalue: 677 0.0000, weight 37.0801 evalue: 678 0.0000, weight 37.0801 evalue: 679 0.0000, weight 37.0801 evalue: 680 0.0000, weight 37.0801 evalue: 681 0.0000, weight 37.0801 evalue: 682 0.0000, weight 37.0801 evalue: 683 0.0000, weight 37.0801 evalue: 684 0.0000, weight 37.0801 evalue: 685 0.0000, weight 37.0801 evalue: 686 0.0000, weight 37.0801 evalue: 687 0.0000, weight 37.0801 evalue: 688 0.0000, weight 37.0801 evalue: 689 0.0000, weight 37.0801 evalue: 690 0.0000, weight 37.0801 evalue: 691 0.0000, weight 37.0801 evalue: 692 0.0000, weight 37.0801 evalue: 693 0.0004, weight 8.3670 evalue: 694 0.0004, weight 8.3670 evalue: 695 0.0004, weight 8.3670 evalue: 696 0.0004, weight 8.3670 evalue: 697 0.0004, weight 8.3670 evalue: 698 0.0004, weight 8.3670 evalue: 699 0.0004, weight 8.3670 evalue: 700 0.0004, weight 8.3670 evalue: 701 0.0004, weight 8.3670 evalue: 702 0.0004, weight 8.3670 evalue: 703 0.0004, weight 8.3670 evalue: 704 0.0043, weight 5.9838 evalue: 705 0.0043, weight 5.9838 evalue: 706 0.0043, weight 5.9838 evalue: 707 0.0043, weight 5.9838 evalue: 708 0.0043, weight 5.9838 evalue: 709 0.0043, weight 5.9838 evalue: 710 0.0043, weight 5.9838 evalue: 711 0.0043, weight 5.9838 evalue: 712 0.0043, weight 5.9838 evalue: 713 0.0043, weight 5.9838 evalue: 714 0.0043, weight 5.9838 evalue: 715 0.0043, weight 5.9838 evalue: 716 0.0043, weight 5.9838 evalue: 717 0.0043, weight 5.9838 evalue: 718 0.0043, weight 5.9838 evalue: 719 0.0000, weight 10.5477 evalue: 720 0.0000, weight 10.5477 evalue: 721 0.0000, weight 10.5477 evalue: 722 0.0000, weight 10.5477 evalue: 723 0.0000, weight 10.5477 evalue: 724 0.0000, weight 10.5477 evalue: 725 0.0000, weight 10.5477 evalue: 726 0.0000, weight 10.5477 evalue: 727 0.0000, weight 10.5477 evalue: 728 0.0000, weight 10.5477 evalue: 729 0.0000, weight 10.5477 evalue: 730 0.0000, weight 10.5477 evalue: 731 0.0000, weight 10.5477 evalue: 732 0.0000, weight 10.5477 evalue: 733 0.0000, weight 10.5477 evalue: 734 0.0000, weight 10.5477 evalue: 735 0.0000, weight 10.5477 evalue: 736 0.0000, weight 10.5477 evalue: 737 0.0000, weight 13.5701 evalue: 738 0.0000, weight 13.5701 evalue: 739 0.0000, weight 13.5701 evalue: 740 0.0000, weight 13.5701 evalue: 741 0.0000, weight 13.5701 evalue: 742 0.0000, weight 13.5701 evalue: 743 0.0000, weight 13.5701 evalue: 744 0.0000, weight 13.5701 evalue: 745 0.0000, weight 13.5701 evalue: 746 0.0000, weight 13.5701 evalue: 747 0.0000, weight 13.5701 evalue: 748 0.0000, weight 11.6835 evalue: 749 0.0000, weight 11.6835 evalue: 750 0.0000, weight 11.6835 evalue: 751 0.0000, weight 11.6835 evalue: 752 0.0000, weight 11.6835 evalue: 753 0.0000, weight 11.6835 evalue: 754 0.0000, weight 11.6835 evalue: 755 0.0000, weight 11.6835 evalue: 756 0.0000, weight 11.6835 evalue: 757 0.0000, weight 11.6835 evalue: 758 0.0000, weight 11.6835 evalue: 759 0.0000, weight 11.6835 evalue: 760 0.0000, weight 11.6835 evalue: 761 0.0074, weight 5.4458 evalue: 762 0.0074, weight 5.4458 evalue: 763 0.0074, weight 5.4458 evalue: 764 0.0074, weight 5.4458 evalue: 765 0.0074, weight 5.4458 evalue: 766 0.0074, weight 5.4458 evalue: 767 0.0074, weight 5.4458 evalue: 768 0.0074, weight 5.4458 evalue: 769 0.0074, weight 5.4458 evalue: 770 0.0074, weight 5.4458 evalue: 771 0.0074, weight 5.4458 evalue: 772 0.0074, weight 5.4458 evalue: 773 0.0074, weight 5.4458 evalue: 774 0.0074, weight 5.4458 evalue: 775 0.0074, weight 5.4458 evalue: 776 0.0074, weight 5.4458 evalue: 777 0.0005, weight 8.1318 evalue: 778 0.0005, weight 8.1318 evalue: 779 0.0005, weight 8.1318 evalue: 780 0.0005, weight 8.1318 evalue: 781 0.0005, weight 8.1318 evalue: 782 0.0005, weight 8.1318 evalue: 783 0.0005, weight 8.1318 evalue: 784 0.0005, weight 8.1318 evalue: 785 0.0005, weight 8.1318 evalue: 786 0.0005, weight 8.1318 evalue: 787 0.0005, weight 8.1318 evalue: 788 0.0005, weight 8.1318 evalue: 789 0.0005, weight 8.1318 evalue: 790 0.0005, weight 8.1318 evalue: 791 0.0005, weight 8.1318 evalue: 792 0.0005, weight 8.1318 evalue: 793 0.0005, weight 8.1318 evalue: 794 0.0001, weight 9.7342 evalue: 795 0.0001, weight 9.7342 evalue: 796 0.0001, weight 9.7342 evalue: 797 0.0001, weight 9.7342 evalue: 798 0.0001, weight 9.7342 evalue: 799 0.0001, weight 9.7342 evalue: 800 0.0001, weight 9.7342 evalue: 801 0.0001, weight 9.7342 evalue: 802 0.0001, weight 9.7342 evalue: 803 0.0001, weight 9.7342 evalue: 804 0.0001, weight 9.7342 evalue: 805 0.0001, weight 9.7342 evalue: 806 0.0001, weight 9.7342 evalue: 807 0.0001, weight 9.7342 evalue: 808 0.0001, weight 9.7342 evalue: 809 0.0001, weight 9.7342 evalue: 810 0.0001, weight 9.7342 evalue: 811 0.0045, weight 5.9584 evalue: 812 0.0045, weight 5.9584 evalue: 813 0.0045, weight 5.9584 evalue: 814 0.0045, weight 5.9584 evalue: 815 0.0045, weight 5.9584 evalue: 816 0.0045, weight 5.9584 evalue: 817 0.0045, weight 5.9584 evalue: 818 0.0045, weight 5.9584 evalue: 819 0.0045, weight 5.9584 evalue: 820 0.0045, weight 5.9584 evalue: 821 0.0045, weight 5.9584 evalue: 822 0.0045, weight 5.9584 evalue: 823 0.0045, weight 5.9584 evalue: 824 0.0045, weight 5.9584 evalue: 825 0.0045, weight 5.9584 evalue: 826 0.0000, weight 11.5741 evalue: 827 0.0000, weight 11.5741 evalue: 828 0.0000, weight 11.5741 evalue: 829 0.0000, weight 11.5741 evalue: 830 0.0000, weight 11.5741 evalue: 831 0.0000, weight 11.5741 evalue: 832 0.0000, weight 11.5741 evalue: 833 0.0000, weight 11.5741 evalue: 834 0.0000, weight 11.5741 evalue: 835 0.0000, weight 11.5741 evalue: 836 0.0000, weight 11.5741 evalue: 837 0.0000, weight 11.5741 evalue: 838 0.0000, weight 11.5741 evalue: 839 0.0000, weight 11.5741 evalue: 840 0.0000, weight 11.5741 evalue: 841 0.0000, weight 11.5741 evalue: 842 0.0000, weight 11.5741 evalue: 843 0.0000, weight 11.5741 evalue: 844 0.0000, weight 17.8400 evalue: 845 0.0000, weight 17.8400 evalue: 846 0.0000, weight 17.8400 evalue: 847 0.0000, weight 17.8400 evalue: 848 0.0000, weight 17.8400 evalue: 849 0.0000, weight 17.8400 evalue: 850 0.0000, weight 17.8400 evalue: 851 0.0000, weight 17.8400 evalue: 852 0.0000, weight 17.8400 evalue: 853 0.0000, weight 17.8400 evalue: 854 0.0000, weight 17.8400 evalue: 855 0.0000, weight 17.8400 evalue: 856 0.0000, weight 17.8400 evalue: 857 0.0000, weight 17.8400 evalue: 858 0.0000, weight 17.8400 evalue: 859 0.0000, weight 17.8400 evalue: 860 0.0000, weight 17.8400 evalue: 861 0.0000, weight 17.8400 evalue: 862 0.0000, weight 13.0610 evalue: 863 0.0000, weight 13.0610 evalue: 864 0.0000, weight 13.0610 evalue: 865 0.0000, weight 13.0610 evalue: 866 0.0000, weight 13.0610 evalue: 867 0.0000, weight 13.0610 evalue: 868 0.0000, weight 13.0610 evalue: 869 0.0000, weight 13.0610 evalue: 870 0.0000, weight 13.0610 evalue: 871 0.0000, weight 13.0610 evalue: 872 0.0000, weight 13.0610 evalue: 873 0.0000, weight 13.0610 evalue: 874 0.0000, weight 13.0610 evalue: 875 0.0000, weight 13.0610 evalue: 876 0.0000, weight 13.0610 evalue: 877 0.0000, weight 13.0610 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 17 RES2ATOM 3 24 RES2ATOM 4 32 RES2ATOM 5 41 RES2ATOM 6 49 RES2ATOM 7 57 RES2ATOM 8 66 RES2ATOM 9 74 RES2ATOM 10 79 RES2ATOM 11 84 RES2ATOM 12 94 RES2ATOM 13 102 RES2ATOM 14 113 RES2ATOM 15 119 RES2ATOM 16 128 RES2ATOM 17 135 RES2ATOM 18 142 RES2ATOM 19 149 RES2ATOM 20 157 RES2ATOM 21 164 RES2ATOM 22 175 RES2ATOM 23 186 RES2ATOM 24 194 RES2ATOM 25 205 RES2ATOM 26 216 RES2ATOM 27 225 RES2ATOM 28 230 RES2ATOM 29 239 RES2ATOM 30 244 RES2ATOM 31 252 RES2ATOM 32 259 RES2ATOM 33 266 RES2ATOM 34 275 RES2ATOM 35 286 RES2ATOM 36 292 RES2ATOM 37 301 RES2ATOM 38 309 RES2ATOM 39 316 RES2ATOM 40 323 RES2ATOM 42 335 RES2ATOM 43 340 RES2ATOM 44 348 RES2ATOM 45 356 RES2ATOM 46 367 RES2ATOM 49 383 RES2ATOM 50 391 RES2ATOM 51 398 RES2ATOM 52 405 RES2ATOM 53 412 RES2ATOM 54 418 RES2ATOM 55 427 RES2ATOM 56 435 RES2ATOM 57 440 RES2ATOM 58 445 RES2ATOM 59 450 RES2ATOM 60 459 RES2ATOM 61 470 RES2ATOM 62 478 RES2ATOM 63 489 RES2ATOM 64 495 RES2ATOM 65 501 RES2ATOM 66 509 RES2ATOM 67 517 RES2ATOM 68 522 RES2ATOM 69 527 RES2ATOM 70 535 RES2ATOM 71 543 RES2ATOM 72 554 RES2ATOM 73 563 RES2ATOM 74 571 RES2ATOM 75 580 RES2ATOM 78 599 RES2ATOM 79 607 RES2ATOM 80 615 RES2ATOM 81 622 RES2ATOM 82 633 RES2ATOM 83 643 RES2ATOM 84 648 RES2ATOM 85 656 RES2ATOM 86 663 RES2ATOM 87 672 RES2ATOM 89 684 RES2ATOM 90 695 RES2ATOM 91 706 RES2ATOM 92 713 RES2ATOM 93 724 RES2ATOM 94 731 RES2ATOM 95 737 RES2ATOM 96 745 RES2ATOM 97 751 RES2ATOM 98 757 RES2ATOM 100 770 RES2ATOM 101 781 RES2ATOM 102 792 RES2ATOM 103 800 RES2ATOM 104 808 RES2ATOM 106 824 RES2ATOM 107 832 RES2ATOM 108 843 RES2ATOM 109 848 RES2ATOM 110 857 RES2ATOM 111 868 RES2ATOM 112 877 RES2ATOM 113 886 RES2ATOM 114 900 RES2ATOM 115 908 RES2ATOM 116 915 RES2ATOM 117 926 RES2ATOM 118 931 RES2ATOM 119 939 RES2ATOM 120 949 RES2ATOM 121 954 RES2ATOM 122 960 RES2ATOM 123 968 RES2ATOM 124 976 RES2ATOM 125 985 RES2ATOM 126 991 RES2ATOM 127 1000 RES2ATOM 128 1011 RES2ATOM 129 1016 RES2ATOM 130 1024 RES2ATOM 131 1032 RES2ATOM 132 1037 RES2ATOM 133 1042 RES2ATOM 135 1051 RES2ATOM 136 1058 RES2ATOM 137 1066 RES2ATOM 138 1074 RES2ATOM 139 1081 RES2ATOM 140 1092 RES2ATOM 141 1100 RES2ATOM 142 1105 RES2ATOM 143 1114 RES2ATOM 144 1125 RES2ATOM 145 1134 RES2ATOM 146 1143 Constraint 536 608 5.0814 6.3517 12.7035 1309.3203 Constraint 436 510 3.8179 4.7724 9.5448 1294.6417 Constraint 428 510 4.5712 5.7140 11.4280 1285.1570 Constraint 406 510 4.9515 6.1894 12.3787 1278.2585 Constraint 406 536 5.4603 6.8253 13.6507 1168.2968 Constraint 623 725 4.7386 5.9233 11.8466 1167.3798 Constraint 616 732 4.2865 5.3581 10.7163 1153.8417 Constraint 608 732 5.4566 6.8208 13.6415 1153.8417 Constraint 608 738 4.9931 6.2413 12.4826 1152.3799 Constraint 336 446 4.8038 6.0048 12.0096 1147.4766 Constraint 317 428 5.1067 6.3834 12.7669 1144.0850 Constraint 608 725 4.4511 5.5638 11.1277 1136.2274 Constraint 392 725 4.4562 5.5703 11.1406 1133.2130 Constraint 616 746 4.6665 5.8331 11.6663 1131.0720 Constraint 536 725 5.1093 6.3866 12.7732 1129.4033 Constraint 399 725 5.8922 7.3652 14.7304 1123.4747 Constraint 623 714 5.6147 7.0184 14.0367 1115.9874 Constraint 336 428 5.0757 6.3446 12.6891 1104.9358 Constraint 600 746 4.7495 5.9368 11.8737 1104.8014 Constraint 600 738 5.5604 6.9505 13.9010 1102.6118 Constraint 616 725 5.8879 7.3599 14.7198 1092.5779 Constraint 406 725 5.3308 6.6635 13.3271 1091.9165 Constraint 608 746 5.1370 6.4213 12.8425 1089.3646 Constraint 399 714 4.6771 5.8463 11.6926 1083.9100 Constraint 317 564 5.3445 6.6806 13.3612 1079.1521 Constraint 634 714 4.4098 5.5123 11.0246 1077.7966 Constraint 341 608 5.4501 6.8126 13.6252 1071.4575 Constraint 324 600 5.1826 6.4782 12.9564 1068.2671 Constraint 317 528 4.5413 5.6767 11.3533 1068.1394 Constraint 392 714 5.2750 6.5938 13.1875 1066.3203 Constraint 317 536 5.6493 7.0616 14.1232 1056.2368 Constraint 428 725 5.2726 6.5907 13.1814 1040.5046 Constraint 406 518 5.2200 6.5250 13.0500 1009.7783 Constraint 634 732 4.9752 6.2190 12.4379 1005.0120 Constraint 600 758 4.8439 6.0549 12.1097 1002.4373 Constraint 324 564 5.5618 6.9523 13.9045 986.3292 Constraint 293 564 4.9659 6.2073 12.4147 984.4777 Constraint 293 528 4.7062 5.8828 11.7656 983.9151 Constraint 317 451 5.3612 6.7015 13.4030 971.8602 Constraint 341 738 4.2612 5.3265 10.6530 969.7099 Constraint 413 490 5.3889 6.7362 13.4724 969.4385 Constraint 600 793 5.0878 6.3598 12.7195 969.1059 Constraint 623 707 4.1707 5.2134 10.4268 966.3534 Constraint 634 707 5.4437 6.8046 13.6092 959.1852 Constraint 399 707 5.5649 6.9561 13.9122 958.6838 Constraint 341 725 4.8538 6.0673 12.1346 957.4163 Constraint 310 451 4.8606 6.0758 12.1516 953.6291 Constraint 406 490 5.1210 6.4012 12.8024 944.8585 Constraint 536 623 5.6885 7.1106 14.2211 933.3204 Constraint 399 696 4.6556 5.8195 11.6389 928.5182 Constraint 287 528 4.7529 5.9411 11.8823 927.1119 Constraint 324 801 4.6447 5.8059 11.6118 927.0421 Constraint 406 707 4.9137 6.1421 12.2842 920.5235 Constraint 349 738 4.9046 6.1308 12.2616 911.4479 Constraint 293 555 5.5076 6.8844 13.7689 883.7719 Constraint 317 510 5.8259 7.2824 14.5648 835.0199 Constraint 341 732 5.3824 6.7280 13.4561 823.1752 Constraint 349 801 4.1172 5.1464 10.2929 821.9465 Constraint 336 451 5.2204 6.5255 13.0511 788.2733 Constraint 341 428 5.8093 7.2616 14.5231 788.1800 Constraint 349 771 5.5538 6.9422 13.8845 783.5796 Constraint 324 738 5.3775 6.7219 13.4437 778.6641 Constraint 623 732 5.9895 7.4868 14.9737 774.6196 Constraint 644 714 5.9120 7.3899 14.7799 771.9030 Constraint 616 738 6.0570 7.5712 15.1425 763.1604 Constraint 302 825 5.1187 6.3984 12.7967 745.3453 Constraint 324 608 5.8888 7.3611 14.7221 730.1639 Constraint 428 536 5.7869 7.2336 14.4672 687.5006 Constraint 436 502 5.9889 7.4862 14.9723 675.6392 Constraint 324 793 5.5450 6.9312 13.8625 665.3909 Constraint 384 725 5.3933 6.7417 13.4833 643.8948 Constraint 287 471 5.3718 6.7148 13.4295 623.1624 Constraint 384 714 3.7897 4.7371 9.4743 617.9745 Constraint 384 732 4.0299 5.0374 10.0749 617.3708 Constraint 317 608 6.1919 7.7398 15.4797 608.6686 Constraint 287 451 5.5594 6.9492 13.8985 606.8677 Constraint 226 302 4.7464 5.9330 11.8659 605.2597 Constraint 287 502 5.6807 7.1009 14.2017 590.0500 Constraint 217 849 4.4047 5.5058 11.0117 586.2693 Constraint 293 600 6.2257 7.7821 15.5643 585.4202 Constraint 399 649 5.8139 7.2673 14.5347 529.0638 Constraint 267 528 5.8386 7.2982 14.5964 506.0006 Constraint 245 825 5.2338 6.5422 13.0844 503.5723 Constraint 324 825 5.4856 6.8570 13.7140 491.6254 Constraint 226 825 5.6887 7.1109 14.2217 478.2713 Constraint 195 276 5.4322 6.7903 13.5805 461.3237 Constraint 187 858 4.7978 5.9973 11.9946 455.9208 Constraint 406 696 5.8382 7.2978 14.5956 443.2692 Constraint 634 725 6.0287 7.5359 15.0718 442.0189 Constraint 245 793 5.1015 6.3769 12.7539 422.7128 Constraint 187 302 5.8638 7.3297 14.6594 422.4391 Constraint 176 887 4.5322 5.6652 11.3304 417.9970 Constraint 384 634 5.6690 7.0862 14.1724 386.4667 Constraint 392 732 6.0477 7.5596 15.1192 383.2470 Constraint 406 623 6.1040 7.6301 15.2601 379.6059 Constraint 187 276 4.8046 6.0058 12.0116 352.2914 Constraint 406 714 5.8394 7.2993 14.5985 344.5316 Constraint 260 793 5.6031 7.0039 14.0078 343.6269 Constraint 158 276 5.1839 6.4799 12.9598 336.6882 Constraint 217 887 4.7059 5.8824 11.7647 336.2442 Constraint 150 932 5.4102 6.7628 13.5256 335.0829 Constraint 176 901 4.8077 6.0096 12.0193 332.5304 Constraint 302 801 5.4739 6.8424 13.6849 325.3628 Constraint 413 696 5.6617 7.0772 14.1543 312.3440 Constraint 368 446 6.1003 7.6253 15.2507 308.0377 Constraint 187 887 4.6883 5.8604 11.7208 307.5341 Constraint 187 849 5.2744 6.5930 13.1861 300.1877 Constraint 600 801 5.6535 7.0669 14.1337 298.7213 Constraint 317 725 6.0637 7.5796 15.1593 297.9987 Constraint 267 555 6.0626 7.5782 15.1564 294.6352 Constraint 217 825 5.0074 6.2593 12.5186 294.5675 Constraint 217 858 4.8249 6.0312 12.0624 278.6923 Constraint 150 901 5.4253 6.7816 13.5632 275.7756 Constraint 176 932 5.3611 6.7014 13.4027 265.4013 Constraint 260 825 5.1441 6.4301 12.8603 263.5145 Constraint 176 927 4.8020 6.0025 12.0049 259.9325 Constraint 226 849 5.5038 6.8798 13.7595 256.6304 Constraint 150 887 5.3029 6.6286 13.2572 247.7789 Constraint 260 600 5.9357 7.4197 14.8394 242.3976 Constraint 302 858 5.3651 6.7063 13.4126 235.9110 Constraint 317 446 5.5752 6.9690 13.9379 229.2196 Constraint 932 1001 5.0034 6.2543 12.5086 224.6512 Constraint 187 901 5.0641 6.3302 12.6603 223.1285 Constraint 310 471 5.7915 7.2394 14.4789 221.4744 Constraint 341 801 5.7040 7.1300 14.2600 215.2097 Constraint 245 849 5.7032 7.1290 14.2580 212.6776 Constraint 572 725 6.2696 7.8370 15.6740 211.3480 Constraint 217 901 5.2814 6.6017 13.2034 205.5602 Constraint 317 392 6.1165 7.6456 15.2912 188.8210 Constraint 302 833 5.6279 7.0349 14.0699 183.4513 Constraint 349 833 4.7625 5.9531 11.9061 180.3326 Constraint 341 564 6.2486 7.8107 15.6214 179.2088 Constraint 349 825 5.8229 7.2786 14.5572 179.2042 Constraint 217 878 5.3687 6.7108 13.4217 178.2579 Constraint 195 302 5.7142 7.1428 14.2855 176.2085 Constraint 349 809 4.9113 6.1391 12.2782 165.4407 Constraint 336 419 5.6102 7.0127 14.0254 150.2402 Constraint 302 793 5.5395 6.9244 13.8488 148.2612 Constraint 428 528 6.1257 7.6572 15.3143 144.7140 Constraint 176 916 4.6373 5.7967 11.5933 137.5671 Constraint 310 528 5.8807 7.3509 14.7018 135.8427 Constraint 384 649 5.0410 6.3012 12.6025 135.5686 Constraint 317 471 5.7214 7.1518 14.3035 134.6447 Constraint 310 460 5.5670 6.9587 13.9175 131.7506 Constraint 368 428 5.9830 7.4787 14.9574 131.2383 Constraint 195 267 4.8801 6.1001 12.2002 129.7987 Constraint 341 600 6.1761 7.7201 15.4402 129.4873 Constraint 564 725 6.2804 7.8505 15.7009 127.7999 Constraint 206 849 5.4910 6.8637 13.7275 125.9816 Constraint 143 932 6.0492 7.5615 15.1229 122.6279 Constraint 150 927 5.2015 6.5019 13.0039 121.7508 Constraint 217 793 5.7879 7.2349 14.4697 121.5003 Constraint 384 738 5.3082 6.6352 13.2705 119.1217 Constraint 436 518 6.2064 7.7580 15.5161 118.6330 Constraint 150 858 4.9320 6.1650 12.3301 117.5810 Constraint 187 825 4.1958 5.2448 10.4896 115.0777 Constraint 176 858 5.0550 6.3187 12.6374 114.5343 Constraint 324 771 6.2422 7.8027 15.6054 111.1958 Constraint 260 564 6.1964 7.7455 15.4911 108.2475 Constraint 451 528 5.8937 7.3672 14.7344 106.2536 Constraint 276 528 4.7576 5.9470 11.8941 105.9030 Constraint 240 849 6.2137 7.7672 15.5343 105.8905 Constraint 310 446 5.5531 6.9414 13.8829 100.1191 Constraint 413 510 6.1198 7.6498 15.2996 99.9538 Constraint 226 793 5.8123 7.2653 14.5306 98.6475 Constraint 293 825 6.2074 7.7593 15.5185 98.0215 Constraint 226 858 5.7100 7.1375 14.2750 97.7189 Constraint 176 849 4.8296 6.0370 12.0740 97.3151 Constraint 399 673 5.7672 7.2090 14.4180 94.5424 Constraint 357 446 5.6927 7.1159 14.2317 94.0949 Constraint 649 732 5.9059 7.3824 14.7647 93.3218 Constraint 120 932 5.6687 7.0859 14.1718 93.2437 Constraint 226 293 5.7052 7.1315 14.2630 87.8604 Constraint 909 1001 5.8284 7.2855 14.5710 87.7565 Constraint 187 833 5.3155 6.6443 13.2886 87.0877 Constraint 324 428 5.5450 6.9312 13.8625 85.1842 Constraint 187 260 5.7239 7.1549 14.3097 84.9276 Constraint 276 555 5.4651 6.8314 13.6628 81.9812 Constraint 276 523 6.2081 7.7602 15.5203 81.9812 Constraint 158 310 6.1748 7.7186 15.4371 81.9812 Constraint 187 267 5.5933 6.9916 13.9832 81.5486 Constraint 324 833 5.0356 6.2945 12.5891 80.4696 Constraint 287 510 5.8921 7.3652 14.7303 79.7193 Constraint 901 1001 5.1168 6.3960 12.7919 77.3072 Constraint 176 950 5.6104 7.0130 14.0261 76.8801 Constraint 195 825 5.2990 6.6238 13.2476 75.3701 Constraint 368 738 5.2271 6.5339 13.0679 75.1214 Constraint 324 392 3.9243 4.9054 9.8108 74.7796 Constraint 217 844 6.3404 7.9255 15.8510 74.3443 Constraint 600 825 5.5722 6.9653 13.9305 70.1521 Constraint 341 419 4.6107 5.7633 11.5267 69.4983 Constraint 341 446 5.8704 7.3380 14.6759 68.0659 Constraint 324 725 4.7574 5.9467 11.8934 67.4252 Constraint 245 858 5.4573 6.8217 13.6433 66.2630 Constraint 253 600 6.1482 7.6852 15.3705 65.6158 Constraint 150 950 5.3838 6.7298 13.4596 65.2407 Constraint 302 849 6.1012 7.6265 15.2531 65.1848 Constraint 399 685 4.5276 5.6595 11.3190 63.8970 Constraint 302 600 5.2251 6.5313 13.0626 63.6323 Constraint 187 287 5.8835 7.3544 14.7089 61.9568 Constraint 158 287 4.9846 6.2307 12.4615 61.9568 Constraint 245 887 5.3731 6.7164 13.4329 61.0184 Constraint 536 707 6.0543 7.5679 15.1359 60.8116 Constraint 293 451 5.7166 7.1457 14.2914 60.3727 Constraint 324 809 4.8137 6.0172 12.0344 60.0185 Constraint 324 858 5.6741 7.0926 14.1852 59.1383 Constraint 293 536 5.8557 7.3196 14.6393 58.9035 Constraint 293 428 5.1208 6.4009 12.8019 58.9035 Constraint 738 809 5.2463 6.5579 13.1157 57.2907 Constraint 245 801 5.0611 6.3263 12.6527 57.0747 Constraint 293 510 5.9725 7.4656 14.9313 53.6497 Constraint 336 833 5.6267 7.0334 14.0667 53.4453 Constraint 544 623 6.1333 7.6666 15.3332 53.3231 Constraint 310 858 5.4916 6.8645 13.7290 53.3200 Constraint 302 564 5.9212 7.4015 14.8030 53.2482 Constraint 195 849 3.9933 4.9916 9.9832 52.4993 Constraint 302 738 5.6271 7.0339 14.0678 52.4509 Constraint 240 825 5.3921 6.7402 13.4804 51.6266 Constraint 310 825 3.7807 4.7259 9.4518 50.2727 Constraint 231 600 5.7766 7.2208 14.4416 50.0271 Constraint 176 878 6.0070 7.5087 15.0174 49.9343 Constraint 150 909 5.7889 7.2361 14.4722 49.1180 Constraint 310 833 4.6528 5.8160 11.6320 47.6766 Constraint 310 801 4.7341 5.9176 11.8352 47.6766 Constraint 623 696 4.9066 6.1332 12.2664 46.6192 Constraint 143 955 5.9650 7.4562 14.9124 46.5060 Constraint 176 909 5.7208 7.1510 14.3021 46.5042 Constraint 217 927 5.3956 6.7445 13.4889 44.2624 Constraint 413 707 6.1441 7.6802 15.3603 44.1066 Constraint 357 833 6.1405 7.6756 15.3512 42.7355 Constraint 195 878 5.0007 6.2508 12.5017 42.1437 Constraint 608 801 6.2594 7.8242 15.6484 41.5042 Constraint 176 955 6.1098 7.6373 15.2746 41.4743 Constraint 226 833 5.8305 7.2881 14.5762 41.3862 Constraint 176 276 6.1037 7.6297 15.2593 41.0160 Constraint 276 825 4.2471 5.3088 10.6177 40.8720 Constraint 341 536 6.2551 7.8188 15.6377 40.6321 Constraint 349 732 5.7891 7.2363 14.4726 40.6228 Constraint 260 801 5.4514 6.8142 13.6284 40.2147 Constraint 217 600 5.2827 6.6033 13.2067 39.6577 Constraint 120 927 5.5466 6.9333 13.8665 39.5498 Constraint 143 927 5.3405 6.6757 13.3514 39.3711 Constraint 240 793 5.9585 7.4482 14.8963 39.0054 Constraint 231 793 4.3714 5.4642 10.9284 38.9962 Constraint 245 833 5.1727 6.4658 12.9316 38.7306 Constraint 187 869 4.7080 5.8849 11.7699 37.9638 Constraint 927 1001 5.0801 6.3502 12.7003 37.9403 Constraint 392 685 4.8647 6.0809 12.1618 37.9018 Constraint 260 555 5.9004 7.3754 14.7509 37.1735 Constraint 399 664 4.6655 5.8319 11.6638 36.0913 Constraint 176 940 4.5890 5.7363 11.4725 35.2731 Constraint 324 528 6.0894 7.6118 15.2235 34.8220 Constraint 276 793 5.6044 7.0055 14.0110 34.7381 Constraint 616 714 5.2659 6.5824 13.1648 34.7087 Constraint 336 564 5.5972 6.9966 13.9931 34.6307 Constraint 253 793 5.9605 7.4506 14.9013 34.5627 Constraint 195 844 6.2299 7.7874 15.5747 34.5185 Constraint 940 1025 5.5520 6.9400 13.8800 34.0786 Constraint 240 887 4.6507 5.8134 11.6268 33.0973 Constraint 267 564 5.2766 6.5958 13.1915 32.8725 Constraint 384 685 4.0571 5.0713 10.1427 31.8974 Constraint 600 771 4.9222 6.1527 12.3054 31.8457 Constraint 406 657 6.0293 7.5366 15.0732 31.7592 Constraint 317 419 5.9127 7.3909 14.7818 31.7262 Constraint 245 600 5.5051 6.8814 13.7627 31.1639 Constraint 187 878 5.6536 7.0671 14.1341 31.0667 Constraint 392 696 4.7184 5.8980 11.7960 30.9883 Constraint 217 833 5.0215 6.2769 12.5539 30.5791 Constraint 368 725 5.1818 6.4773 12.9546 30.5567 Constraint 150 276 5.2829 6.6037 13.2073 30.5070 Constraint 657 732 4.4343 5.5429 11.0858 30.2661 Constraint 392 707 4.8441 6.0551 12.1102 30.1393 Constraint 384 657 4.8438 6.0548 12.1095 29.1640 Constraint 368 732 5.2087 6.5108 13.0216 28.9330 Constraint 399 657 5.0584 6.3230 12.6460 28.7392 Constraint 869 1001 5.0943 6.3678 12.7357 28.7161 Constraint 310 428 4.7899 5.9874 11.9748 28.2695 Constraint 349 725 6.1339 7.6673 15.3347 28.2432 Constraint 357 725 5.1774 6.4718 12.9435 27.8698 Constraint 260 528 5.2950 6.6187 13.2375 27.5357 Constraint 324 746 4.9556 6.1945 12.3889 27.1958 Constraint 901 1025 4.9626 6.2033 12.4065 27.1277 Constraint 384 771 5.9421 7.4276 14.8552 27.0767 Constraint 267 600 5.6721 7.0902 14.1803 26.2609 Constraint 341 825 4.6343 5.7929 11.5857 26.1133 Constraint 217 932 5.4695 6.8369 13.6739 25.9330 Constraint 384 746 5.6622 7.0778 14.1556 25.9129 Constraint 384 707 4.4088 5.5110 11.0220 25.6184 Constraint 368 771 6.1823 7.7279 15.4558 25.5904 Constraint 293 608 6.3153 7.8941 15.7883 25.4768 Constraint 310 564 5.2340 6.5425 13.0850 25.4197 Constraint 302 471 5.0103 6.2629 12.5258 25.4197 Constraint 649 725 4.7843 5.9803 11.9607 25.1145 Constraint 302 608 6.2507 7.8134 15.6267 24.9677 Constraint 357 738 4.3721 5.4651 10.9302 24.9274 Constraint 357 428 4.7449 5.9312 11.8624 24.8931 Constraint 616 752 5.0599 6.3248 12.6496 24.6660 Constraint 267 793 6.1318 7.6648 15.3295 24.3643 Constraint 406 685 5.7150 7.1437 14.2874 24.3405 Constraint 869 961 5.7800 7.2250 14.4499 23.9731 Constraint 608 714 4.7151 5.8939 11.7878 23.3894 Constraint 206 858 5.6836 7.1045 14.2089 23.2274 Constraint 887 1025 5.0315 6.2894 12.5787 23.1667 Constraint 349 446 4.4774 5.5967 11.1935 22.9227 Constraint 310 510 6.1874 7.7342 15.4685 22.8323 Constraint 384 752 6.3659 7.9574 15.9148 22.7801 Constraint 217 801 5.9627 7.4534 14.9067 22.7246 Constraint 260 833 4.9009 6.1261 12.2522 22.4395 Constraint 231 849 4.5960 5.7450 11.4899 21.9136 Constraint 195 887 4.4815 5.6019 11.2038 21.4326 Constraint 187 927 5.2892 6.6115 13.2229 21.1895 Constraint 341 746 3.4614 4.3267 8.6535 21.1878 Constraint 302 451 5.3204 6.6506 13.3011 21.0953 Constraint 143 916 4.9076 6.1346 12.2691 21.0375 Constraint 217 869 5.4573 6.8217 13.6433 21.0198 Constraint 399 732 5.8429 7.3036 14.6073 21.0143 Constraint 600 752 4.6472 5.8090 11.6180 21.0027 Constraint 336 608 5.9577 7.4471 14.8942 20.9945 Constraint 217 293 5.5925 6.9907 13.9813 20.9867 Constraint 349 428 4.7478 5.9347 11.8694 20.8525 Constraint 206 955 6.3464 7.9330 15.8659 20.7269 Constraint 206 950 6.2354 7.7943 15.5886 20.7269 Constraint 206 927 5.1067 6.3834 12.7668 20.7269 Constraint 165 955 5.0957 6.3696 12.7393 20.7269 Constraint 95 1093 6.3566 7.9458 15.8916 20.6523 Constraint 341 714 4.9876 6.2345 12.4691 20.6477 Constraint 245 901 4.8168 6.0210 12.0421 20.4973 Constraint 240 901 4.8791 6.0989 12.1977 20.4973 Constraint 50 143 5.4177 6.7722 13.5443 20.3656 Constraint 357 732 5.2626 6.5782 13.1564 20.2518 Constraint 336 793 4.5299 5.6624 11.3248 20.2518 Constraint 336 738 5.7870 7.2338 14.4676 20.2518 Constraint 336 600 5.3878 6.7347 13.4695 20.2518 Constraint 310 555 5.9258 7.4072 14.8144 20.2518 Constraint 302 528 3.8592 4.8239 9.6479 20.2518 Constraint 302 510 5.6947 7.1183 14.2366 20.2518 Constraint 384 446 4.9344 6.1680 12.3359 20.2383 Constraint 608 752 5.0101 6.2626 12.5251 20.2307 Constraint 406 664 3.9035 4.8794 9.7587 20.1820 Constraint 324 451 4.9513 6.1891 12.3782 20.1518 Constraint 932 1017 4.1717 5.2147 10.4293 20.1453 Constraint 623 738 5.6975 7.1218 14.2437 20.0580 Constraint 858 1001 5.4179 6.7723 13.5447 19.7007 Constraint 927 1025 4.6656 5.8320 11.6640 19.6574 Constraint 50 136 4.8256 6.0320 12.0639 19.6414 Constraint 42 136 4.9770 6.2213 12.4426 19.6414 Constraint 349 746 3.5790 4.4737 8.9475 19.6215 Constraint 310 1033 4.8879 6.1099 12.2198 19.6126 Constraint 143 887 5.1470 6.4337 12.8674 19.2433 Constraint 349 858 4.6280 5.7850 11.5699 18.9758 Constraint 158 267 5.6111 7.0139 14.0278 18.8676 Constraint 129 276 5.2325 6.5406 13.0813 18.8676 Constraint 471 1052 6.1464 7.6830 15.3659 18.6499 Constraint 460 1082 5.9212 7.4015 14.8031 18.6499 Constraint 460 1059 4.6486 5.8107 11.6214 18.6499 Constraint 460 1052 2.9476 3.6845 7.3689 18.6499 Constraint 357 1012 5.9186 7.3983 14.7966 18.6499 Constraint 302 1001 6.2564 7.8205 15.6411 18.6499 Constraint 217 909 5.8212 7.2766 14.5531 18.4743 Constraint 878 969 6.0531 7.5664 15.1328 17.9982 Constraint 293 793 5.6753 7.0941 14.1882 17.9131 Constraint 634 738 5.2499 6.5624 13.1248 17.8816 Constraint 536 732 4.6308 5.7885 11.5771 17.8816 Constraint 428 732 5.7094 7.1368 14.2736 17.8816 Constraint 406 732 5.8008 7.2510 14.5019 17.8816 Constraint 600 782 6.2017 7.7521 15.5043 17.8812 Constraint 878 955 6.3172 7.8965 15.7930 17.8572 Constraint 368 801 4.8978 6.1222 12.2445 17.6732 Constraint 253 878 4.5643 5.7054 11.4107 17.5889 Constraint 253 849 3.4348 4.2934 8.5869 17.5889 Constraint 253 844 6.0821 7.6027 15.2053 17.5889 Constraint 245 878 5.5353 6.9192 13.8384 17.5889 Constraint 240 927 4.6020 5.7525 11.5050 17.5889 Constraint 240 878 5.9365 7.4206 14.8412 17.5889 Constraint 67 158 5.0286 6.2857 12.5715 17.5889 Constraint 67 150 4.4306 5.5382 11.0764 17.5889 Constraint 67 143 5.8623 7.3278 14.6557 17.5889 Constraint 67 136 4.1927 5.2409 10.4817 17.5889 Constraint 58 150 4.8501 6.0626 12.1252 17.5889 Constraint 58 143 4.6005 5.7506 11.5013 17.5889 Constraint 58 136 5.8718 7.3398 14.6796 17.5889 Constraint 384 696 4.3469 5.4336 10.8672 17.4451 Constraint 858 1043 5.1489 6.4361 12.8722 17.3799 Constraint 336 528 4.7157 5.8946 11.7892 17.3247 Constraint 746 825 5.3478 6.6847 13.3694 17.2792 Constraint 368 608 4.6814 5.8517 11.7035 17.1572 Constraint 616 707 4.9297 6.1622 12.3243 17.1478 Constraint 608 707 4.9051 6.1313 12.2626 17.1478 Constraint 932 1025 5.4205 6.7756 13.5511 16.9688 Constraint 572 732 6.3087 7.8859 15.7718 16.9253 Constraint 302 809 5.6925 7.1156 14.2311 16.8573 Constraint 950 1017 4.9669 6.2087 12.4173 16.7515 Constraint 226 600 5.7156 7.1444 14.2889 16.7493 Constraint 869 950 4.7673 5.9591 11.9182 16.7368 Constraint 858 950 5.3108 6.6386 13.2771 16.7368 Constraint 276 801 6.1718 7.7147 15.4295 16.7000 Constraint 349 758 5.0474 6.3093 12.6185 16.6364 Constraint 324 732 5.5943 6.9929 13.9858 16.5978 Constraint 384 644 5.8971 7.3713 14.7426 16.1515 Constraint 1033 1101 4.6674 5.8343 11.6685 15.7458 Constraint 1033 1093 5.7466 7.1832 14.3665 15.7458 Constraint 858 1025 5.1923 6.4904 12.9808 15.7165 Constraint 909 1025 5.4175 6.7719 13.5438 15.6915 Constraint 341 707 5.7250 7.1563 14.3125 15.5266 Constraint 226 801 6.0314 7.5392 15.0784 15.5217 Constraint 276 471 5.6910 7.1138 14.2275 15.4954 Constraint 217 564 4.9528 6.1909 12.3819 15.4817 Constraint 217 555 5.1129 6.3912 12.7823 15.4817 Constraint 336 399 5.1936 6.4920 12.9841 15.4290 Constraint 413 664 5.4984 6.8730 13.7460 15.3265 Constraint 226 324 5.3739 6.7173 13.4347 15.2234 Constraint 927 992 5.2476 6.5595 13.1190 15.1928 Constraint 206 825 5.3013 6.6266 13.2531 15.1803 Constraint 293 502 5.4507 6.8134 13.6269 14.9812 Constraint 357 451 5.5231 6.9039 13.8079 14.9221 Constraint 276 502 5.3889 6.7361 13.4722 14.8904 Constraint 95 1067 5.0626 6.3283 12.6566 14.8829 Constraint 858 1033 5.3174 6.6468 13.2935 14.5724 Constraint 887 1067 4.9200 6.1501 12.3001 14.5518 Constraint 349 600 6.1066 7.6332 15.2664 14.5210 Constraint 357 608 5.4662 6.8327 13.6654 14.4582 Constraint 349 451 5.3047 6.6309 13.2619 14.4582 Constraint 336 825 5.1596 6.4495 12.8990 14.4582 Constraint 317 849 5.2182 6.5227 13.0455 14.4582 Constraint 317 825 4.9353 6.1691 12.3382 14.4582 Constraint 317 793 5.9220 7.4024 14.8049 14.4582 Constraint 406 673 6.1022 7.6278 15.2556 14.4149 Constraint 336 536 5.7920 7.2400 14.4801 14.3789 Constraint 901 969 4.4865 5.6081 11.2162 14.3313 Constraint 150 916 6.2576 7.8220 15.6439 14.1397 Constraint 336 801 4.9122 6.1403 12.2805 14.1302 Constraint 460 1038 3.7663 4.7078 9.4156 14.1181 Constraint 451 1038 5.2916 6.6145 13.2290 14.1181 Constraint 357 986 4.8445 6.0556 12.1112 14.1181 Constraint 336 1012 5.0513 6.3141 12.6282 14.1181 Constraint 310 1012 4.3676 5.4595 10.9189 14.1181 Constraint 310 1001 5.7465 7.1831 14.3661 14.1181 Constraint 120 1025 5.1077 6.3846 12.7692 14.1181 Constraint 95 1043 5.2613 6.5766 13.1533 14.1181 Constraint 206 901 5.8315 7.2893 14.5787 14.0324 Constraint 909 1017 4.4796 5.5995 11.1989 13.9352 Constraint 392 664 5.3097 6.6371 13.2742 13.8577 Constraint 384 664 4.7527 5.9409 11.8817 13.7895 Constraint 460 1135 5.1508 6.4385 12.8769 13.7682 Constraint 287 523 5.4765 6.8456 13.6913 13.7610 Constraint 927 1059 5.5042 6.8803 13.7605 13.7063 Constraint 187 793 4.8145 6.0182 12.0364 13.5719 Constraint 341 858 5.4128 6.7660 13.5321 13.5295 Constraint 901 1043 3.6086 4.5107 9.0214 13.4611 Constraint 240 932 5.7301 7.1626 14.3253 13.4104 Constraint 1025 1093 5.5821 6.9776 13.9552 13.3892 Constraint 287 555 5.7217 7.1521 14.3043 13.3820 Constraint 564 746 6.0903 7.6129 15.2258 13.3005 Constraint 887 1033 4.6505 5.8132 11.6263 13.0986 Constraint 932 1012 5.9414 7.4267 14.8534 13.0081 Constraint 927 1067 4.5024 5.6280 11.2559 12.9342 Constraint 302 887 6.0332 7.5415 15.0829 12.7924 Constraint 341 634 6.3018 7.8773 15.7545 12.7869 Constraint 932 1043 5.6292 7.0365 14.0729 12.5505 Constraint 349 419 6.0753 7.5941 15.1883 12.5159 Constraint 916 1067 4.5498 5.6873 11.3746 12.4788 Constraint 287 564 5.3678 6.7097 13.4194 12.4537 Constraint 276 451 5.7470 7.1838 14.3676 12.4537 Constraint 143 858 5.3812 6.7265 13.4530 12.3455 Constraint 932 1038 4.8179 6.0224 12.0448 12.1458 Constraint 600 809 6.3639 7.9549 15.9098 12.1134 Constraint 399 536 5.5583 6.9479 13.8958 12.1063 Constraint 206 302 6.1095 7.6368 15.2736 12.1028 Constraint 536 696 5.4370 6.7963 13.5926 12.0055 Constraint 738 825 4.6990 5.8737 11.7475 11.9477 Constraint 536 714 5.2885 6.6107 13.2213 11.8852 Constraint 368 825 5.8103 7.2629 14.5258 11.8796 Constraint 240 858 6.2041 7.7552 15.5103 11.8351 Constraint 176 267 5.6197 7.0247 14.0493 11.8012 Constraint 916 1025 5.1905 6.4881 12.9761 11.7743 Constraint 260 451 5.3051 6.6313 13.2627 11.7422 Constraint 195 833 5.2414 6.5517 13.1034 11.7177 Constraint 187 844 5.6151 7.0189 14.0378 11.7177 Constraint 176 869 5.1763 6.4704 12.9407 11.7177 Constraint 150 869 4.4928 5.6160 11.2321 11.7177 Constraint 120 955 6.3851 7.9814 15.9628 11.6394 Constraint 114 927 6.0954 7.6193 15.2385 11.6110 Constraint 143 986 6.3103 7.8879 15.7758 11.5150 Constraint 114 986 4.3802 5.4753 10.9505 11.5150 Constraint 85 1043 5.0385 6.2981 12.5962 11.4408 Constraint 849 1067 4.9546 6.1933 12.3865 11.1953 Constraint 844 1067 5.4173 6.7716 13.5433 11.1953 Constraint 600 732 5.6470 7.0588 14.1175 11.1885 Constraint 240 555 5.0977 6.3722 12.7443 11.1815 Constraint 165 887 4.2098 5.2622 10.5244 11.0770 Constraint 165 858 5.4721 6.8401 13.6803 11.0770 Constraint 165 276 4.7171 5.8964 11.7929 11.0770 Constraint 158 932 5.1005 6.3757 12.7514 11.0770 Constraint 158 916 5.8561 7.3201 14.6402 11.0770 Constraint 158 887 4.5191 5.6489 11.2978 11.0770 Constraint 143 276 5.1369 6.4211 12.8422 11.0770 Constraint 136 932 4.8806 6.1008 12.2015 11.0770 Constraint 136 887 6.3142 7.8927 15.7854 11.0770 Constraint 129 932 6.1721 7.7151 15.4303 11.0770 Constraint 849 961 5.1652 6.4566 12.9131 10.9560 Constraint 18 114 6.2561 7.8201 15.6401 10.9411 Constraint 738 833 4.9847 6.2308 12.4617 10.9315 Constraint 253 887 6.3384 7.9229 15.8459 10.8527 Constraint 240 916 3.3870 4.2337 8.4675 10.8527 Constraint 927 1017 4.9485 6.1856 12.3712 10.8326 Constraint 1038 1106 4.3952 5.4940 10.9880 10.7974 Constraint 341 809 5.3125 6.6406 13.2812 10.7879 Constraint 357 419 4.7137 5.8922 11.7843 10.7763 Constraint 406 471 5.1559 6.4448 12.8897 10.7231 Constraint 187 600 5.1410 6.4262 12.8525 10.7101 Constraint 869 1025 6.1032 7.6290 15.2581 10.5819 Constraint 58 206 4.6335 5.7919 11.5838 10.2201 Constraint 752 825 4.6757 5.8447 11.6893 10.1594 Constraint 384 673 5.5490 6.9362 13.8725 10.0866 Constraint 446 1115 4.0152 5.0190 10.0380 9.9889 Constraint 446 1093 5.4827 6.8534 13.7068 9.9889 Constraint 441 1093 5.0609 6.3262 12.6523 9.9889 Constraint 441 1082 6.1294 7.6617 15.3235 9.9889 Constraint 357 1115 5.4245 6.7806 13.5612 9.9889 Constraint 336 1115 6.3009 7.8762 15.7524 9.9889 Constraint 858 940 4.1042 5.1302 10.2605 9.9655 Constraint 916 1093 5.2362 6.5453 13.0906 9.9609 Constraint 616 696 5.4388 6.7985 13.5969 9.9354 Constraint 608 696 4.2453 5.3067 10.6133 9.9354 Constraint 572 714 5.7147 7.1433 14.2867 9.8151 Constraint 428 714 6.0239 7.5298 15.0597 9.8151 Constraint 399 510 4.8815 6.1019 12.2037 9.8128 Constraint 901 1038 6.2915 7.8643 15.7287 9.7881 Constraint 276 1033 6.3355 7.9193 15.8386 9.7374 Constraint 58 217 5.1359 6.4198 12.8397 9.6632 Constraint 428 696 6.2222 7.7777 15.5554 9.5435 Constraint 341 833 4.7299 5.9124 11.8247 9.5259 Constraint 165 916 6.1093 7.6366 15.2732 9.4265 Constraint 392 738 5.9202 7.4003 14.8006 9.3158 Constraint 600 714 5.7114 7.1392 14.2784 9.3036 Constraint 406 649 5.7860 7.2325 14.4651 9.2783 Constraint 955 1115 5.9343 7.4179 14.8358 9.2448 Constraint 460 1033 6.2985 7.8731 15.7462 9.2120 Constraint 58 955 5.3421 6.6776 13.3552 9.1850 Constraint 50 206 5.4688 6.8360 13.6721 9.1850 Constraint 33 961 4.7234 5.9042 11.8084 9.1850 Constraint 33 955 6.3462 7.9327 15.8654 9.1850 Constraint 18 961 5.6511 7.0639 14.1278 9.1850 Constraint 18 955 4.2396 5.2995 10.5990 9.1850 Constraint 341 793 4.9989 6.2486 12.4973 9.1813 Constraint 50 195 4.5529 5.6911 11.3822 9.1477 Constraint 67 217 4.3846 5.4807 10.9614 9.1319 Constraint 67 195 4.8085 6.0107 12.0213 9.0903 Constraint 245 869 4.7897 5.9871 11.9742 9.0621 Constraint 752 833 5.6910 7.1138 14.2276 9.0057 Constraint 245 324 5.8107 7.2634 14.5268 8.9661 Constraint 240 600 5.1660 6.4576 12.9151 8.9661 Constraint 240 564 4.8954 6.1192 12.2384 8.9661 Constraint 1025 1101 5.7471 7.1838 14.3676 8.8941 Constraint 572 696 5.9524 7.4405 14.8810 8.8295 Constraint 341 696 4.9785 6.2231 12.4462 8.8295 Constraint 287 825 6.3004 7.8755 15.7510 8.7815 Constraint 887 961 5.9269 7.4086 14.8172 8.7005 Constraint 887 1001 5.0602 6.3252 12.6504 8.6730 Constraint 67 206 5.6869 7.1086 14.2171 8.6537 Constraint 955 1126 5.9669 7.4586 14.9172 8.6516 Constraint 950 1126 4.7698 5.9623 11.9245 8.6516 Constraint 916 1126 4.8846 6.1057 12.2114 8.6516 Constraint 317 399 5.0019 6.2524 12.5047 8.6213 Constraint 1038 1115 5.4753 6.8442 13.6883 8.5558 Constraint 1033 1106 5.6132 7.0164 14.0329 8.5558 Constraint 357 801 5.4743 6.8428 13.6856 8.5301 Constraint 253 801 5.9911 7.4889 14.9778 8.5139 Constraint 940 1067 4.5761 5.7201 11.4402 8.4971 Constraint 909 1043 4.1420 5.1775 10.3550 8.3364 Constraint 887 1093 4.5051 5.6313 11.2626 8.2771 Constraint 901 1017 4.9220 6.1525 12.3051 8.2563 Constraint 217 451 5.5175 6.8969 13.7939 8.2556 Constraint 349 869 5.3996 6.7495 13.4991 8.2444 Constraint 940 1017 4.1685 5.2107 10.4213 8.2435 Constraint 1038 1101 4.7615 5.9518 11.9037 8.1135 Constraint 406 496 6.1274 7.6593 15.3186 8.0809 Constraint 901 992 5.2056 6.5070 13.0140 8.0140 Constraint 833 1001 4.4622 5.5777 11.1554 7.9929 Constraint 226 887 4.3717 5.4646 10.9292 7.9837 Constraint 245 564 5.8846 7.3557 14.7115 7.8732 Constraint 302 502 4.7079 5.8849 11.7699 7.7359 Constraint 1001 1126 6.3374 7.9217 15.8434 7.6323 Constraint 1001 1101 6.1734 7.7168 15.4336 7.6323 Constraint 120 858 5.7591 7.1989 14.3977 7.6323 Constraint 245 555 5.6007 7.0009 14.0018 7.6211 Constraint 67 226 5.0056 6.2570 12.5140 7.6187 Constraint 58 932 3.6471 4.5589 9.1178 7.6187 Constraint 33 932 5.4475 6.8093 13.6187 7.6187 Constraint 324 758 6.2811 7.8514 15.7029 7.5743 Constraint 849 1001 4.4498 5.5622 11.1245 7.5469 Constraint 849 1043 5.7634 7.2043 14.4086 7.5462 Constraint 849 940 4.7070 5.8837 11.7674 7.5401 Constraint 916 1017 4.7327 5.9159 11.8319 7.5366 Constraint 287 460 5.7180 7.1475 14.2950 7.4581 Constraint 336 510 6.0626 7.5782 15.1565 7.3910 Constraint 302 869 5.1975 6.4968 12.9937 7.3847 Constraint 302 844 5.5546 6.9433 13.8865 7.3847 Constraint 293 833 6.3452 7.9315 15.8630 7.3847 Constraint 150 849 6.3358 7.9198 15.8396 7.3847 Constraint 231 302 5.5224 6.9030 13.8060 7.3598 Constraint 1038 1126 4.5882 5.7352 11.4704 7.2941 Constraint 1033 1126 6.0118 7.5148 15.0296 7.2941 Constraint 1033 1115 4.5031 5.6288 11.2577 7.2941 Constraint 1025 1115 5.7128 7.1410 14.2820 7.2941 Constraint 1025 1106 4.1970 5.2462 10.4924 7.2941 Constraint 1017 1106 5.4317 6.7896 13.5792 7.2941 Constraint 143 901 4.4775 5.5968 11.1937 7.2566 Constraint 114 932 6.1396 7.6744 15.3489 7.2566 Constraint 392 623 6.3068 7.8835 15.7671 7.2453 Constraint 392 510 6.2132 7.7665 15.5330 7.2453 Constraint 341 510 5.5317 6.9146 13.8292 7.2453 Constraint 317 502 4.3158 5.3947 10.7895 7.2453 Constraint 267 502 5.8567 7.3209 14.6418 7.2453 Constraint 253 555 4.3088 5.3860 10.7720 7.2453 Constraint 950 1135 5.6855 7.1068 14.2136 7.2319 Constraint 887 1101 5.4181 6.7726 13.5452 7.2308 Constraint 129 1033 5.1996 6.4995 12.9990 7.2091 Constraint 129 1025 6.1794 7.7243 15.4486 7.2091 Constraint 103 1067 6.3785 7.9731 15.9462 7.2091 Constraint 95 1033 6.3787 7.9733 15.9467 7.2091 Constraint 95 1025 3.9826 4.9782 9.9565 7.2091 Constraint 75 1067 3.5773 4.4716 8.9432 7.2091 Constraint 75 1043 5.5159 6.8949 13.7897 7.2091 Constraint 67 1043 5.7140 7.1425 14.2850 7.2091 Constraint 58 195 5.5189 6.8986 13.7972 7.0874 Constraint 392 657 5.5462 6.9328 13.8655 7.0527 Constraint 887 1017 6.0472 7.5590 15.1180 6.9247 Constraint 833 1033 4.3297 5.4122 10.8243 6.9221 Constraint 217 302 4.4468 5.5585 11.1171 6.9090 Constraint 150 1033 5.1630 6.4537 12.9074 6.9090 Constraint 150 1025 6.1845 7.7306 15.4611 6.9090 Constraint 143 1025 6.2637 7.8296 15.6592 6.9090 Constraint 143 1001 5.7227 7.1533 14.3067 6.9090 Constraint 129 1067 6.3667 7.9584 15.9168 6.9090 Constraint 120 1043 5.0318 6.2898 12.5795 6.9090 Constraint 120 1033 6.3707 7.9633 15.9267 6.9090 Constraint 120 1001 4.7673 5.9591 11.9183 6.9090 Constraint 114 1001 3.8809 4.8511 9.7022 6.9090 Constraint 85 1001 4.8829 6.1037 12.2073 6.9090 Constraint 50 129 6.3582 7.9478 15.8955 6.9090 Constraint 50 120 3.9634 4.9543 9.9085 6.9090 Constraint 253 324 4.8355 6.0444 12.0888 6.9077 Constraint 240 833 5.2478 6.5598 13.1196 6.9037 Constraint 240 801 5.9322 7.4153 14.8306 6.9037 Constraint 231 801 4.3680 5.4600 10.9199 6.9037 Constraint 195 858 3.5262 4.4078 8.8156 6.9037 Constraint 217 955 6.0656 7.5820 15.1639 6.8885 Constraint 67 1093 6.3566 7.9458 15.8916 6.8841 Constraint 324 782 6.3803 7.9754 15.9509 6.8169 Constraint 260 782 5.8303 7.2879 14.5758 6.8169 Constraint 317 801 5.4635 6.8294 13.6587 6.8077 Constraint 317 738 5.4406 6.8008 13.6016 6.8077 Constraint 310 392 6.2696 7.8370 15.6740 6.8077 Constraint 293 801 4.1436 5.1795 10.3591 6.8077 Constraint 293 738 6.3271 7.9089 15.8178 6.8077 Constraint 287 536 6.1684 7.7104 15.4209 6.8077 Constraint 287 428 5.7299 7.1623 14.3247 6.8077 Constraint 253 901 6.3182 7.8977 15.7955 6.7362 Constraint 310 600 6.3006 7.8757 15.7515 6.7223 Constraint 267 336 6.1595 7.6994 15.3988 6.7223 Constraint 287 446 6.0249 7.5312 15.0624 6.6116 Constraint 260 502 5.2459 6.5573 13.1147 6.6116 Constraint 260 471 3.9856 4.9820 9.9640 6.6116 Constraint 260 460 5.4287 6.7859 13.5718 6.6116 Constraint 738 858 5.5344 6.9180 13.8361 6.6005 Constraint 600 725 5.7667 7.2083 14.4167 6.5673 Constraint 349 608 5.6792 7.0990 14.1980 6.5400 Constraint 341 451 5.5041 6.8801 13.7603 6.5400 Constraint 909 977 6.0398 7.5497 15.0994 6.4798 Constraint 50 165 4.6050 5.7563 11.5126 6.3538 Constraint 349 714 3.8539 4.8174 9.6348 6.3068 Constraint 349 752 5.6006 7.0007 14.0015 6.2654 Constraint 302 950 4.5168 5.6460 11.2920 6.2354 Constraint 195 793 5.5330 6.9163 13.8326 6.2010 Constraint 909 1093 5.4296 6.7870 13.5740 6.1841 Constraint 58 187 4.9872 6.2340 12.4679 6.1707 Constraint 187 932 5.5041 6.8801 13.7602 6.1424 Constraint 324 849 5.4193 6.7742 13.5483 6.1420 Constraint 276 858 5.3332 6.6665 13.3331 6.1340 Constraint 67 932 5.5193 6.8991 13.7982 6.0523 Constraint 67 909 6.2579 7.8223 15.6446 6.0523 Constraint 42 195 5.2063 6.5079 13.0159 6.0523 Constraint 932 1059 5.0210 6.2762 12.5525 5.9577 Constraint 950 1144 5.8945 7.3681 14.7362 5.9198 Constraint 428 707 5.8305 7.2881 14.5762 5.8884 Constraint 758 844 4.7810 5.9763 11.9526 5.8825 Constraint 758 833 4.1809 5.2261 10.4522 5.8825 Constraint 909 1126 4.3238 5.4048 10.8096 5.8603 Constraint 887 1043 3.3586 4.1982 8.3965 5.8536 Constraint 368 833 5.0691 6.3364 12.6729 5.7936 Constraint 324 471 6.2105 7.7631 15.5263 5.7936 Constraint 317 858 4.7853 5.9816 11.9632 5.7936 Constraint 368 758 5.4502 6.8128 13.6256 5.7684 Constraint 293 725 6.3827 7.9784 15.9567 5.7546 Constraint 95 165 5.1384 6.4230 12.8461 5.7128 Constraint 310 950 5.6396 7.0495 14.0991 5.7122 Constraint 276 955 5.8496 7.3120 14.6241 5.7122 Constraint 276 950 2.7658 3.4573 6.9146 5.7122 Constraint 324 510 5.6778 7.0972 14.1944 5.6936 Constraint 276 510 5.7291 7.1614 14.3229 5.6460 Constraint 50 176 5.2651 6.5814 13.1628 5.6296 Constraint 42 165 5.2899 6.6124 13.2249 5.6198 Constraint 809 901 4.3912 5.4890 10.9780 5.5710 Constraint 825 955 5.0975 6.3719 12.7437 5.4518 Constraint 217 324 5.2905 6.6131 13.2261 5.3951 Constraint 901 1012 5.5817 6.9772 13.9543 5.3901 Constraint 927 1093 4.7177 5.8972 11.7943 5.3417 Constraint 1017 1082 5.1597 6.4496 12.8992 5.3416 Constraint 940 1012 6.1744 7.7180 15.4360 5.3265 Constraint 901 1059 5.5157 6.8946 13.7891 5.3265 Constraint 844 1001 5.2409 6.5511 13.1022 5.2957 Constraint 349 782 5.0576 6.3220 12.6439 5.2397 Constraint 187 758 4.2138 5.2673 10.5346 5.1752 Constraint 176 758 5.8647 7.3309 14.6618 5.1752 Constraint 310 536 5.6784 7.0980 14.1959 5.1679 Constraint 231 564 5.4617 6.8271 13.6541 5.1530 Constraint 226 460 5.4839 6.8548 13.7097 5.1424 Constraint 226 451 6.0249 7.5311 15.0622 5.1424 Constraint 103 176 5.2353 6.5441 13.0883 5.1363 Constraint 324 536 5.5819 6.9774 13.9549 5.0929 Constraint 932 1067 5.1432 6.4289 12.8579 5.0471 Constraint 732 833 3.2996 4.1245 8.2489 5.0470 Constraint 732 825 6.0587 7.5734 15.1468 5.0470 Constraint 732 809 5.5462 6.9328 13.8655 5.0470 Constraint 725 844 6.1311 7.6638 15.3277 5.0470 Constraint 725 833 3.9083 4.8854 9.7707 5.0470 Constraint 725 825 4.8163 6.0204 12.0408 5.0470 Constraint 725 809 3.9797 4.9746 9.9492 5.0470 Constraint 324 384 5.6482 7.0603 14.1206 4.9988 Constraint 644 725 5.3967 6.7459 13.4918 4.9952 Constraint 927 1126 5.4113 6.7641 13.5283 4.9493 Constraint 878 1126 5.9820 7.4775 14.9549 4.9430 Constraint 878 1101 5.8831 7.3539 14.7077 4.9430 Constraint 878 1093 3.9096 4.8870 9.7740 4.9430 Constraint 878 1067 4.2991 5.3739 10.7479 4.9430 Constraint 42 1067 6.3913 7.9891 15.9783 4.9061 Constraint 909 992 4.2495 5.3118 10.6237 4.8663 Constraint 600 858 4.7699 5.9623 11.9246 4.8573 Constraint 825 950 5.7930 7.2413 14.4825 4.8551 Constraint 187 324 5.1224 6.4030 12.8059 4.8274 Constraint 869 969 5.0558 6.3197 12.6394 4.7132 Constraint 206 909 5.8102 7.2627 14.5254 4.7132 Constraint 165 927 6.1780 7.7224 15.4449 4.7132 Constraint 95 564 5.4541 6.8176 13.6353 4.6713 Constraint 50 187 4.9515 6.1893 12.3787 4.6617 Constraint 42 187 5.0331 6.2914 12.5829 4.6520 Constraint 206 887 4.4626 5.5783 11.1566 4.6060 Constraint 67 187 4.5304 5.6630 11.3261 4.6043 Constraint 869 1012 5.1070 6.3837 12.7675 4.5814 Constraint 844 1012 5.2203 6.5254 13.0507 4.5814 Constraint 187 909 6.2306 7.7882 15.5765 4.5761 Constraint 809 950 4.8691 6.0864 12.1728 4.5742 Constraint 616 758 5.0589 6.3237 12.6474 4.5671 Constraint 357 1033 6.2747 7.8434 15.6869 4.5319 Constraint 349 1001 6.0925 7.6156 15.2313 4.5319 Constraint 336 1033 5.0541 6.3176 12.6351 4.5319 Constraint 310 1025 5.7551 7.1939 14.3877 4.5319 Constraint 302 1025 6.3620 7.9525 15.9050 4.5319 Constraint 226 927 5.2041 6.5051 13.0102 4.5319 Constraint 217 950 6.2214 7.7767 15.5535 4.5319 Constraint 158 1043 6.2005 7.7506 15.5013 4.5319 Constraint 150 1043 6.2058 7.7573 15.5146 4.5319 Constraint 150 955 6.3795 7.9744 15.9488 4.5319 Constraint 85 158 5.0107 6.2633 12.5267 4.5319 Constraint 80 150 5.0245 6.2807 12.5613 4.5319 Constraint 67 1067 3.5678 4.4597 8.9194 4.5319 Constraint 310 809 5.5200 6.9000 13.8001 4.5318 Constraint 1025 1082 4.6130 5.7663 11.5326 4.4952 Constraint 644 732 5.4182 6.7728 13.5456 4.4815 Constraint 616 833 4.0127 5.0158 10.0317 4.4346 Constraint 608 844 6.0613 7.5766 15.1533 4.4346 Constraint 608 833 4.0286 5.0357 10.0714 4.4346 Constraint 406 809 5.6118 7.0148 14.0295 4.4346 Constraint 399 809 5.2212 6.5265 13.0531 4.4346 Constraint 206 349 4.9583 6.1979 12.3957 4.4296 Constraint 916 1012 5.5267 6.9084 13.8168 4.4241 Constraint 392 649 5.7306 7.1632 14.3264 4.4223 Constraint 217 317 6.3511 7.9389 15.8778 4.4077 Constraint 217 310 4.1372 5.1716 10.3431 4.4077 Constraint 217 287 4.1620 5.2024 10.4049 4.4077 Constraint 940 1038 5.0329 6.2911 12.5822 4.3974 Constraint 368 809 4.3858 5.4822 10.9644 4.3943 Constraint 368 782 4.4151 5.5188 11.0377 4.3943 Constraint 18 85 4.5666 5.7082 11.4165 4.3853 Constraint 42 528 5.6664 7.0830 14.1661 4.3667 Constraint 572 707 5.9353 7.4191 14.8382 4.3442 Constraint 887 969 3.7461 4.6826 9.3652 4.3423 Constraint 869 992 5.0390 6.2987 12.5975 4.3075 Constraint 940 1093 4.6236 5.7795 11.5591 4.3016 Constraint 623 746 5.8323 7.2904 14.5808 4.2864 Constraint 187 510 5.3225 6.6532 13.3063 4.2773 Constraint 869 1033 6.2312 7.7890 15.5780 4.2450 Constraint 616 685 5.3517 6.6896 13.3793 4.2322 Constraint 226 564 5.9471 7.4338 14.8676 4.2267 Constraint 187 746 4.7779 5.9723 11.9447 4.1402 Constraint 176 746 5.2011 6.5013 13.0026 4.1402 Constraint 176 600 5.2346 6.5433 13.0865 4.1402 Constraint 195 600 5.6811 7.1014 14.2027 4.1109 Constraint 217 782 6.2164 7.7706 15.5411 4.1032 Constraint 187 801 5.8476 7.3095 14.6191 4.1032 Constraint 176 833 5.8392 7.2991 14.5981 4.1032 Constraint 176 825 3.1382 3.9228 7.8456 4.1032 Constraint 909 1038 6.2676 7.8345 15.6689 3.9883 Constraint 909 1012 5.0037 6.2547 12.5093 3.8870 Constraint 707 858 4.8096 6.0119 12.0239 3.8844 Constraint 600 685 3.2550 4.0688 8.1376 3.8670 Constraint 226 428 5.8018 7.2522 14.5044 3.8479 Constraint 226 392 5.1146 6.3933 12.7866 3.8479 Constraint 217 446 3.9903 4.9879 9.9758 3.8479 Constraint 217 428 4.5573 5.6966 11.3931 3.8479 Constraint 217 392 5.4058 6.7573 13.5146 3.8479 Constraint 932 1075 4.8116 6.0145 12.0289 3.8377 Constraint 916 1059 4.9762 6.2203 12.4406 3.8377 Constraint 878 1025 5.1532 6.4415 12.8830 3.8154 Constraint 187 564 5.5502 6.9377 13.8755 3.8000 Constraint 341 528 4.3213 5.4016 10.8032 3.7922 Constraint 260 758 5.1581 6.4477 12.8953 3.7852 Constraint 253 758 5.8985 7.3731 14.7462 3.7852 Constraint 245 752 6.1801 7.7252 15.4503 3.7852 Constraint 887 1126 5.9762 7.4703 14.9406 3.7086 Constraint 600 849 4.7113 5.8892 11.7783 3.6764 Constraint 324 901 5.3240 6.6550 13.3101 3.6240 Constraint 833 961 4.4201 5.5252 11.0503 3.6180 Constraint 833 955 5.8375 7.2969 14.5939 3.6180 Constraint 833 950 4.2937 5.3672 10.7343 3.6180 Constraint 825 961 5.3580 6.6975 13.3950 3.6180 Constraint 927 1033 5.2706 6.5883 13.1766 3.6146 Constraint 75 217 5.8013 7.2517 14.5034 3.6109 Constraint 67 176 5.8508 7.3135 14.6269 3.5693 Constraint 67 165 4.2157 5.2697 10.5393 3.5693 Constraint 58 176 4.2936 5.3670 10.7340 3.5693 Constraint 58 165 5.7477 7.1846 14.3692 3.5693 Constraint 801 955 4.6211 5.7764 11.5528 3.5622 Constraint 793 961 5.3761 6.7201 13.4403 3.5622 Constraint 793 955 4.5084 5.6355 11.2711 3.5622 Constraint 869 977 4.4343 5.5429 11.0859 3.4610 Constraint 833 1052 5.3468 6.6835 13.3670 3.4610 Constraint 833 1038 4.8014 6.0017 12.0034 3.4610 Constraint 833 1025 3.8852 4.8565 9.7129 3.4610 Constraint 833 1012 4.7894 5.9867 11.9734 3.4610 Constraint 809 1038 4.9643 6.2053 12.4107 3.4610 Constraint 809 1033 4.9643 6.2053 12.4107 3.4610 Constraint 809 1012 5.3872 6.7340 13.4680 3.4610 Constraint 809 1001 5.4051 6.7563 13.5127 3.4610 Constraint 801 1052 5.2860 6.6075 13.2151 3.4610 Constraint 801 1038 5.3921 6.7402 13.4804 3.4610 Constraint 801 1033 5.3921 6.7402 13.4804 3.4610 Constraint 231 878 4.7763 5.9704 11.9407 3.4519 Constraint 231 844 6.2336 7.7920 15.5841 3.4519 Constraint 226 878 5.6565 7.0706 14.1413 3.4519 Constraint 217 916 3.3233 4.1542 8.3083 3.4519 Constraint 136 217 5.6215 7.0269 14.0538 3.4519 Constraint 129 206 5.7903 7.2379 14.4758 3.4519 Constraint 120 195 4.8986 6.1233 12.2466 3.4519 Constraint 114 187 5.2252 6.5315 13.0630 3.4519 Constraint 267 887 6.2388 7.7985 15.5969 3.4470 Constraint 460 1106 5.1788 6.4735 12.9470 3.4420 Constraint 267 825 5.9086 7.3858 14.7715 3.4403 Constraint 916 1043 5.4710 6.8387 13.6775 3.4234 Constraint 878 1033 4.7682 5.9602 11.9204 3.4234 Constraint 608 685 4.3025 5.3781 10.7562 3.3888 Constraint 564 685 5.8553 7.3191 14.6382 3.3888 Constraint 310 752 4.5613 5.7016 11.4033 3.3888 Constraint 310 746 3.7808 4.7260 9.4520 3.3888 Constraint 310 725 4.5472 5.6840 11.3681 3.3888 Constraint 302 746 5.1736 6.4670 12.9341 3.3888 Constraint 302 725 3.1647 3.9558 7.9116 3.3888 Constraint 302 714 4.4605 5.5757 11.1513 3.3888 Constraint 302 685 4.5746 5.7182 11.4365 3.3888 Constraint 909 1059 5.5165 6.8956 13.7912 3.3823 Constraint 649 801 4.6547 5.8184 11.6368 3.2809 Constraint 649 782 4.8345 6.0431 12.0863 3.2809 Constraint 644 801 6.0964 7.6206 15.2411 3.2809 Constraint 644 793 4.3647 5.4558 10.9117 3.2809 Constraint 644 782 5.4296 6.7870 13.5741 3.2809 Constraint 634 801 4.3141 5.3927 10.7853 3.2809 Constraint 634 793 5.7083 7.1354 14.2708 3.2809 Constraint 623 809 3.8435 4.8043 9.6087 3.2809 Constraint 623 801 4.8951 6.1189 12.2378 3.2809 Constraint 623 793 3.6421 4.5526 9.1052 3.2809 Constraint 616 825 5.9267 7.4083 14.8167 3.2809 Constraint 616 809 5.3764 6.7205 13.4411 3.2809 Constraint 608 825 4.7197 5.8996 11.7992 3.2809 Constraint 608 809 3.9641 4.9552 9.9103 3.2809 Constraint 600 844 4.1758 5.2197 10.4395 3.2809 Constraint 600 833 4.6429 5.8037 11.6073 3.2809 Constraint 572 809 5.7421 7.1776 14.3552 3.2809 Constraint 536 809 5.3533 6.6916 13.3831 3.2809 Constraint 428 809 5.7873 7.2342 14.4684 3.2809 Constraint 406 793 5.1729 6.4661 12.9322 3.2809 Constraint 399 801 4.5135 5.6418 11.2837 3.2809 Constraint 399 793 5.3001 6.6251 13.2503 3.2809 Constraint 399 782 4.5339 5.6673 11.3346 3.2809 Constraint 392 809 4.5677 5.7096 11.4192 3.2809 Constraint 392 801 5.1003 6.3753 12.7507 3.2809 Constraint 384 809 5.1164 6.3955 12.7910 3.2809 Constraint 384 801 3.1943 3.9929 7.9858 3.2809 Constraint 809 909 3.9192 4.8990 9.7981 3.2636 Constraint 240 528 5.6511 7.0638 14.1277 3.2316 Constraint 809 887 5.4112 6.7640 13.5281 3.2243 Constraint 50 758 4.6583 5.8228 11.6457 3.2238 Constraint 950 1038 5.6194 7.0243 14.0486 3.1626 Constraint 419 725 5.0326 6.2907 12.5814 3.1482 Constraint 634 746 5.0869 6.3586 12.7171 3.1327 Constraint 608 758 5.1207 6.4008 12.8016 3.1327 Constraint 572 738 6.2438 7.8047 15.6095 3.1327 Constraint 536 738 4.5120 5.6400 11.2800 3.1327 Constraint 428 738 5.7951 7.2438 14.4877 3.1327 Constraint 406 738 5.8040 7.2549 14.5099 3.1327 Constraint 399 738 6.1214 7.6518 15.3036 3.1327 Constraint 75 231 5.2175 6.5219 13.0439 3.1327 Constraint 75 226 4.6795 5.8494 11.6989 3.1327 Constraint 75 206 4.2540 5.3175 10.6351 3.1327 Constraint 858 1101 3.9759 4.9698 9.9396 3.1302 Constraint 849 1101 4.2686 5.3357 10.6714 3.1302 Constraint 825 1101 5.4212 6.7765 13.5530 3.1302 Constraint 752 858 4.0315 5.0393 10.0786 3.1232 Constraint 752 849 4.3651 5.4564 10.9128 3.1232 Constraint 909 1144 5.6570 7.0713 14.1426 3.1218 Constraint 909 986 4.9804 6.2255 12.4509 3.1205 Constraint 114 451 5.5757 6.9696 13.9393 3.0882 Constraint 901 1033 4.0629 5.0786 10.1571 3.0848 Constraint 564 707 6.0172 7.5215 15.0430 3.0829 Constraint 18 158 5.2129 6.5161 13.0321 3.0778 Constraint 226 608 5.6941 7.1176 14.2352 3.0758 Constraint 226 536 6.2939 7.8674 15.7347 3.0758 Constraint 195 608 5.9238 7.4047 14.8094 3.0758 Constraint 195 564 5.7860 7.2326 14.4651 3.0758 Constraint 187 536 5.3209 6.6511 13.3022 3.0758 Constraint 187 528 4.6647 5.8308 11.6616 3.0758 Constraint 187 451 4.8071 6.0089 12.0177 3.0758 Constraint 187 428 5.3270 6.6588 13.3175 3.0758 Constraint 916 992 5.8197 7.2746 14.5492 2.9501 Constraint 341 555 5.5563 6.9454 13.8908 2.9458 Constraint 336 502 4.9216 6.1520 12.3039 2.9458 Constraint 336 471 4.4397 5.5496 11.0993 2.9458 Constraint 336 479 6.2419 7.8024 15.6048 2.9129 Constraint 310 479 5.6734 7.0917 14.1834 2.9129 Constraint 725 901 5.5786 6.9732 13.9464 2.8591 Constraint 916 1144 5.6738 7.0922 14.1844 2.7980 Constraint 793 969 6.1007 7.6258 15.2517 2.7901 Constraint 341 771 5.0973 6.3716 12.7432 2.7783 Constraint 217 581 5.8625 7.3281 14.6563 2.7783 Constraint 50 158 4.8182 6.0228 12.0455 2.7767 Constraint 50 150 4.9120 6.1400 12.2801 2.7767 Constraint 869 1043 6.0968 7.6210 15.2420 2.7318 Constraint 916 1001 4.4006 5.5008 11.0016 2.7000 Constraint 916 1033 4.5718 5.7148 11.4296 2.6928 Constraint 336 725 6.0524 7.5656 15.1311 2.6190 Constraint 801 961 5.1842 6.4802 12.9605 2.6059 Constraint 927 1012 5.4694 6.8367 13.6734 2.5710 Constraint 940 1075 5.9628 7.4535 14.9071 2.5476 Constraint 940 1033 5.4379 6.7973 13.5946 2.5476 Constraint 649 771 6.3200 7.9001 15.8001 2.5235 Constraint 644 771 5.0785 6.3481 12.6962 2.5235 Constraint 384 623 6.2493 7.8116 15.6233 2.5235 Constraint 714 858 4.5292 5.6615 11.3230 2.5227 Constraint 887 992 5.0482 6.3102 12.6205 2.4712 Constraint 349 909 5.8298 7.2872 14.5744 2.4703 Constraint 349 901 5.3495 6.6869 13.3737 2.4703 Constraint 927 1043 5.8408 7.3011 14.6021 2.4687 Constraint 932 1082 5.4367 6.7959 13.5918 2.4650 Constraint 927 1075 5.4081 6.7601 13.5201 2.4650 Constraint 849 1059 5.3821 6.7277 13.4553 2.4547 Constraint 878 961 5.1620 6.4525 12.9051 2.4150 Constraint 616 844 5.4782 6.8477 13.6955 2.4150 Constraint 336 752 6.0450 7.5563 15.1126 2.3924 Constraint 1012 1126 6.3260 7.9075 15.8151 2.3566 Constraint 1012 1101 6.1217 7.6521 15.3043 2.3566 Constraint 357 1144 4.1469 5.1836 10.3671 2.3566 Constraint 240 955 6.0852 7.6065 15.2130 2.3566 Constraint 217 961 5.6723 7.0904 14.1807 2.3566 Constraint 324 752 4.6062 5.7577 11.5154 2.3384 Constraint 103 738 5.7884 7.2355 14.4711 2.3162 Constraint 103 600 5.3763 6.7203 13.4407 2.3162 Constraint 103 564 5.5566 6.9457 13.8915 2.3162 Constraint 95 536 5.2492 6.5615 13.1230 2.3162 Constraint 95 528 3.9218 4.9022 9.8044 2.3162 Constraint 95 510 4.6572 5.8214 11.6429 2.3162 Constraint 95 471 5.9040 7.3800 14.7600 2.3162 Constraint 95 451 4.2359 5.2949 10.5898 2.3162 Constraint 95 428 4.8190 6.0238 12.0476 2.3162 Constraint 85 471 5.2687 6.5859 13.1718 2.3162 Constraint 85 460 5.6883 7.1104 14.2208 2.3162 Constraint 85 451 3.1765 3.9706 7.9412 2.3162 Constraint 75 564 5.2695 6.5869 13.1737 2.3162 Constraint 75 555 5.7957 7.2446 14.4892 2.3162 Constraint 75 528 4.3414 5.4267 10.8534 2.3162 Constraint 67 528 4.6453 5.8066 11.6133 2.3162 Constraint 67 510 6.3351 7.9188 15.8377 2.3162 Constraint 67 502 5.1830 6.4787 12.9574 2.3162 Constraint 67 471 4.8461 6.0576 12.1152 2.3162 Constraint 67 451 5.6381 7.0476 14.0953 2.3162 Constraint 368 451 4.9995 6.2493 12.4986 2.3157 Constraint 336 460 5.6427 7.0534 14.1069 2.3157 Constraint 357 1001 6.2186 7.7732 15.5464 2.3030 Constraint 206 969 6.2440 7.8050 15.6101 2.3030 Constraint 206 961 6.1705 7.7131 15.4263 2.3030 Constraint 206 932 5.1123 6.3904 12.7808 2.3030 Constraint 176 969 6.3379 7.9224 15.8448 2.3030 Constraint 165 969 5.0411 6.3014 12.6027 2.3030 Constraint 42 120 6.3660 7.9575 15.9150 2.3030 Constraint 33 120 5.9937 7.4921 14.9843 2.3030 Constraint 25 103 4.2422 5.3027 10.6055 2.3030 Constraint 399 623 4.9267 6.1584 12.3168 2.2935 Constraint 267 858 4.9529 6.1911 12.3822 2.2935 Constraint 267 849 5.8522 7.3153 14.6306 2.2935 Constraint 245 471 5.8666 7.3332 14.6665 2.2935 Constraint 833 916 5.7485 7.1856 14.3712 2.2780 Constraint 564 714 6.3512 7.9391 15.8781 2.2408 Constraint 33 1067 6.3913 7.9891 15.9783 2.2289 Constraint 932 1093 5.7863 7.2329 14.4657 2.2034 Constraint 932 1033 4.7529 5.9411 11.8822 2.1941 Constraint 67 600 5.1811 6.4764 12.9527 2.1887 Constraint 909 1033 3.6802 4.6003 9.2006 2.1675 Constraint 901 1126 5.1661 6.4576 12.9152 2.1581 Constraint 349 793 5.2458 6.5573 13.1146 2.1078 Constraint 536 685 6.0104 7.5131 15.0261 2.0701 Constraint 231 555 5.1691 6.4613 12.9227 2.0701 Constraint 50 793 5.9465 7.4331 14.8663 2.0701 Constraint 644 758 4.4848 5.6060 11.2121 2.0525 Constraint 634 758 4.8451 6.0563 12.1127 2.0525 Constraint 42 150 5.0099 6.2624 12.5247 2.0525 Constraint 42 143 4.3635 5.4543 10.9087 2.0525 Constraint 33 143 5.0244 6.2805 12.5611 2.0525 Constraint 33 136 4.4142 5.5177 11.0355 2.0525 Constraint 25 136 5.5347 6.9184 13.8368 2.0525 Constraint 18 136 4.2836 5.3545 10.7090 2.0525 Constraint 11 136 6.0993 7.6241 15.2482 2.0525 Constraint 685 858 4.8950 6.1188 12.2376 2.0506 Constraint 685 849 5.3739 6.7174 13.4348 2.0506 Constraint 685 833 4.9068 6.1334 12.2669 2.0506 Constraint 226 634 6.1492 7.6865 15.3730 2.0506 Constraint 176 451 3.6919 4.6149 9.2298 2.0506 Constraint 42 471 5.3811 6.7264 13.4529 2.0506 Constraint 42 451 5.1912 6.4890 12.9781 2.0506 Constraint 42 176 4.3080 5.3851 10.7701 2.0506 Constraint 33 176 5.0102 6.2627 12.5255 2.0506 Constraint 33 165 4.4612 5.5765 11.1530 2.0506 Constraint 25 165 6.1112 7.6390 15.2780 2.0506 Constraint 18 600 6.0196 7.5245 15.0489 2.0506 Constraint 18 165 5.3897 6.7372 13.4743 2.0506 Constraint 3 600 6.2929 7.8661 15.7323 2.0506 Constraint 3 555 4.8594 6.0742 12.1484 2.0506 Constraint 324 887 5.7887 7.2359 14.4717 2.0468 Constraint 120 564 5.5265 6.9081 13.8161 1.9735 Constraint 120 226 5.4975 6.8719 13.7438 1.9735 Constraint 801 927 5.9593 7.4491 14.8981 1.9422 Constraint 738 932 5.8516 7.3145 14.6291 1.9422 Constraint 738 927 5.8696 7.3370 14.6740 1.9422 Constraint 85 564 5.3778 6.7222 13.4444 1.9257 Constraint 85 555 4.9057 6.1321 12.2642 1.9257 Constraint 357 771 5.5488 6.9360 13.8721 1.8900 Constraint 758 969 6.0013 7.5017 15.0034 1.8339 Constraint 725 858 5.8472 7.3089 14.6179 1.8339 Constraint 986 1059 4.8197 6.0246 12.0491 1.8279 Constraint 887 1038 5.8283 7.2854 14.5708 1.8212 Constraint 95 195 5.3269 6.6586 13.3171 1.7854 Constraint 95 187 4.3074 5.3843 10.7686 1.7854 Constraint 95 176 5.7998 7.2497 14.4995 1.7854 Constraint 85 187 5.1825 6.4782 12.9563 1.7854 Constraint 85 176 4.5410 5.6762 11.3524 1.7854 Constraint 80 176 5.2162 6.5203 13.0406 1.7854 Constraint 849 1025 5.3039 6.6299 13.2597 1.7625 Constraint 927 1038 5.0006 6.2507 12.5014 1.7570 Constraint 801 950 5.3302 6.6627 13.3254 1.7283 Constraint 782 955 6.0006 7.5008 15.0015 1.7283 Constraint 950 1025 4.9697 6.2121 12.4242 1.6894 Constraint 940 1059 5.1407 6.4259 12.8518 1.6894 Constraint 858 955 6.2092 7.7614 15.5229 1.6680 Constraint 341 752 3.1082 3.8853 7.7705 1.5664 Constraint 67 927 5.4775 6.8469 13.6938 1.5664 Constraint 67 901 6.2031 7.7539 15.5079 1.5664 Constraint 58 927 3.6190 4.5237 9.0474 1.5664 Constraint 33 927 5.4648 6.8310 13.6620 1.5664 Constraint 33 187 5.0837 6.3547 12.7093 1.5664 Constraint 969 1038 6.3148 7.8935 15.7870 1.5441 Constraint 961 1038 5.8148 7.2685 14.5371 1.5441 Constraint 955 1043 5.4326 6.7907 13.5814 1.5441 Constraint 955 1038 3.1667 3.9584 7.9167 1.5441 Constraint 878 1059 6.0591 7.5738 15.1476 1.5441 Constraint 114 368 5.8055 7.2569 14.5139 1.5441 Constraint 103 368 5.3257 6.6572 13.3143 1.5441 Constraint 217 357 5.1592 6.4490 12.8980 1.4765 Constraint 399 644 6.1952 7.7440 15.4880 1.4692 Constraint 368 564 6.0220 7.5275 15.0550 1.4692 Constraint 368 536 5.9471 7.4339 14.8678 1.4692 Constraint 368 528 4.2942 5.3677 10.7354 1.4692 Constraint 368 510 5.3410 6.6762 13.3524 1.4692 Constraint 357 460 5.6273 7.0341 14.0681 1.4692 Constraint 302 460 5.4839 6.8548 13.7097 1.4692 Constraint 293 357 4.2324 5.2905 10.5811 1.4692 Constraint 253 825 5.5873 6.9841 13.9682 1.4619 Constraint 217 528 5.7860 7.2325 14.4650 1.4484 Constraint 206 293 6.2807 7.8509 15.7018 1.4484 Constraint 349 564 6.2813 7.8517 15.7033 1.4472 Constraint 927 1115 4.8332 6.0415 12.0831 1.3902 Constraint 950 1082 5.2783 6.5979 13.1957 1.3728 Constraint 950 1075 4.7114 5.8893 11.7786 1.3728 Constraint 950 1067 5.9037 7.3796 14.7592 1.3728 Constraint 950 1059 4.3047 5.3809 10.7617 1.3728 Constraint 878 1001 5.4229 6.7786 13.5573 1.3718 Constraint 901 1093 5.7617 7.2022 14.4044 1.3701 Constraint 869 1067 6.2340 7.7925 15.5851 1.3547 Constraint 858 1075 5.7416 7.1769 14.3539 1.3547 Constraint 858 1067 4.2223 5.2778 10.5557 1.3547 Constraint 849 1093 5.8251 7.2814 14.5627 1.3547 Constraint 310 1101 5.8968 7.3711 14.7421 1.3547 Constraint 276 1101 5.6418 7.0523 14.1046 1.3547 Constraint 887 1059 4.1940 5.2425 10.4849 1.3479 Constraint 317 555 5.6959 7.1198 14.2396 1.2893 Constraint 253 502 6.3588 7.9485 15.8969 1.2893 Constraint 245 528 5.0228 6.2785 12.5570 1.2893 Constraint 245 317 6.3825 7.9782 15.9564 1.2893 Constraint 1017 1093 5.2171 6.5214 13.0428 1.2617 Constraint 801 887 5.0646 6.3308 12.6616 1.2617 Constraint 801 878 5.0550 6.3187 12.6374 1.2617 Constraint 771 849 6.2590 7.8238 15.6476 1.2617 Constraint 714 844 3.9952 4.9939 9.9879 1.2617 Constraint 714 833 4.4948 5.6185 11.2369 1.2617 Constraint 714 825 6.2239 7.7799 15.5597 1.2617 Constraint 858 961 4.3796 5.4745 10.9490 1.2614 Constraint 714 793 4.5129 5.6411 11.2822 1.2614 Constraint 616 771 5.7786 7.2232 14.4464 1.2614 Constraint 572 746 5.9222 7.4028 14.8056 1.2614 Constraint 932 1126 5.5302 6.9128 13.8256 1.2407 Constraint 849 950 6.3140 7.8926 15.7851 1.2371 Constraint 849 932 5.8374 7.2968 14.5936 1.2371 Constraint 844 1025 5.3988 6.7485 13.4971 1.2371 Constraint 833 940 6.1558 7.6947 15.3894 1.2371 Constraint 825 940 4.2489 5.3111 10.6223 1.2371 Constraint 260 392 4.3490 5.4362 10.8724 1.2014 Constraint 226 510 5.0481 6.3101 12.6202 1.2014 Constraint 195 510 4.3891 5.4864 10.9728 1.2014 Constraint 187 725 5.9069 7.3836 14.7673 1.2014 Constraint 158 801 5.2391 6.5488 13.0977 1.2014 Constraint 158 771 5.6463 7.0579 14.1158 1.2014 Constraint 158 738 3.5506 4.4382 8.8765 1.2014 Constraint 150 738 4.5910 5.7388 11.4776 1.2014 Constraint 150 732 5.4838 6.8548 13.7095 1.2014 Constraint 150 725 3.9298 4.9123 9.8246 1.2014 Constraint 150 608 5.1164 6.3956 12.7911 1.2014 Constraint 150 564 6.2017 7.7522 15.5043 1.2014 Constraint 143 245 6.1565 7.6956 15.3912 1.2014 Constraint 143 226 5.3469 6.6836 13.3672 1.2014 Constraint 136 801 5.5165 6.8956 13.7912 1.2014 Constraint 129 825 5.9147 7.3933 14.7867 1.2014 Constraint 129 801 4.6740 5.8425 11.6850 1.2014 Constraint 129 793 5.5647 6.9559 13.9118 1.2014 Constraint 129 738 5.6616 7.0770 14.1540 1.2014 Constraint 129 608 6.0929 7.6161 15.2323 1.2014 Constraint 129 600 4.9978 6.2473 12.4945 1.2014 Constraint 129 564 4.9246 6.1557 12.3115 1.2014 Constraint 120 510 5.0129 6.2662 12.5323 1.2014 Constraint 114 245 4.8542 6.0678 12.1355 1.2014 Constraint 114 226 5.5304 6.9130 13.8260 1.2014 Constraint 103 825 3.8127 4.7659 9.5318 1.2014 Constraint 95 555 5.8715 7.3393 14.6787 1.2014 Constraint 80 392 4.8013 6.0016 12.0032 1.2014 Constraint 758 878 4.8298 6.0373 12.0746 1.1809 Constraint 758 869 4.0882 5.1102 10.2205 1.1809 Constraint 758 858 5.8592 7.3240 14.6480 1.1809 Constraint 758 849 4.4865 5.6081 11.2161 1.1809 Constraint 752 869 6.0277 7.5346 15.0693 1.1809 Constraint 746 858 4.4435 5.5543 11.1087 1.1809 Constraint 738 901 6.1144 7.6430 15.2859 1.1809 Constraint 738 869 4.2752 5.3440 10.6880 1.1809 Constraint 302 901 6.3355 7.9193 15.8387 1.1809 Constraint 302 771 5.8055 7.2569 14.5139 1.1809 Constraint 85 165 5.7283 7.1604 14.3208 1.1809 Constraint 80 165 4.4225 5.5281 11.0562 1.1809 Constraint 75 165 5.0090 6.2613 12.5225 1.1809 Constraint 833 1067 5.2933 6.6167 13.2334 1.1537 Constraint 801 1067 5.2236 6.5295 13.0591 1.1537 Constraint 771 887 5.1437 6.4296 12.8593 1.1537 Constraint 771 878 4.5891 5.7364 11.4727 1.1537 Constraint 644 825 3.8330 4.7912 9.5824 1.1537 Constraint 644 752 5.2836 6.6045 13.2089 1.1537 Constraint 644 746 4.4569 5.5711 11.1423 1.1537 Constraint 634 844 3.4357 4.2946 8.5892 1.1537 Constraint 634 833 5.3276 6.6595 13.3191 1.1537 Constraint 634 825 3.6808 4.6010 9.2020 1.1537 Constraint 623 833 5.1921 6.4901 12.9802 1.1537 Constraint 623 825 5.7455 7.1819 14.3639 1.1537 Constraint 616 858 4.7375 5.9219 11.8437 1.1537 Constraint 608 858 5.3026 6.6282 13.2565 1.1537 Constraint 608 849 5.3142 6.6427 13.2855 1.1537 Constraint 600 901 5.8637 7.3296 14.6593 1.1537 Constraint 572 833 5.8465 7.3081 14.6162 1.1537 Constraint 564 833 6.2450 7.8063 15.6125 1.1537 Constraint 536 833 4.7052 5.8815 11.7631 1.1537 Constraint 413 809 5.3475 6.6843 13.3687 1.1537 Constraint 406 833 6.1732 7.7164 15.4329 1.1537 Constraint 399 833 5.8901 7.3627 14.7253 1.1537 Constraint 399 825 4.7392 5.9239 11.8479 1.1537 Constraint 392 833 5.2809 6.6011 13.2022 1.1537 Constraint 392 825 5.5050 6.8812 13.7624 1.1537 Constraint 384 844 3.2711 4.0888 8.1776 1.1537 Constraint 384 833 5.0329 6.2911 12.5822 1.1537 Constraint 384 825 3.3618 4.2023 8.4045 1.1537 Constraint 349 878 5.4510 6.8137 13.6274 1.1537 Constraint 349 849 5.3089 6.6361 13.2722 1.1537 Constraint 341 849 3.8299 4.7873 9.5747 1.1537 Constraint 341 844 4.9671 6.2089 12.4178 1.1537 Constraint 260 1025 5.2451 6.5564 13.1129 1.1537 Constraint 103 793 5.2448 6.5559 13.1119 1.1537 Constraint 103 302 5.8039 7.2549 14.5097 1.1537 Constraint 103 293 5.9475 7.4344 14.8688 1.1537 Constraint 103 267 4.5267 5.6584 11.3168 1.1537 Constraint 95 600 4.5437 5.6796 11.3591 1.1537 Constraint 95 324 5.5083 6.8853 13.7706 1.1537 Constraint 95 302 5.6357 7.0446 14.0892 1.1537 Constraint 95 293 4.7038 5.8798 11.7596 1.1537 Constraint 95 267 5.7919 7.2399 14.4797 1.1537 Constraint 85 600 5.6722 7.0902 14.1804 1.1537 Constraint 85 581 6.1151 7.6439 15.2878 1.1537 Constraint 85 293 5.4075 6.7594 13.5188 1.1537 Constraint 85 267 5.4532 6.8165 13.6330 1.1537 Constraint 80 793 6.2607 7.8259 15.6518 1.1537 Constraint 80 758 5.7386 7.1733 14.3465 1.1537 Constraint 267 901 6.0860 7.6075 15.2150 1.1468 Constraint 368 714 5.7719 7.2148 14.4297 1.1204 Constraint 324 696 4.6211 5.7764 11.5528 1.1059 Constraint 324 685 6.1448 7.6810 15.3620 1.0485 Constraint 368 707 5.3868 6.7335 13.4670 1.0350 Constraint 206 793 4.1804 5.2255 10.4511 1.0350 Constraint 206 758 4.1819 5.2274 10.4549 1.0350 Constraint 206 746 4.7950 5.9937 11.9874 1.0350 Constraint 206 600 4.7852 5.9815 11.9631 1.0350 Constraint 195 758 6.3551 7.9438 15.8877 1.0350 Constraint 195 746 5.2011 6.5013 13.0026 1.0350 Constraint 176 793 5.9284 7.4105 14.8210 1.0350 Constraint 158 793 5.9788 7.4735 14.9471 1.0350 Constraint 158 758 3.8801 4.8502 9.7003 1.0350 Constraint 42 758 3.6220 4.5274 9.0549 1.0350 Constraint 42 752 5.4068 6.7585 13.5170 1.0350 Constraint 226 782 6.2432 7.8040 15.6080 1.0258 Constraint 206 276 5.5715 6.9644 13.9288 1.0258 Constraint 195 801 5.9279 7.4099 14.8198 1.0258 Constraint 195 324 5.1582 6.4477 12.8955 1.0258 Constraint 793 932 5.8683 7.3354 14.6708 1.0253 Constraint 793 927 5.4825 6.8531 13.7062 1.0253 Constraint 725 932 6.3888 7.9859 15.9719 1.0253 Constraint 725 909 6.3045 7.8806 15.7612 1.0253 Constraint 725 887 6.3610 7.9512 15.9025 1.0253 Constraint 158 600 6.1010 7.6262 15.2525 1.0253 Constraint 158 564 5.0419 6.3023 12.6047 1.0253 Constraint 158 528 4.9555 6.1943 12.3887 1.0253 Constraint 50 600 6.0873 7.6091 15.2181 1.0253 Constraint 50 564 5.0191 6.2739 12.5479 1.0253 Constraint 50 528 4.9453 6.1817 12.3633 1.0253 Constraint 42 158 4.3265 5.4081 10.8162 1.0253 Constraint 33 158 5.7951 7.2439 14.4878 1.0253 Constraint 25 158 4.4249 5.5312 11.0623 1.0253 Constraint 825 916 4.4446 5.5557 11.1114 1.0162 Constraint 809 961 5.9823 7.4779 14.9558 0.9563 Constraint 809 955 5.9752 7.4690 14.9381 0.9563 Constraint 809 940 5.5801 6.9751 13.9502 0.9563 Constraint 809 932 4.7777 5.9722 11.9443 0.9563 Constraint 801 901 5.8136 7.2669 14.5339 0.9563 Constraint 782 969 3.9924 4.9906 9.9811 0.9563 Constraint 782 961 6.3900 7.9875 15.9750 0.9563 Constraint 771 986 5.4878 6.8598 13.7196 0.9563 Constraint 771 977 4.1974 5.2468 10.4935 0.9563 Constraint 771 969 4.9622 6.2027 12.4054 0.9563 Constraint 758 986 3.4852 4.3565 8.7130 0.9563 Constraint 746 1001 5.8253 7.2816 14.5631 0.9563 Constraint 600 707 5.5407 6.9258 13.8517 0.9563 Constraint 317 732 6.3575 7.9469 15.8937 0.9563 Constraint 916 1115 6.2661 7.8326 15.6653 0.9465 Constraint 349 844 5.9637 7.4546 14.9092 0.9261 Constraint 909 1101 4.6750 5.8437 11.6875 0.9173 Constraint 909 1067 3.1830 3.9787 7.9574 0.9173 Constraint 849 1126 3.5570 4.4463 8.8925 0.9173 Constraint 825 1106 5.9079 7.3849 14.7698 0.9173 Constraint 287 1106 6.0779 7.5974 15.1948 0.9173 Constraint 276 1106 4.4765 5.5956 11.1912 0.9173 Constraint 253 1106 3.3249 4.1561 8.3122 0.9173 Constraint 245 1115 5.6717 7.0896 14.1792 0.9173 Constraint 245 1106 3.2973 4.1216 8.2432 0.9173 Constraint 245 1082 4.4938 5.6173 11.2346 0.9173 Constraint 955 1093 5.1421 6.4276 12.8552 0.9169 Constraint 932 1115 4.4355 5.5444 11.0887 0.9169 Constraint 901 1135 6.2821 7.8526 15.7052 0.9169 Constraint 901 1115 6.2201 7.7751 15.5502 0.9169 Constraint 849 1144 5.4537 6.8171 13.6343 0.9169 Constraint 825 932 5.1405 6.4257 12.8513 0.9169 Constraint 825 927 5.1540 6.4426 12.8851 0.9169 Constraint 801 932 5.5176 6.8970 13.7940 0.9169 Constraint 752 901 5.5132 6.8915 13.7830 0.9169 Constraint 738 1093 5.8940 7.3675 14.7349 0.9169 Constraint 725 1033 5.2661 6.5826 13.1652 0.9169 Constraint 725 1001 5.8472 7.3089 14.6179 0.9169 Constraint 707 1001 5.2414 6.5517 13.1034 0.9169 Constraint 986 1082 5.1938 6.4922 12.9845 0.9106 Constraint 986 1075 4.5071 5.6338 11.2676 0.9106 Constraint 986 1067 5.6769 7.0961 14.1921 0.9106 Constraint 977 1075 5.1039 6.3799 12.7597 0.9106 Constraint 977 1067 4.2482 5.3103 10.6205 0.9106 Constraint 977 1059 5.9228 7.4035 14.8070 0.9106 Constraint 969 1067 5.7275 7.1594 14.3188 0.9106 Constraint 969 1059 3.8686 4.8358 9.6715 0.9106 Constraint 961 1067 5.0310 6.2887 12.5774 0.9106 Constraint 961 1059 4.2244 5.2805 10.5611 0.9106 Constraint 858 1059 6.1050 7.6312 15.2624 0.9106 Constraint 849 955 5.7617 7.2021 14.4042 0.9106 Constraint 1017 1075 4.6032 5.7540 11.5080 0.8464 Constraint 1012 1075 5.4817 6.8521 13.7042 0.8464 Constraint 1012 1067 4.4142 5.5177 11.0355 0.8464 Constraint 1001 1067 5.0535 6.3169 12.6339 0.8464 Constraint 1001 1059 4.5418 5.6772 11.3544 0.8464 Constraint 992 1059 5.0861 6.3577 12.7153 0.8464 Constraint 878 992 4.7077 5.8846 11.7693 0.8464 Constraint 878 986 5.8080 7.2600 14.5200 0.8464 Constraint 869 986 4.4691 5.5863 11.1727 0.8464 Constraint 858 986 5.2486 6.5607 13.1215 0.8464 Constraint 858 1093 6.1800 7.7250 15.4500 0.8293 Constraint 858 1038 5.8396 7.2995 14.5990 0.7839 Constraint 950 1033 4.6398 5.7998 11.5995 0.7721 Constraint 932 1052 4.2332 5.2916 10.5831 0.7721 Constraint 927 1052 6.1328 7.6660 15.3320 0.7721 Constraint 916 1052 6.0620 7.5774 15.1549 0.7721 Constraint 793 950 5.8865 7.3581 14.7162 0.7721 Constraint 782 950 4.8577 6.0722 12.1444 0.7721 Constraint 771 950 6.2281 7.7851 15.5702 0.7721 Constraint 253 446 5.1622 6.4527 12.9054 0.7721 Constraint 253 428 5.6049 7.0061 14.0122 0.7721 Constraint 253 419 4.5953 5.7442 11.4883 0.7721 Constraint 253 392 3.0770 3.8463 7.6926 0.7721 Constraint 226 738 3.8758 4.8448 9.6896 0.7721 Constraint 226 732 5.8709 7.3386 14.6772 0.7721 Constraint 226 725 6.0506 7.5633 15.1266 0.7721 Constraint 217 419 6.1783 7.7228 15.4457 0.7721 Constraint 129 451 6.1200 7.6500 15.3001 0.7721 Constraint 129 231 6.3536 7.9420 15.8839 0.7721 Constraint 129 226 5.7940 7.2425 14.4851 0.7721 Constraint 129 217 4.5637 5.7046 11.4093 0.7721 Constraint 120 738 5.7457 7.1822 14.3644 0.7721 Constraint 120 600 5.3547 6.6934 13.3868 0.7721 Constraint 120 451 3.8830 4.8538 9.7075 0.7721 Constraint 120 446 3.2255 4.0319 8.0639 0.7721 Constraint 120 428 3.7532 4.6915 9.3830 0.7721 Constraint 120 419 6.2310 7.7888 15.5775 0.7721 Constraint 120 392 5.6594 7.0743 14.1486 0.7721 Constraint 120 368 4.5083 5.6353 11.2706 0.7721 Constraint 120 217 5.7843 7.2304 14.4608 0.7721 Constraint 114 564 5.3976 6.7470 13.4940 0.7721 Constraint 114 536 5.2502 6.5628 13.1256 0.7721 Constraint 114 528 3.9492 4.9364 9.8729 0.7721 Constraint 114 510 4.6411 5.8014 11.6027 0.7721 Constraint 114 471 5.8917 7.3647 14.7293 0.7721 Constraint 114 428 4.7785 5.9731 11.9463 0.7721 Constraint 114 231 6.3702 7.9628 15.9256 0.7721 Constraint 114 217 4.5280 5.6600 11.3199 0.7721 Constraint 103 471 5.2829 6.6036 13.2072 0.7721 Constraint 103 460 5.6635 7.0794 14.1588 0.7721 Constraint 103 451 3.1541 3.9426 7.8853 0.7721 Constraint 103 217 5.3331 6.6664 13.3328 0.7721 Constraint 85 528 4.3115 5.3894 10.7788 0.7721 Constraint 80 528 4.6477 5.8096 11.6192 0.7721 Constraint 80 510 6.3061 7.8826 15.7651 0.7721 Constraint 80 502 5.1601 6.4501 12.9002 0.7721 Constraint 80 471 4.8037 6.0046 12.0092 0.7721 Constraint 80 451 5.6007 7.0009 14.0017 0.7721 Constraint 58 528 5.9352 7.4190 14.8380 0.7721 Constraint 317 496 6.3040 7.8800 15.7600 0.7707 Constraint 310 496 5.2700 6.5875 13.1750 0.7707 Constraint 940 1043 5.1867 6.4834 12.9668 0.7611 Constraint 901 1067 3.9103 4.8879 9.7757 0.7611 Constraint 324 844 6.0454 7.5568 15.1136 0.7574 Constraint 245 357 5.1520 6.4400 12.8800 0.7383 Constraint 206 357 5.1201 6.4001 12.8001 0.7383 Constraint 336 490 6.1471 7.6839 15.3678 0.7363 Constraint 310 490 5.2100 6.5125 13.0251 0.7363 Constraint 536 657 5.8049 7.2561 14.5122 0.7346 Constraint 195 293 5.0019 6.2524 12.5048 0.7242 Constraint 187 293 4.0811 5.1014 10.2027 0.7242 Constraint 176 564 4.6466 5.8082 11.6165 0.7242 Constraint 176 555 3.5093 4.3866 8.7733 0.7242 Constraint 176 528 5.7176 7.1470 14.2941 0.7242 Constraint 176 293 4.0748 5.0934 10.1869 0.7242 Constraint 165 293 6.2807 7.8509 15.7018 0.7242 Constraint 165 267 4.9590 6.1988 12.3976 0.7242 Constraint 336 809 5.9559 7.4448 14.8897 0.7140 Constraint 310 940 5.6113 7.0142 14.0283 0.7140 Constraint 287 950 6.2813 7.8516 15.7033 0.7140 Constraint 103 206 5.1651 6.4564 12.9128 0.6045 Constraint 103 195 4.7932 5.9915 11.9829 0.6045 Constraint 103 187 5.6904 7.1130 14.2260 0.6045 Constraint 302 555 5.8715 7.3393 14.6787 0.6007 Constraint 276 460 4.8687 6.0859 12.1717 0.6007 Constraint 165 696 5.8989 7.3736 14.7472 0.6007 Constraint 50 392 5.6996 7.1245 14.2491 0.6007 Constraint 18 555 6.1509 7.6887 15.3774 0.6007 Constraint 18 523 4.5408 5.6760 11.3519 0.6007 Constraint 901 977 5.0288 6.2861 12.5721 0.5254 Constraint 858 1012 5.6837 7.1046 14.2092 0.5254 Constraint 849 1033 3.8337 4.7921 9.5842 0.5254 Constraint 825 1038 5.8306 7.2883 14.5765 0.5254 Constraint 825 1033 4.3054 5.3817 10.7634 0.5254 Constraint 287 1038 6.0179 7.5224 15.0449 0.5254 Constraint 287 1012 6.2268 7.7835 15.5671 0.5254 Constraint 276 1038 4.2895 5.3618 10.7237 0.5254 Constraint 302 940 6.0302 7.5377 15.0754 0.5231 Constraint 771 992 4.8313 6.0391 12.0782 0.4781 Constraint 758 1001 3.7700 4.7125 9.4250 0.4781 Constraint 758 992 3.6414 4.5518 9.1036 0.4781 Constraint 746 961 5.7946 7.2433 14.4865 0.4781 Constraint 226 809 5.6692 7.0865 14.1731 0.4781 Constraint 217 809 5.5723 6.9654 13.9308 0.4781 Constraint 80 253 4.4479 5.5599 11.1198 0.4781 Constraint 80 245 5.9933 7.4917 14.9833 0.4781 Constraint 80 217 4.1503 5.1879 10.3758 0.4781 Constraint 75 725 5.6867 7.1084 14.2167 0.4781 Constraint 75 253 4.9178 6.1473 12.2946 0.4781 Constraint 75 245 4.6427 5.8033 11.6067 0.4781 Constraint 67 725 5.6502 7.0628 14.1255 0.4781 Constraint 67 707 5.6922 7.1152 14.2304 0.4781 Constraint 67 245 4.8102 6.0128 12.0256 0.4781 Constraint 42 725 5.7869 7.2336 14.4673 0.4781 Constraint 287 1033 6.3046 7.8808 15.7616 0.4732 Constraint 245 1052 4.5310 5.6637 11.3274 0.4732 Constraint 833 1101 6.3036 7.8795 15.7591 0.4373 Constraint 267 1038 4.7517 5.9397 11.8794 0.4373 Constraint 955 1144 6.2942 7.8678 15.7356 0.3238 Constraint 955 1135 5.2960 6.6200 13.2401 0.3238 Constraint 927 1144 5.9406 7.4258 14.8515 0.3238 Constraint 901 1101 5.9264 7.4080 14.8160 0.3238 Constraint 1135 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1126 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1126 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1115 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1115 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1115 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1106 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1101 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1101 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1101 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1101 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1101 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1093 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1093 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1093 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1093 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1093 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1093 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1082 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1075 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1067 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1052 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1043 1052 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1052 0.8000 1.0000 2.0000 0.0000 Constraint 1038 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1052 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1033 1038 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1052 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1038 0.8000 1.0000 2.0000 0.0000 Constraint 1025 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1126 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1101 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1067 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1052 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1038 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1017 1025 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1052 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1038 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1025 0.8000 1.0000 2.0000 0.0000 Constraint 1012 1017 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1144 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1135 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1115 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1106 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1093 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1082 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1075 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1052 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1043 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1038 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1033 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1025 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1017 0.8000 1.0000 2.0000 0.0000 Constraint 1001 1012 0.8000 1.0000 2.0000 0.0000 Constraint 992 1144 0.8000 1.0000 2.0000 0.0000 Constraint 992 1135 0.8000 1.0000 2.0000 0.0000 Constraint 992 1126 0.8000 1.0000 2.0000 0.0000 Constraint 992 1115 0.8000 1.0000 2.0000 0.0000 Constraint 992 1106 0.8000 1.0000 2.0000 0.0000 Constraint 992 1101 0.8000 1.0000 2.0000 0.0000 Constraint 992 1093 0.8000 1.0000 2.0000 0.0000 Constraint 992 1082 0.8000 1.0000 2.0000 0.0000 Constraint 992 1075 0.8000 1.0000 2.0000 0.0000 Constraint 992 1067 0.8000 1.0000 2.0000 0.0000 Constraint 992 1052 0.8000 1.0000 2.0000 0.0000 Constraint 992 1043 0.8000 1.0000 2.0000 0.0000 Constraint 992 1038 0.8000 1.0000 2.0000 0.0000 Constraint 992 1033 0.8000 1.0000 2.0000 0.0000 Constraint 992 1025 0.8000 1.0000 2.0000 0.0000 Constraint 992 1017 0.8000 1.0000 2.0000 0.0000 Constraint 992 1012 0.8000 1.0000 2.0000 0.0000 Constraint 992 1001 0.8000 1.0000 2.0000 0.0000 Constraint 986 1144 0.8000 1.0000 2.0000 0.0000 Constraint 986 1135 0.8000 1.0000 2.0000 0.0000 Constraint 986 1126 0.8000 1.0000 2.0000 0.0000 Constraint 986 1115 0.8000 1.0000 2.0000 0.0000 Constraint 986 1106 0.8000 1.0000 2.0000 0.0000 Constraint 986 1101 0.8000 1.0000 2.0000 0.0000 Constraint 986 1093 0.8000 1.0000 2.0000 0.0000 Constraint 986 1052 0.8000 1.0000 2.0000 0.0000 Constraint 986 1043 0.8000 1.0000 2.0000 0.0000 Constraint 986 1038 0.8000 1.0000 2.0000 0.0000 Constraint 986 1033 0.8000 1.0000 2.0000 0.0000 Constraint 986 1025 0.8000 1.0000 2.0000 0.0000 Constraint 986 1017 0.8000 1.0000 2.0000 0.0000 Constraint 986 1012 0.8000 1.0000 2.0000 0.0000 Constraint 986 1001 0.8000 1.0000 2.0000 0.0000 Constraint 986 992 0.8000 1.0000 2.0000 0.0000 Constraint 977 1144 0.8000 1.0000 2.0000 0.0000 Constraint 977 1135 0.8000 1.0000 2.0000 0.0000 Constraint 977 1126 0.8000 1.0000 2.0000 0.0000 Constraint 977 1115 0.8000 1.0000 2.0000 0.0000 Constraint 977 1106 0.8000 1.0000 2.0000 0.0000 Constraint 977 1101 0.8000 1.0000 2.0000 0.0000 Constraint 977 1093 0.8000 1.0000 2.0000 0.0000 Constraint 977 1082 0.8000 1.0000 2.0000 0.0000 Constraint 977 1052 0.8000 1.0000 2.0000 0.0000 Constraint 977 1043 0.8000 1.0000 2.0000 0.0000 Constraint 977 1038 0.8000 1.0000 2.0000 0.0000 Constraint 977 1033 0.8000 1.0000 2.0000 0.0000 Constraint 977 1025 0.8000 1.0000 2.0000 0.0000 Constraint 977 1017 0.8000 1.0000 2.0000 0.0000 Constraint 977 1012 0.8000 1.0000 2.0000 0.0000 Constraint 977 1001 0.8000 1.0000 2.0000 0.0000 Constraint 977 992 0.8000 1.0000 2.0000 0.0000 Constraint 977 986 0.8000 1.0000 2.0000 0.0000 Constraint 969 1144 0.8000 1.0000 2.0000 0.0000 Constraint 969 1135 0.8000 1.0000 2.0000 0.0000 Constraint 969 1126 0.8000 1.0000 2.0000 0.0000 Constraint 969 1115 0.8000 1.0000 2.0000 0.0000 Constraint 969 1106 0.8000 1.0000 2.0000 0.0000 Constraint 969 1101 0.8000 1.0000 2.0000 0.0000 Constraint 969 1093 0.8000 1.0000 2.0000 0.0000 Constraint 969 1082 0.8000 1.0000 2.0000 0.0000 Constraint 969 1075 0.8000 1.0000 2.0000 0.0000 Constraint 969 1052 0.8000 1.0000 2.0000 0.0000 Constraint 969 1043 0.8000 1.0000 2.0000 0.0000 Constraint 969 1033 0.8000 1.0000 2.0000 0.0000 Constraint 969 1025 0.8000 1.0000 2.0000 0.0000 Constraint 969 1017 0.8000 1.0000 2.0000 0.0000 Constraint 969 1012 0.8000 1.0000 2.0000 0.0000 Constraint 969 1001 0.8000 1.0000 2.0000 0.0000 Constraint 969 992 0.8000 1.0000 2.0000 0.0000 Constraint 969 986 0.8000 1.0000 2.0000 0.0000 Constraint 969 977 0.8000 1.0000 2.0000 0.0000 Constraint 961 1144 0.8000 1.0000 2.0000 0.0000 Constraint 961 1135 0.8000 1.0000 2.0000 0.0000 Constraint 961 1126 0.8000 1.0000 2.0000 0.0000 Constraint 961 1115 0.8000 1.0000 2.0000 0.0000 Constraint 961 1106 0.8000 1.0000 2.0000 0.0000 Constraint 961 1101 0.8000 1.0000 2.0000 0.0000 Constraint 961 1093 0.8000 1.0000 2.0000 0.0000 Constraint 961 1082 0.8000 1.0000 2.0000 0.0000 Constraint 961 1075 0.8000 1.0000 2.0000 0.0000 Constraint 961 1052 0.8000 1.0000 2.0000 0.0000 Constraint 961 1043 0.8000 1.0000 2.0000 0.0000 Constraint 961 1033 0.8000 1.0000 2.0000 0.0000 Constraint 961 1025 0.8000 1.0000 2.0000 0.0000 Constraint 961 1017 0.8000 1.0000 2.0000 0.0000 Constraint 961 1012 0.8000 1.0000 2.0000 0.0000 Constraint 961 1001 0.8000 1.0000 2.0000 0.0000 Constraint 961 992 0.8000 1.0000 2.0000 0.0000 Constraint 961 986 0.8000 1.0000 2.0000 0.0000 Constraint 961 977 0.8000 1.0000 2.0000 0.0000 Constraint 961 969 0.8000 1.0000 2.0000 0.0000 Constraint 955 1106 0.8000 1.0000 2.0000 0.0000 Constraint 955 1101 0.8000 1.0000 2.0000 0.0000 Constraint 955 1082 0.8000 1.0000 2.0000 0.0000 Constraint 955 1075 0.8000 1.0000 2.0000 0.0000 Constraint 955 1067 0.8000 1.0000 2.0000 0.0000 Constraint 955 1059 0.8000 1.0000 2.0000 0.0000 Constraint 955 1052 0.8000 1.0000 2.0000 0.0000 Constraint 955 1033 0.8000 1.0000 2.0000 0.0000 Constraint 955 1025 0.8000 1.0000 2.0000 0.0000 Constraint 955 1017 0.8000 1.0000 2.0000 0.0000 Constraint 955 1012 0.8000 1.0000 2.0000 0.0000 Constraint 955 1001 0.8000 1.0000 2.0000 0.0000 Constraint 955 992 0.8000 1.0000 2.0000 0.0000 Constraint 955 986 0.8000 1.0000 2.0000 0.0000 Constraint 955 977 0.8000 1.0000 2.0000 0.0000 Constraint 955 969 0.8000 1.0000 2.0000 0.0000 Constraint 955 961 0.8000 1.0000 2.0000 0.0000 Constraint 950 1115 0.8000 1.0000 2.0000 0.0000 Constraint 950 1106 0.8000 1.0000 2.0000 0.0000 Constraint 950 1101 0.8000 1.0000 2.0000 0.0000 Constraint 950 1093 0.8000 1.0000 2.0000 0.0000 Constraint 950 1052 0.8000 1.0000 2.0000 0.0000 Constraint 950 1043 0.8000 1.0000 2.0000 0.0000 Constraint 950 1012 0.8000 1.0000 2.0000 0.0000 Constraint 950 1001 0.8000 1.0000 2.0000 0.0000 Constraint 950 992 0.8000 1.0000 2.0000 0.0000 Constraint 950 986 0.8000 1.0000 2.0000 0.0000 Constraint 950 977 0.8000 1.0000 2.0000 0.0000 Constraint 950 969 0.8000 1.0000 2.0000 0.0000 Constraint 950 961 0.8000 1.0000 2.0000 0.0000 Constraint 950 955 0.8000 1.0000 2.0000 0.0000 Constraint 940 1144 0.8000 1.0000 2.0000 0.0000 Constraint 940 1135 0.8000 1.0000 2.0000 0.0000 Constraint 940 1126 0.8000 1.0000 2.0000 0.0000 Constraint 940 1115 0.8000 1.0000 2.0000 0.0000 Constraint 940 1106 0.8000 1.0000 2.0000 0.0000 Constraint 940 1101 0.8000 1.0000 2.0000 0.0000 Constraint 940 1082 0.8000 1.0000 2.0000 0.0000 Constraint 940 1052 0.8000 1.0000 2.0000 0.0000 Constraint 940 1001 0.8000 1.0000 2.0000 0.0000 Constraint 940 992 0.8000 1.0000 2.0000 0.0000 Constraint 940 986 0.8000 1.0000 2.0000 0.0000 Constraint 940 977 0.8000 1.0000 2.0000 0.0000 Constraint 940 969 0.8000 1.0000 2.0000 0.0000 Constraint 940 961 0.8000 1.0000 2.0000 0.0000 Constraint 940 955 0.8000 1.0000 2.0000 0.0000 Constraint 940 950 0.8000 1.0000 2.0000 0.0000 Constraint 932 1144 0.8000 1.0000 2.0000 0.0000 Constraint 932 1135 0.8000 1.0000 2.0000 0.0000 Constraint 932 1106 0.8000 1.0000 2.0000 0.0000 Constraint 932 1101 0.8000 1.0000 2.0000 0.0000 Constraint 932 992 0.8000 1.0000 2.0000 0.0000 Constraint 932 986 0.8000 1.0000 2.0000 0.0000 Constraint 932 977 0.8000 1.0000 2.0000 0.0000 Constraint 932 969 0.8000 1.0000 2.0000 0.0000 Constraint 932 961 0.8000 1.0000 2.0000 0.0000 Constraint 932 955 0.8000 1.0000 2.0000 0.0000 Constraint 932 950 0.8000 1.0000 2.0000 0.0000 Constraint 932 940 0.8000 1.0000 2.0000 0.0000 Constraint 927 1135 0.8000 1.0000 2.0000 0.0000 Constraint 927 1106 0.8000 1.0000 2.0000 0.0000 Constraint 927 1101 0.8000 1.0000 2.0000 0.0000 Constraint 927 1082 0.8000 1.0000 2.0000 0.0000 Constraint 927 986 0.8000 1.0000 2.0000 0.0000 Constraint 927 977 0.8000 1.0000 2.0000 0.0000 Constraint 927 969 0.8000 1.0000 2.0000 0.0000 Constraint 927 961 0.8000 1.0000 2.0000 0.0000 Constraint 927 955 0.8000 1.0000 2.0000 0.0000 Constraint 927 950 0.8000 1.0000 2.0000 0.0000 Constraint 927 940 0.8000 1.0000 2.0000 0.0000 Constraint 927 932 0.8000 1.0000 2.0000 0.0000 Constraint 916 1135 0.8000 1.0000 2.0000 0.0000 Constraint 916 1106 0.8000 1.0000 2.0000 0.0000 Constraint 916 1101 0.8000 1.0000 2.0000 0.0000 Constraint 916 1082 0.8000 1.0000 2.0000 0.0000 Constraint 916 1075 0.8000 1.0000 2.0000 0.0000 Constraint 916 1038 0.8000 1.0000 2.0000 0.0000 Constraint 916 986 0.8000 1.0000 2.0000 0.0000 Constraint 916 977 0.8000 1.0000 2.0000 0.0000 Constraint 916 969 0.8000 1.0000 2.0000 0.0000 Constraint 916 961 0.8000 1.0000 2.0000 0.0000 Constraint 916 955 0.8000 1.0000 2.0000 0.0000 Constraint 916 950 0.8000 1.0000 2.0000 0.0000 Constraint 916 940 0.8000 1.0000 2.0000 0.0000 Constraint 916 932 0.8000 1.0000 2.0000 0.0000 Constraint 916 927 0.8000 1.0000 2.0000 0.0000 Constraint 909 1135 0.8000 1.0000 2.0000 0.0000 Constraint 909 1115 0.8000 1.0000 2.0000 0.0000 Constraint 909 1106 0.8000 1.0000 2.0000 0.0000 Constraint 909 1082 0.8000 1.0000 2.0000 0.0000 Constraint 909 1075 0.8000 1.0000 2.0000 0.0000 Constraint 909 1052 0.8000 1.0000 2.0000 0.0000 Constraint 909 969 0.8000 1.0000 2.0000 0.0000 Constraint 909 961 0.8000 1.0000 2.0000 0.0000 Constraint 909 955 0.8000 1.0000 2.0000 0.0000 Constraint 909 950 0.8000 1.0000 2.0000 0.0000 Constraint 909 940 0.8000 1.0000 2.0000 0.0000 Constraint 909 932 0.8000 1.0000 2.0000 0.0000 Constraint 909 927 0.8000 1.0000 2.0000 0.0000 Constraint 909 916 0.8000 1.0000 2.0000 0.0000 Constraint 901 1144 0.8000 1.0000 2.0000 0.0000 Constraint 901 1106 0.8000 1.0000 2.0000 0.0000 Constraint 901 1082 0.8000 1.0000 2.0000 0.0000 Constraint 901 1075 0.8000 1.0000 2.0000 0.0000 Constraint 901 1052 0.8000 1.0000 2.0000 0.0000 Constraint 901 986 0.8000 1.0000 2.0000 0.0000 Constraint 901 961 0.8000 1.0000 2.0000 0.0000 Constraint 901 955 0.8000 1.0000 2.0000 0.0000 Constraint 901 950 0.8000 1.0000 2.0000 0.0000 Constraint 901 940 0.8000 1.0000 2.0000 0.0000 Constraint 901 932 0.8000 1.0000 2.0000 0.0000 Constraint 901 927 0.8000 1.0000 2.0000 0.0000 Constraint 901 916 0.8000 1.0000 2.0000 0.0000 Constraint 901 909 0.8000 1.0000 2.0000 0.0000 Constraint 887 1144 0.8000 1.0000 2.0000 0.0000 Constraint 887 1135 0.8000 1.0000 2.0000 0.0000 Constraint 887 1115 0.8000 1.0000 2.0000 0.0000 Constraint 887 1106 0.8000 1.0000 2.0000 0.0000 Constraint 887 1082 0.8000 1.0000 2.0000 0.0000 Constraint 887 1075 0.8000 1.0000 2.0000 0.0000 Constraint 887 1052 0.8000 1.0000 2.0000 0.0000 Constraint 887 1012 0.8000 1.0000 2.0000 0.0000 Constraint 887 986 0.8000 1.0000 2.0000 0.0000 Constraint 887 977 0.8000 1.0000 2.0000 0.0000 Constraint 887 955 0.8000 1.0000 2.0000 0.0000 Constraint 887 950 0.8000 1.0000 2.0000 0.0000 Constraint 887 940 0.8000 1.0000 2.0000 0.0000 Constraint 887 932 0.8000 1.0000 2.0000 0.0000 Constraint 887 927 0.8000 1.0000 2.0000 0.0000 Constraint 887 916 0.8000 1.0000 2.0000 0.0000 Constraint 887 909 0.8000 1.0000 2.0000 0.0000 Constraint 887 901 0.8000 1.0000 2.0000 0.0000 Constraint 878 1144 0.8000 1.0000 2.0000 0.0000 Constraint 878 1135 0.8000 1.0000 2.0000 0.0000 Constraint 878 1115 0.8000 1.0000 2.0000 0.0000 Constraint 878 1106 0.8000 1.0000 2.0000 0.0000 Constraint 878 1082 0.8000 1.0000 2.0000 0.0000 Constraint 878 1075 0.8000 1.0000 2.0000 0.0000 Constraint 878 1052 0.8000 1.0000 2.0000 0.0000 Constraint 878 1043 0.8000 1.0000 2.0000 0.0000 Constraint 878 1038 0.8000 1.0000 2.0000 0.0000 Constraint 878 1017 0.8000 1.0000 2.0000 0.0000 Constraint 878 1012 0.8000 1.0000 2.0000 0.0000 Constraint 878 977 0.8000 1.0000 2.0000 0.0000 Constraint 878 950 0.8000 1.0000 2.0000 0.0000 Constraint 878 940 0.8000 1.0000 2.0000 0.0000 Constraint 878 932 0.8000 1.0000 2.0000 0.0000 Constraint 878 927 0.8000 1.0000 2.0000 0.0000 Constraint 878 916 0.8000 1.0000 2.0000 0.0000 Constraint 878 909 0.8000 1.0000 2.0000 0.0000 Constraint 878 901 0.8000 1.0000 2.0000 0.0000 Constraint 878 887 0.8000 1.0000 2.0000 0.0000 Constraint 869 1144 0.8000 1.0000 2.0000 0.0000 Constraint 869 1135 0.8000 1.0000 2.0000 0.0000 Constraint 869 1126 0.8000 1.0000 2.0000 0.0000 Constraint 869 1115 0.8000 1.0000 2.0000 0.0000 Constraint 869 1106 0.8000 1.0000 2.0000 0.0000 Constraint 869 1101 0.8000 1.0000 2.0000 0.0000 Constraint 869 1093 0.8000 1.0000 2.0000 0.0000 Constraint 869 1082 0.8000 1.0000 2.0000 0.0000 Constraint 869 1075 0.8000 1.0000 2.0000 0.0000 Constraint 869 1059 0.8000 1.0000 2.0000 0.0000 Constraint 869 1052 0.8000 1.0000 2.0000 0.0000 Constraint 869 1038 0.8000 1.0000 2.0000 0.0000 Constraint 869 1017 0.8000 1.0000 2.0000 0.0000 Constraint 869 955 0.8000 1.0000 2.0000 0.0000 Constraint 869 940 0.8000 1.0000 2.0000 0.0000 Constraint 869 932 0.8000 1.0000 2.0000 0.0000 Constraint 869 927 0.8000 1.0000 2.0000 0.0000 Constraint 869 916 0.8000 1.0000 2.0000 0.0000 Constraint 869 909 0.8000 1.0000 2.0000 0.0000 Constraint 869 901 0.8000 1.0000 2.0000 0.0000 Constraint 869 887 0.8000 1.0000 2.0000 0.0000 Constraint 869 878 0.8000 1.0000 2.0000 0.0000 Constraint 858 1144 0.8000 1.0000 2.0000 0.0000 Constraint 858 1135 0.8000 1.0000 2.0000 0.0000 Constraint 858 1126 0.8000 1.0000 2.0000 0.0000 Constraint 858 1115 0.8000 1.0000 2.0000 0.0000 Constraint 858 1106 0.8000 1.0000 2.0000 0.0000 Constraint 858 1082 0.8000 1.0000 2.0000 0.0000 Constraint 858 1052 0.8000 1.0000 2.0000 0.0000 Constraint 858 1017 0.8000 1.0000 2.0000 0.0000 Constraint 858 992 0.8000 1.0000 2.0000 0.0000 Constraint 858 977 0.8000 1.0000 2.0000 0.0000 Constraint 858 969 0.8000 1.0000 2.0000 0.0000 Constraint 858 932 0.8000 1.0000 2.0000 0.0000 Constraint 858 927 0.8000 1.0000 2.0000 0.0000 Constraint 858 916 0.8000 1.0000 2.0000 0.0000 Constraint 858 909 0.8000 1.0000 2.0000 0.0000 Constraint 858 901 0.8000 1.0000 2.0000 0.0000 Constraint 858 887 0.8000 1.0000 2.0000 0.0000 Constraint 858 878 0.8000 1.0000 2.0000 0.0000 Constraint 858 869 0.8000 1.0000 2.0000 0.0000 Constraint 849 1135 0.8000 1.0000 2.0000 0.0000 Constraint 849 1115 0.8000 1.0000 2.0000 0.0000 Constraint 849 1106 0.8000 1.0000 2.0000 0.0000 Constraint 849 1082 0.8000 1.0000 2.0000 0.0000 Constraint 849 1075 0.8000 1.0000 2.0000 0.0000 Constraint 849 1052 0.8000 1.0000 2.0000 0.0000 Constraint 849 1038 0.8000 1.0000 2.0000 0.0000 Constraint 849 1017 0.8000 1.0000 2.0000 0.0000 Constraint 849 1012 0.8000 1.0000 2.0000 0.0000 Constraint 849 992 0.8000 1.0000 2.0000 0.0000 Constraint 849 986 0.8000 1.0000 2.0000 0.0000 Constraint 849 977 0.8000 1.0000 2.0000 0.0000 Constraint 849 969 0.8000 1.0000 2.0000 0.0000 Constraint 849 927 0.8000 1.0000 2.0000 0.0000 Constraint 849 916 0.8000 1.0000 2.0000 0.0000 Constraint 849 909 0.8000 1.0000 2.0000 0.0000 Constraint 849 901 0.8000 1.0000 2.0000 0.0000 Constraint 849 887 0.8000 1.0000 2.0000 0.0000 Constraint 849 878 0.8000 1.0000 2.0000 0.0000 Constraint 849 869 0.8000 1.0000 2.0000 0.0000 Constraint 849 858 0.8000 1.0000 2.0000 0.0000 Constraint 844 1144 0.8000 1.0000 2.0000 0.0000 Constraint 844 1135 0.8000 1.0000 2.0000 0.0000 Constraint 844 1126 0.8000 1.0000 2.0000 0.0000 Constraint 844 1115 0.8000 1.0000 2.0000 0.0000 Constraint 844 1106 0.8000 1.0000 2.0000 0.0000 Constraint 844 1101 0.8000 1.0000 2.0000 0.0000 Constraint 844 1093 0.8000 1.0000 2.0000 0.0000 Constraint 844 1082 0.8000 1.0000 2.0000 0.0000 Constraint 844 1075 0.8000 1.0000 2.0000 0.0000 Constraint 844 1059 0.8000 1.0000 2.0000 0.0000 Constraint 844 1052 0.8000 1.0000 2.0000 0.0000 Constraint 844 1043 0.8000 1.0000 2.0000 0.0000 Constraint 844 1038 0.8000 1.0000 2.0000 0.0000 Constraint 844 1033 0.8000 1.0000 2.0000 0.0000 Constraint 844 1017 0.8000 1.0000 2.0000 0.0000 Constraint 844 992 0.8000 1.0000 2.0000 0.0000 Constraint 844 986 0.8000 1.0000 2.0000 0.0000 Constraint 844 977 0.8000 1.0000 2.0000 0.0000 Constraint 844 969 0.8000 1.0000 2.0000 0.0000 Constraint 844 961 0.8000 1.0000 2.0000 0.0000 Constraint 844 955 0.8000 1.0000 2.0000 0.0000 Constraint 844 950 0.8000 1.0000 2.0000 0.0000 Constraint 844 940 0.8000 1.0000 2.0000 0.0000 Constraint 844 932 0.8000 1.0000 2.0000 0.0000 Constraint 844 927 0.8000 1.0000 2.0000 0.0000 Constraint 844 916 0.8000 1.0000 2.0000 0.0000 Constraint 844 909 0.8000 1.0000 2.0000 0.0000 Constraint 844 901 0.8000 1.0000 2.0000 0.0000 Constraint 844 887 0.8000 1.0000 2.0000 0.0000 Constraint 844 878 0.8000 1.0000 2.0000 0.0000 Constraint 844 869 0.8000 1.0000 2.0000 0.0000 Constraint 844 858 0.8000 1.0000 2.0000 0.0000 Constraint 844 849 0.8000 1.0000 2.0000 0.0000 Constraint 833 1144 0.8000 1.0000 2.0000 0.0000 Constraint 833 1135 0.8000 1.0000 2.0000 0.0000 Constraint 833 1126 0.8000 1.0000 2.0000 0.0000 Constraint 833 1115 0.8000 1.0000 2.0000 0.0000 Constraint 833 1106 0.8000 1.0000 2.0000 0.0000 Constraint 833 1093 0.8000 1.0000 2.0000 0.0000 Constraint 833 1082 0.8000 1.0000 2.0000 0.0000 Constraint 833 1075 0.8000 1.0000 2.0000 0.0000 Constraint 833 1059 0.8000 1.0000 2.0000 0.0000 Constraint 833 1043 0.8000 1.0000 2.0000 0.0000 Constraint 833 1017 0.8000 1.0000 2.0000 0.0000 Constraint 833 992 0.8000 1.0000 2.0000 0.0000 Constraint 833 986 0.8000 1.0000 2.0000 0.0000 Constraint 833 977 0.8000 1.0000 2.0000 0.0000 Constraint 833 969 0.8000 1.0000 2.0000 0.0000 Constraint 833 932 0.8000 1.0000 2.0000 0.0000 Constraint 833 927 0.8000 1.0000 2.0000 0.0000 Constraint 833 909 0.8000 1.0000 2.0000 0.0000 Constraint 833 901 0.8000 1.0000 2.0000 0.0000 Constraint 833 887 0.8000 1.0000 2.0000 0.0000 Constraint 833 878 0.8000 1.0000 2.0000 0.0000 Constraint 833 869 0.8000 1.0000 2.0000 0.0000 Constraint 833 858 0.8000 1.0000 2.0000 0.0000 Constraint 833 849 0.8000 1.0000 2.0000 0.0000 Constraint 833 844 0.8000 1.0000 2.0000 0.0000 Constraint 825 1144 0.8000 1.0000 2.0000 0.0000 Constraint 825 1135 0.8000 1.0000 2.0000 0.0000 Constraint 825 1126 0.8000 1.0000 2.0000 0.0000 Constraint 825 1115 0.8000 1.0000 2.0000 0.0000 Constraint 825 1093 0.8000 1.0000 2.0000 0.0000 Constraint 825 1082 0.8000 1.0000 2.0000 0.0000 Constraint 825 1075 0.8000 1.0000 2.0000 0.0000 Constraint 825 1067 0.8000 1.0000 2.0000 0.0000 Constraint 825 1059 0.8000 1.0000 2.0000 0.0000 Constraint 825 1052 0.8000 1.0000 2.0000 0.0000 Constraint 825 1043 0.8000 1.0000 2.0000 0.0000 Constraint 825 1025 0.8000 1.0000 2.0000 0.0000 Constraint 825 1017 0.8000 1.0000 2.0000 0.0000 Constraint 825 1012 0.8000 1.0000 2.0000 0.0000 Constraint 825 1001 0.8000 1.0000 2.0000 0.0000 Constraint 825 992 0.8000 1.0000 2.0000 0.0000 Constraint 825 986 0.8000 1.0000 2.0000 0.0000 Constraint 825 977 0.8000 1.0000 2.0000 0.0000 Constraint 825 969 0.8000 1.0000 2.0000 0.0000 Constraint 825 909 0.8000 1.0000 2.0000 0.0000 Constraint 825 901 0.8000 1.0000 2.0000 0.0000 Constraint 825 887 0.8000 1.0000 2.0000 0.0000 Constraint 825 878 0.8000 1.0000 2.0000 0.0000 Constraint 825 869 0.8000 1.0000 2.0000 0.0000 Constraint 825 858 0.8000 1.0000 2.0000 0.0000 Constraint 825 849 0.8000 1.0000 2.0000 0.0000 Constraint 825 844 0.8000 1.0000 2.0000 0.0000 Constraint 825 833 0.8000 1.0000 2.0000 0.0000 Constraint 809 1144 0.8000 1.0000 2.0000 0.0000 Constraint 809 1135 0.8000 1.0000 2.0000 0.0000 Constraint 809 1126 0.8000 1.0000 2.0000 0.0000 Constraint 809 1115 0.8000 1.0000 2.0000 0.0000 Constraint 809 1106 0.8000 1.0000 2.0000 0.0000 Constraint 809 1101 0.8000 1.0000 2.0000 0.0000 Constraint 809 1093 0.8000 1.0000 2.0000 0.0000 Constraint 809 1082 0.8000 1.0000 2.0000 0.0000 Constraint 809 1075 0.8000 1.0000 2.0000 0.0000 Constraint 809 1067 0.8000 1.0000 2.0000 0.0000 Constraint 809 1059 0.8000 1.0000 2.0000 0.0000 Constraint 809 1052 0.8000 1.0000 2.0000 0.0000 Constraint 809 1043 0.8000 1.0000 2.0000 0.0000 Constraint 809 1025 0.8000 1.0000 2.0000 0.0000 Constraint 809 1017 0.8000 1.0000 2.0000 0.0000 Constraint 809 992 0.8000 1.0000 2.0000 0.0000 Constraint 809 986 0.8000 1.0000 2.0000 0.0000 Constraint 809 977 0.8000 1.0000 2.0000 0.0000 Constraint 809 969 0.8000 1.0000 2.0000 0.0000 Constraint 809 927 0.8000 1.0000 2.0000 0.0000 Constraint 809 916 0.8000 1.0000 2.0000 0.0000 Constraint 809 878 0.8000 1.0000 2.0000 0.0000 Constraint 809 869 0.8000 1.0000 2.0000 0.0000 Constraint 809 858 0.8000 1.0000 2.0000 0.0000 Constraint 809 849 0.8000 1.0000 2.0000 0.0000 Constraint 809 844 0.8000 1.0000 2.0000 0.0000 Constraint 809 833 0.8000 1.0000 2.0000 0.0000 Constraint 809 825 0.8000 1.0000 2.0000 0.0000 Constraint 801 1144 0.8000 1.0000 2.0000 0.0000 Constraint 801 1135 0.8000 1.0000 2.0000 0.0000 Constraint 801 1126 0.8000 1.0000 2.0000 0.0000 Constraint 801 1115 0.8000 1.0000 2.0000 0.0000 Constraint 801 1106 0.8000 1.0000 2.0000 0.0000 Constraint 801 1101 0.8000 1.0000 2.0000 0.0000 Constraint 801 1093 0.8000 1.0000 2.0000 0.0000 Constraint 801 1082 0.8000 1.0000 2.0000 0.0000 Constraint 801 1075 0.8000 1.0000 2.0000 0.0000 Constraint 801 1059 0.8000 1.0000 2.0000 0.0000 Constraint 801 1043 0.8000 1.0000 2.0000 0.0000 Constraint 801 1025 0.8000 1.0000 2.0000 0.0000 Constraint 801 1017 0.8000 1.0000 2.0000 0.0000 Constraint 801 1012 0.8000 1.0000 2.0000 0.0000 Constraint 801 1001 0.8000 1.0000 2.0000 0.0000 Constraint 801 992 0.8000 1.0000 2.0000 0.0000 Constraint 801 986 0.8000 1.0000 2.0000 0.0000 Constraint 801 977 0.8000 1.0000 2.0000 0.0000 Constraint 801 969 0.8000 1.0000 2.0000 0.0000 Constraint 801 940 0.8000 1.0000 2.0000 0.0000 Constraint 801 916 0.8000 1.0000 2.0000 0.0000 Constraint 801 909 0.8000 1.0000 2.0000 0.0000 Constraint 801 869 0.8000 1.0000 2.0000 0.0000 Constraint 801 858 0.8000 1.0000 2.0000 0.0000 Constraint 801 849 0.8000 1.0000 2.0000 0.0000 Constraint 801 844 0.8000 1.0000 2.0000 0.0000 Constraint 801 833 0.8000 1.0000 2.0000 0.0000 Constraint 801 825 0.8000 1.0000 2.0000 0.0000 Constraint 801 809 0.8000 1.0000 2.0000 0.0000 Constraint 793 1144 0.8000 1.0000 2.0000 0.0000 Constraint 793 1135 0.8000 1.0000 2.0000 0.0000 Constraint 793 1126 0.8000 1.0000 2.0000 0.0000 Constraint 793 1115 0.8000 1.0000 2.0000 0.0000 Constraint 793 1106 0.8000 1.0000 2.0000 0.0000 Constraint 793 1101 0.8000 1.0000 2.0000 0.0000 Constraint 793 1093 0.8000 1.0000 2.0000 0.0000 Constraint 793 1082 0.8000 1.0000 2.0000 0.0000 Constraint 793 1075 0.8000 1.0000 2.0000 0.0000 Constraint 793 1067 0.8000 1.0000 2.0000 0.0000 Constraint 793 1059 0.8000 1.0000 2.0000 0.0000 Constraint 793 1052 0.8000 1.0000 2.0000 0.0000 Constraint 793 1043 0.8000 1.0000 2.0000 0.0000 Constraint 793 1038 0.8000 1.0000 2.0000 0.0000 Constraint 793 1033 0.8000 1.0000 2.0000 0.0000 Constraint 793 1025 0.8000 1.0000 2.0000 0.0000 Constraint 793 1017 0.8000 1.0000 2.0000 0.0000 Constraint 793 1012 0.8000 1.0000 2.0000 0.0000 Constraint 793 1001 0.8000 1.0000 2.0000 0.0000 Constraint 793 992 0.8000 1.0000 2.0000 0.0000 Constraint 793 986 0.8000 1.0000 2.0000 0.0000 Constraint 793 977 0.8000 1.0000 2.0000 0.0000 Constraint 793 940 0.8000 1.0000 2.0000 0.0000 Constraint 793 916 0.8000 1.0000 2.0000 0.0000 Constraint 793 909 0.8000 1.0000 2.0000 0.0000 Constraint 793 901 0.8000 1.0000 2.0000 0.0000 Constraint 793 887 0.8000 1.0000 2.0000 0.0000 Constraint 793 878 0.8000 1.0000 2.0000 0.0000 Constraint 793 869 0.8000 1.0000 2.0000 0.0000 Constraint 793 858 0.8000 1.0000 2.0000 0.0000 Constraint 793 849 0.8000 1.0000 2.0000 0.0000 Constraint 793 844 0.8000 1.0000 2.0000 0.0000 Constraint 793 833 0.8000 1.0000 2.0000 0.0000 Constraint 793 825 0.8000 1.0000 2.0000 0.0000 Constraint 793 809 0.8000 1.0000 2.0000 0.0000 Constraint 793 801 0.8000 1.0000 2.0000 0.0000 Constraint 782 1144 0.8000 1.0000 2.0000 0.0000 Constraint 782 1135 0.8000 1.0000 2.0000 0.0000 Constraint 782 1126 0.8000 1.0000 2.0000 0.0000 Constraint 782 1115 0.8000 1.0000 2.0000 0.0000 Constraint 782 1106 0.8000 1.0000 2.0000 0.0000 Constraint 782 1101 0.8000 1.0000 2.0000 0.0000 Constraint 782 1093 0.8000 1.0000 2.0000 0.0000 Constraint 782 1082 0.8000 1.0000 2.0000 0.0000 Constraint 782 1075 0.8000 1.0000 2.0000 0.0000 Constraint 782 1067 0.8000 1.0000 2.0000 0.0000 Constraint 782 1059 0.8000 1.0000 2.0000 0.0000 Constraint 782 1052 0.8000 1.0000 2.0000 0.0000 Constraint 782 1043 0.8000 1.0000 2.0000 0.0000 Constraint 782 1038 0.8000 1.0000 2.0000 0.0000 Constraint 782 1033 0.8000 1.0000 2.0000 0.0000 Constraint 782 1025 0.8000 1.0000 2.0000 0.0000 Constraint 782 1017 0.8000 1.0000 2.0000 0.0000 Constraint 782 1012 0.8000 1.0000 2.0000 0.0000 Constraint 782 1001 0.8000 1.0000 2.0000 0.0000 Constraint 782 992 0.8000 1.0000 2.0000 0.0000 Constraint 782 986 0.8000 1.0000 2.0000 0.0000 Constraint 782 977 0.8000 1.0000 2.0000 0.0000 Constraint 782 940 0.8000 1.0000 2.0000 0.0000 Constraint 782 932 0.8000 1.0000 2.0000 0.0000 Constraint 782 927 0.8000 1.0000 2.0000 0.0000 Constraint 782 916 0.8000 1.0000 2.0000 0.0000 Constraint 782 909 0.8000 1.0000 2.0000 0.0000 Constraint 782 901 0.8000 1.0000 2.0000 0.0000 Constraint 782 887 0.8000 1.0000 2.0000 0.0000 Constraint 782 878 0.8000 1.0000 2.0000 0.0000 Constraint 782 869 0.8000 1.0000 2.0000 0.0000 Constraint 782 858 0.8000 1.0000 2.0000 0.0000 Constraint 782 849 0.8000 1.0000 2.0000 0.0000 Constraint 782 844 0.8000 1.0000 2.0000 0.0000 Constraint 782 833 0.8000 1.0000 2.0000 0.0000 Constraint 782 825 0.8000 1.0000 2.0000 0.0000 Constraint 782 809 0.8000 1.0000 2.0000 0.0000 Constraint 782 801 0.8000 1.0000 2.0000 0.0000 Constraint 782 793 0.8000 1.0000 2.0000 0.0000 Constraint 771 1144 0.8000 1.0000 2.0000 0.0000 Constraint 771 1135 0.8000 1.0000 2.0000 0.0000 Constraint 771 1126 0.8000 1.0000 2.0000 0.0000 Constraint 771 1115 0.8000 1.0000 2.0000 0.0000 Constraint 771 1106 0.8000 1.0000 2.0000 0.0000 Constraint 771 1101 0.8000 1.0000 2.0000 0.0000 Constraint 771 1093 0.8000 1.0000 2.0000 0.0000 Constraint 771 1082 0.8000 1.0000 2.0000 0.0000 Constraint 771 1075 0.8000 1.0000 2.0000 0.0000 Constraint 771 1067 0.8000 1.0000 2.0000 0.0000 Constraint 771 1059 0.8000 1.0000 2.0000 0.0000 Constraint 771 1052 0.8000 1.0000 2.0000 0.0000 Constraint 771 1043 0.8000 1.0000 2.0000 0.0000 Constraint 771 1038 0.8000 1.0000 2.0000 0.0000 Constraint 771 1033 0.8000 1.0000 2.0000 0.0000 Constraint 771 1025 0.8000 1.0000 2.0000 0.0000 Constraint 771 1017 0.8000 1.0000 2.0000 0.0000 Constraint 771 1012 0.8000 1.0000 2.0000 0.0000 Constraint 771 1001 0.8000 1.0000 2.0000 0.0000 Constraint 771 961 0.8000 1.0000 2.0000 0.0000 Constraint 771 955 0.8000 1.0000 2.0000 0.0000 Constraint 771 940 0.8000 1.0000 2.0000 0.0000 Constraint 771 932 0.8000 1.0000 2.0000 0.0000 Constraint 771 927 0.8000 1.0000 2.0000 0.0000 Constraint 771 916 0.8000 1.0000 2.0000 0.0000 Constraint 771 909 0.8000 1.0000 2.0000 0.0000 Constraint 771 901 0.8000 1.0000 2.0000 0.0000 Constraint 771 869 0.8000 1.0000 2.0000 0.0000 Constraint 771 858 0.8000 1.0000 2.0000 0.0000 Constraint 771 844 0.8000 1.0000 2.0000 0.0000 Constraint 771 833 0.8000 1.0000 2.0000 0.0000 Constraint 771 825 0.8000 1.0000 2.0000 0.0000 Constraint 771 809 0.8000 1.0000 2.0000 0.0000 Constraint 771 801 0.8000 1.0000 2.0000 0.0000 Constraint 771 793 0.8000 1.0000 2.0000 0.0000 Constraint 771 782 0.8000 1.0000 2.0000 0.0000 Constraint 758 1144 0.8000 1.0000 2.0000 0.0000 Constraint 758 1135 0.8000 1.0000 2.0000 0.0000 Constraint 758 1126 0.8000 1.0000 2.0000 0.0000 Constraint 758 1115 0.8000 1.0000 2.0000 0.0000 Constraint 758 1106 0.8000 1.0000 2.0000 0.0000 Constraint 758 1101 0.8000 1.0000 2.0000 0.0000 Constraint 758 1093 0.8000 1.0000 2.0000 0.0000 Constraint 758 1082 0.8000 1.0000 2.0000 0.0000 Constraint 758 1075 0.8000 1.0000 2.0000 0.0000 Constraint 758 1067 0.8000 1.0000 2.0000 0.0000 Constraint 758 1059 0.8000 1.0000 2.0000 0.0000 Constraint 758 1052 0.8000 1.0000 2.0000 0.0000 Constraint 758 1043 0.8000 1.0000 2.0000 0.0000 Constraint 758 1038 0.8000 1.0000 2.0000 0.0000 Constraint 758 1033 0.8000 1.0000 2.0000 0.0000 Constraint 758 1025 0.8000 1.0000 2.0000 0.0000 Constraint 758 1017 0.8000 1.0000 2.0000 0.0000 Constraint 758 1012 0.8000 1.0000 2.0000 0.0000 Constraint 758 977 0.8000 1.0000 2.0000 0.0000 Constraint 758 961 0.8000 1.0000 2.0000 0.0000 Constraint 758 955 0.8000 1.0000 2.0000 0.0000 Constraint 758 950 0.8000 1.0000 2.0000 0.0000 Constraint 758 940 0.8000 1.0000 2.0000 0.0000 Constraint 758 932 0.8000 1.0000 2.0000 0.0000 Constraint 758 927 0.8000 1.0000 2.0000 0.0000 Constraint 758 916 0.8000 1.0000 2.0000 0.0000 Constraint 758 909 0.8000 1.0000 2.0000 0.0000 Constraint 758 901 0.8000 1.0000 2.0000 0.0000 Constraint 758 887 0.8000 1.0000 2.0000 0.0000 Constraint 758 825 0.8000 1.0000 2.0000 0.0000 Constraint 758 809 0.8000 1.0000 2.0000 0.0000 Constraint 758 801 0.8000 1.0000 2.0000 0.0000 Constraint 758 793 0.8000 1.0000 2.0000 0.0000 Constraint 758 782 0.8000 1.0000 2.0000 0.0000 Constraint 758 771 0.8000 1.0000 2.0000 0.0000 Constraint 752 1144 0.8000 1.0000 2.0000 0.0000 Constraint 752 1135 0.8000 1.0000 2.0000 0.0000 Constraint 752 1126 0.8000 1.0000 2.0000 0.0000 Constraint 752 1115 0.8000 1.0000 2.0000 0.0000 Constraint 752 1106 0.8000 1.0000 2.0000 0.0000 Constraint 752 1101 0.8000 1.0000 2.0000 0.0000 Constraint 752 1093 0.8000 1.0000 2.0000 0.0000 Constraint 752 1082 0.8000 1.0000 2.0000 0.0000 Constraint 752 1075 0.8000 1.0000 2.0000 0.0000 Constraint 752 1067 0.8000 1.0000 2.0000 0.0000 Constraint 752 1059 0.8000 1.0000 2.0000 0.0000 Constraint 752 1052 0.8000 1.0000 2.0000 0.0000 Constraint 752 1043 0.8000 1.0000 2.0000 0.0000 Constraint 752 1038 0.8000 1.0000 2.0000 0.0000 Constraint 752 1033 0.8000 1.0000 2.0000 0.0000 Constraint 752 1025 0.8000 1.0000 2.0000 0.0000 Constraint 752 1017 0.8000 1.0000 2.0000 0.0000 Constraint 752 1012 0.8000 1.0000 2.0000 0.0000 Constraint 752 1001 0.8000 1.0000 2.0000 0.0000 Constraint 752 992 0.8000 1.0000 2.0000 0.0000 Constraint 752 986 0.8000 1.0000 2.0000 0.0000 Constraint 752 977 0.8000 1.0000 2.0000 0.0000 Constraint 752 969 0.8000 1.0000 2.0000 0.0000 Constraint 752 961 0.8000 1.0000 2.0000 0.0000 Constraint 752 955 0.8000 1.0000 2.0000 0.0000 Constraint 752 950 0.8000 1.0000 2.0000 0.0000 Constraint 752 940 0.8000 1.0000 2.0000 0.0000 Constraint 752 932 0.8000 1.0000 2.0000 0.0000 Constraint 752 927 0.8000 1.0000 2.0000 0.0000 Constraint 752 916 0.8000 1.0000 2.0000 0.0000 Constraint 752 909 0.8000 1.0000 2.0000 0.0000 Constraint 752 887 0.8000 1.0000 2.0000 0.0000 Constraint 752 878 0.8000 1.0000 2.0000 0.0000 Constraint 752 844 0.8000 1.0000 2.0000 0.0000 Constraint 752 809 0.8000 1.0000 2.0000 0.0000 Constraint 752 801 0.8000 1.0000 2.0000 0.0000 Constraint 752 793 0.8000 1.0000 2.0000 0.0000 Constraint 752 782 0.8000 1.0000 2.0000 0.0000 Constraint 752 771 0.8000 1.0000 2.0000 0.0000 Constraint 752 758 0.8000 1.0000 2.0000 0.0000 Constraint 746 1144 0.8000 1.0000 2.0000 0.0000 Constraint 746 1135 0.8000 1.0000 2.0000 0.0000 Constraint 746 1126 0.8000 1.0000 2.0000 0.0000 Constraint 746 1115 0.8000 1.0000 2.0000 0.0000 Constraint 746 1106 0.8000 1.0000 2.0000 0.0000 Constraint 746 1101 0.8000 1.0000 2.0000 0.0000 Constraint 746 1093 0.8000 1.0000 2.0000 0.0000 Constraint 746 1082 0.8000 1.0000 2.0000 0.0000 Constraint 746 1075 0.8000 1.0000 2.0000 0.0000 Constraint 746 1067 0.8000 1.0000 2.0000 0.0000 Constraint 746 1059 0.8000 1.0000 2.0000 0.0000 Constraint 746 1052 0.8000 1.0000 2.0000 0.0000 Constraint 746 1043 0.8000 1.0000 2.0000 0.0000 Constraint 746 1038 0.8000 1.0000 2.0000 0.0000 Constraint 746 1033 0.8000 1.0000 2.0000 0.0000 Constraint 746 1025 0.8000 1.0000 2.0000 0.0000 Constraint 746 1017 0.8000 1.0000 2.0000 0.0000 Constraint 746 1012 0.8000 1.0000 2.0000 0.0000 Constraint 746 992 0.8000 1.0000 2.0000 0.0000 Constraint 746 986 0.8000 1.0000 2.0000 0.0000 Constraint 746 977 0.8000 1.0000 2.0000 0.0000 Constraint 746 969 0.8000 1.0000 2.0000 0.0000 Constraint 746 955 0.8000 1.0000 2.0000 0.0000 Constraint 746 950 0.8000 1.0000 2.0000 0.0000 Constraint 746 940 0.8000 1.0000 2.0000 0.0000 Constraint 746 932 0.8000 1.0000 2.0000 0.0000 Constraint 746 927 0.8000 1.0000 2.0000 0.0000 Constraint 746 916 0.8000 1.0000 2.0000 0.0000 Constraint 746 909 0.8000 1.0000 2.0000 0.0000 Constraint 746 901 0.8000 1.0000 2.0000 0.0000 Constraint 746 887 0.8000 1.0000 2.0000 0.0000 Constraint 746 878 0.8000 1.0000 2.0000 0.0000 Constraint 746 869 0.8000 1.0000 2.0000 0.0000 Constraint 746 849 0.8000 1.0000 2.0000 0.0000 Constraint 746 844 0.8000 1.0000 2.0000 0.0000 Constraint 746 833 0.8000 1.0000 2.0000 0.0000 Constraint 746 809 0.8000 1.0000 2.0000 0.0000 Constraint 746 801 0.8000 1.0000 2.0000 0.0000 Constraint 746 793 0.8000 1.0000 2.0000 0.0000 Constraint 746 782 0.8000 1.0000 2.0000 0.0000 Constraint 746 771 0.8000 1.0000 2.0000 0.0000 Constraint 746 758 0.8000 1.0000 2.0000 0.0000 Constraint 746 752 0.8000 1.0000 2.0000 0.0000 Constraint 738 1144 0.8000 1.0000 2.0000 0.0000 Constraint 738 1135 0.8000 1.0000 2.0000 0.0000 Constraint 738 1126 0.8000 1.0000 2.0000 0.0000 Constraint 738 1115 0.8000 1.0000 2.0000 0.0000 Constraint 738 1106 0.8000 1.0000 2.0000 0.0000 Constraint 738 1101 0.8000 1.0000 2.0000 0.0000 Constraint 738 1082 0.8000 1.0000 2.0000 0.0000 Constraint 738 1075 0.8000 1.0000 2.0000 0.0000 Constraint 738 1067 0.8000 1.0000 2.0000 0.0000 Constraint 738 1059 0.8000 1.0000 2.0000 0.0000 Constraint 738 1052 0.8000 1.0000 2.0000 0.0000 Constraint 738 1043 0.8000 1.0000 2.0000 0.0000 Constraint 738 1038 0.8000 1.0000 2.0000 0.0000 Constraint 738 1033 0.8000 1.0000 2.0000 0.0000 Constraint 738 1025 0.8000 1.0000 2.0000 0.0000 Constraint 738 1017 0.8000 1.0000 2.0000 0.0000 Constraint 738 1012 0.8000 1.0000 2.0000 0.0000 Constraint 738 1001 0.8000 1.0000 2.0000 0.0000 Constraint 738 992 0.8000 1.0000 2.0000 0.0000 Constraint 738 986 0.8000 1.0000 2.0000 0.0000 Constraint 738 977 0.8000 1.0000 2.0000 0.0000 Constraint 738 969 0.8000 1.0000 2.0000 0.0000 Constraint 738 961 0.8000 1.0000 2.0000 0.0000 Constraint 738 955 0.8000 1.0000 2.0000 0.0000 Constraint 738 950 0.8000 1.0000 2.0000 0.0000 Constraint 738 940 0.8000 1.0000 2.0000 0.0000 Constraint 738 916 0.8000 1.0000 2.0000 0.0000 Constraint 738 909 0.8000 1.0000 2.0000 0.0000 Constraint 738 887 0.8000 1.0000 2.0000 0.0000 Constraint 738 878 0.8000 1.0000 2.0000 0.0000 Constraint 738 849 0.8000 1.0000 2.0000 0.0000 Constraint 738 844 0.8000 1.0000 2.0000 0.0000 Constraint 738 801 0.8000 1.0000 2.0000 0.0000 Constraint 738 793 0.8000 1.0000 2.0000 0.0000 Constraint 738 782 0.8000 1.0000 2.0000 0.0000 Constraint 738 771 0.8000 1.0000 2.0000 0.0000 Constraint 738 758 0.8000 1.0000 2.0000 0.0000 Constraint 738 752 0.8000 1.0000 2.0000 0.0000 Constraint 738 746 0.8000 1.0000 2.0000 0.0000 Constraint 732 1144 0.8000 1.0000 2.0000 0.0000 Constraint 732 1135 0.8000 1.0000 2.0000 0.0000 Constraint 732 1126 0.8000 1.0000 2.0000 0.0000 Constraint 732 1115 0.8000 1.0000 2.0000 0.0000 Constraint 732 1106 0.8000 1.0000 2.0000 0.0000 Constraint 732 1101 0.8000 1.0000 2.0000 0.0000 Constraint 732 1093 0.8000 1.0000 2.0000 0.0000 Constraint 732 1082 0.8000 1.0000 2.0000 0.0000 Constraint 732 1075 0.8000 1.0000 2.0000 0.0000 Constraint 732 1067 0.8000 1.0000 2.0000 0.0000 Constraint 732 1059 0.8000 1.0000 2.0000 0.0000 Constraint 732 1052 0.8000 1.0000 2.0000 0.0000 Constraint 732 1043 0.8000 1.0000 2.0000 0.0000 Constraint 732 1038 0.8000 1.0000 2.0000 0.0000 Constraint 732 1033 0.8000 1.0000 2.0000 0.0000 Constraint 732 1025 0.8000 1.0000 2.0000 0.0000 Constraint 732 1017 0.8000 1.0000 2.0000 0.0000 Constraint 732 1012 0.8000 1.0000 2.0000 0.0000 Constraint 732 1001 0.8000 1.0000 2.0000 0.0000 Constraint 732 992 0.8000 1.0000 2.0000 0.0000 Constraint 732 986 0.8000 1.0000 2.0000 0.0000 Constraint 732 977 0.8000 1.0000 2.0000 0.0000 Constraint 732 969 0.8000 1.0000 2.0000 0.0000 Constraint 732 961 0.8000 1.0000 2.0000 0.0000 Constraint 732 955 0.8000 1.0000 2.0000 0.0000 Constraint 732 950 0.8000 1.0000 2.0000 0.0000 Constraint 732 940 0.8000 1.0000 2.0000 0.0000 Constraint 732 932 0.8000 1.0000 2.0000 0.0000 Constraint 732 927 0.8000 1.0000 2.0000 0.0000 Constraint 732 916 0.8000 1.0000 2.0000 0.0000 Constraint 732 909 0.8000 1.0000 2.0000 0.0000 Constraint 732 901 0.8000 1.0000 2.0000 0.0000 Constraint 732 887 0.8000 1.0000 2.0000 0.0000 Constraint 732 878 0.8000 1.0000 2.0000 0.0000 Constraint 732 869 0.8000 1.0000 2.0000 0.0000 Constraint 732 858 0.8000 1.0000 2.0000 0.0000 Constraint 732 849 0.8000 1.0000 2.0000 0.0000 Constraint 732 844 0.8000 1.0000 2.0000 0.0000 Constraint 732 801 0.8000 1.0000 2.0000 0.0000 Constraint 732 793 0.8000 1.0000 2.0000 0.0000 Constraint 732 782 0.8000 1.0000 2.0000 0.0000 Constraint 732 771 0.8000 1.0000 2.0000 0.0000 Constraint 732 758 0.8000 1.0000 2.0000 0.0000 Constraint 732 752 0.8000 1.0000 2.0000 0.0000 Constraint 732 746 0.8000 1.0000 2.0000 0.0000 Constraint 732 738 0.8000 1.0000 2.0000 0.0000 Constraint 725 1144 0.8000 1.0000 2.0000 0.0000 Constraint 725 1135 0.8000 1.0000 2.0000 0.0000 Constraint 725 1126 0.8000 1.0000 2.0000 0.0000 Constraint 725 1115 0.8000 1.0000 2.0000 0.0000 Constraint 725 1106 0.8000 1.0000 2.0000 0.0000 Constraint 725 1101 0.8000 1.0000 2.0000 0.0000 Constraint 725 1093 0.8000 1.0000 2.0000 0.0000 Constraint 725 1082 0.8000 1.0000 2.0000 0.0000 Constraint 725 1075 0.8000 1.0000 2.0000 0.0000 Constraint 725 1067 0.8000 1.0000 2.0000 0.0000 Constraint 725 1059 0.8000 1.0000 2.0000 0.0000 Constraint 725 1052 0.8000 1.0000 2.0000 0.0000 Constraint 725 1043 0.8000 1.0000 2.0000 0.0000 Constraint 725 1038 0.8000 1.0000 2.0000 0.0000 Constraint 725 1025 0.8000 1.0000 2.0000 0.0000 Constraint 725 1017 0.8000 1.0000 2.0000 0.0000 Constraint 725 1012 0.8000 1.0000 2.0000 0.0000 Constraint 725 992 0.8000 1.0000 2.0000 0.0000 Constraint 725 986 0.8000 1.0000 2.0000 0.0000 Constraint 725 977 0.8000 1.0000 2.0000 0.0000 Constraint 725 969 0.8000 1.0000 2.0000 0.0000 Constraint 725 961 0.8000 1.0000 2.0000 0.0000 Constraint 725 955 0.8000 1.0000 2.0000 0.0000 Constraint 725 950 0.8000 1.0000 2.0000 0.0000 Constraint 725 940 0.8000 1.0000 2.0000 0.0000 Constraint 725 927 0.8000 1.0000 2.0000 0.0000 Constraint 725 916 0.8000 1.0000 2.0000 0.0000 Constraint 725 878 0.8000 1.0000 2.0000 0.0000 Constraint 725 869 0.8000 1.0000 2.0000 0.0000 Constraint 725 849 0.8000 1.0000 2.0000 0.0000 Constraint 725 801 0.8000 1.0000 2.0000 0.0000 Constraint 725 793 0.8000 1.0000 2.0000 0.0000 Constraint 725 782 0.8000 1.0000 2.0000 0.0000 Constraint 725 771 0.8000 1.0000 2.0000 0.0000 Constraint 725 758 0.8000 1.0000 2.0000 0.0000 Constraint 725 752 0.8000 1.0000 2.0000 0.0000 Constraint 725 746 0.8000 1.0000 2.0000 0.0000 Constraint 725 738 0.8000 1.0000 2.0000 0.0000 Constraint 725 732 0.8000 1.0000 2.0000 0.0000 Constraint 714 1144 0.8000 1.0000 2.0000 0.0000 Constraint 714 1135 0.8000 1.0000 2.0000 0.0000 Constraint 714 1126 0.8000 1.0000 2.0000 0.0000 Constraint 714 1115 0.8000 1.0000 2.0000 0.0000 Constraint 714 1106 0.8000 1.0000 2.0000 0.0000 Constraint 714 1101 0.8000 1.0000 2.0000 0.0000 Constraint 714 1093 0.8000 1.0000 2.0000 0.0000 Constraint 714 1082 0.8000 1.0000 2.0000 0.0000 Constraint 714 1075 0.8000 1.0000 2.0000 0.0000 Constraint 714 1067 0.8000 1.0000 2.0000 0.0000 Constraint 714 1059 0.8000 1.0000 2.0000 0.0000 Constraint 714 1052 0.8000 1.0000 2.0000 0.0000 Constraint 714 1043 0.8000 1.0000 2.0000 0.0000 Constraint 714 1038 0.8000 1.0000 2.0000 0.0000 Constraint 714 1033 0.8000 1.0000 2.0000 0.0000 Constraint 714 1025 0.8000 1.0000 2.0000 0.0000 Constraint 714 1017 0.8000 1.0000 2.0000 0.0000 Constraint 714 1012 0.8000 1.0000 2.0000 0.0000 Constraint 714 1001 0.8000 1.0000 2.0000 0.0000 Constraint 714 992 0.8000 1.0000 2.0000 0.0000 Constraint 714 986 0.8000 1.0000 2.0000 0.0000 Constraint 714 977 0.8000 1.0000 2.0000 0.0000 Constraint 714 969 0.8000 1.0000 2.0000 0.0000 Constraint 714 961 0.8000 1.0000 2.0000 0.0000 Constraint 714 955 0.8000 1.0000 2.0000 0.0000 Constraint 714 950 0.8000 1.0000 2.0000 0.0000 Constraint 714 940 0.8000 1.0000 2.0000 0.0000 Constraint 714 932 0.8000 1.0000 2.0000 0.0000 Constraint 714 927 0.8000 1.0000 2.0000 0.0000 Constraint 714 916 0.8000 1.0000 2.0000 0.0000 Constraint 714 909 0.8000 1.0000 2.0000 0.0000 Constraint 714 901 0.8000 1.0000 2.0000 0.0000 Constraint 714 887 0.8000 1.0000 2.0000 0.0000 Constraint 714 878 0.8000 1.0000 2.0000 0.0000 Constraint 714 869 0.8000 1.0000 2.0000 0.0000 Constraint 714 849 0.8000 1.0000 2.0000 0.0000 Constraint 714 809 0.8000 1.0000 2.0000 0.0000 Constraint 714 801 0.8000 1.0000 2.0000 0.0000 Constraint 714 782 0.8000 1.0000 2.0000 0.0000 Constraint 714 771 0.8000 1.0000 2.0000 0.0000 Constraint 714 758 0.8000 1.0000 2.0000 0.0000 Constraint 714 752 0.8000 1.0000 2.0000 0.0000 Constraint 714 746 0.8000 1.0000 2.0000 0.0000 Constraint 714 738 0.8000 1.0000 2.0000 0.0000 Constraint 714 732 0.8000 1.0000 2.0000 0.0000 Constraint 714 725 0.8000 1.0000 2.0000 0.0000 Constraint 707 1144 0.8000 1.0000 2.0000 0.0000 Constraint 707 1135 0.8000 1.0000 2.0000 0.0000 Constraint 707 1126 0.8000 1.0000 2.0000 0.0000 Constraint 707 1115 0.8000 1.0000 2.0000 0.0000 Constraint 707 1106 0.8000 1.0000 2.0000 0.0000 Constraint 707 1101 0.8000 1.0000 2.0000 0.0000 Constraint 707 1093 0.8000 1.0000 2.0000 0.0000 Constraint 707 1082 0.8000 1.0000 2.0000 0.0000 Constraint 707 1075 0.8000 1.0000 2.0000 0.0000 Constraint 707 1067 0.8000 1.0000 2.0000 0.0000 Constraint 707 1059 0.8000 1.0000 2.0000 0.0000 Constraint 707 1052 0.8000 1.0000 2.0000 0.0000 Constraint 707 1043 0.8000 1.0000 2.0000 0.0000 Constraint 707 1038 0.8000 1.0000 2.0000 0.0000 Constraint 707 1033 0.8000 1.0000 2.0000 0.0000 Constraint 707 1025 0.8000 1.0000 2.0000 0.0000 Constraint 707 1017 0.8000 1.0000 2.0000 0.0000 Constraint 707 1012 0.8000 1.0000 2.0000 0.0000 Constraint 707 992 0.8000 1.0000 2.0000 0.0000 Constraint 707 986 0.8000 1.0000 2.0000 0.0000 Constraint 707 977 0.8000 1.0000 2.0000 0.0000 Constraint 707 969 0.8000 1.0000 2.0000 0.0000 Constraint 707 961 0.8000 1.0000 2.0000 0.0000 Constraint 707 955 0.8000 1.0000 2.0000 0.0000 Constraint 707 950 0.8000 1.0000 2.0000 0.0000 Constraint 707 940 0.8000 1.0000 2.0000 0.0000 Constraint 707 932 0.8000 1.0000 2.0000 0.0000 Constraint 707 927 0.8000 1.0000 2.0000 0.0000 Constraint 707 916 0.8000 1.0000 2.0000 0.0000 Constraint 707 909 0.8000 1.0000 2.0000 0.0000 Constraint 707 901 0.8000 1.0000 2.0000 0.0000 Constraint 707 887 0.8000 1.0000 2.0000 0.0000 Constraint 707 878 0.8000 1.0000 2.0000 0.0000 Constraint 707 869 0.8000 1.0000 2.0000 0.0000 Constraint 707 849 0.8000 1.0000 2.0000 0.0000 Constraint 707 844 0.8000 1.0000 2.0000 0.0000 Constraint 707 833 0.8000 1.0000 2.0000 0.0000 Constraint 707 825 0.8000 1.0000 2.0000 0.0000 Constraint 707 809 0.8000 1.0000 2.0000 0.0000 Constraint 707 801 0.8000 1.0000 2.0000 0.0000 Constraint 707 793 0.8000 1.0000 2.0000 0.0000 Constraint 707 782 0.8000 1.0000 2.0000 0.0000 Constraint 707 771 0.8000 1.0000 2.0000 0.0000 Constraint 707 758 0.8000 1.0000 2.0000 0.0000 Constraint 707 752 0.8000 1.0000 2.0000 0.0000 Constraint 707 746 0.8000 1.0000 2.0000 0.0000 Constraint 707 738 0.8000 1.0000 2.0000 0.0000 Constraint 707 732 0.8000 1.0000 2.0000 0.0000 Constraint 707 725 0.8000 1.0000 2.0000 0.0000 Constraint 707 714 0.8000 1.0000 2.0000 0.0000 Constraint 696 1144 0.8000 1.0000 2.0000 0.0000 Constraint 696 1135 0.8000 1.0000 2.0000 0.0000 Constraint 696 1126 0.8000 1.0000 2.0000 0.0000 Constraint 696 1115 0.8000 1.0000 2.0000 0.0000 Constraint 696 1106 0.8000 1.0000 2.0000 0.0000 Constraint 696 1101 0.8000 1.0000 2.0000 0.0000 Constraint 696 1093 0.8000 1.0000 2.0000 0.0000 Constraint 696 1082 0.8000 1.0000 2.0000 0.0000 Constraint 696 1075 0.8000 1.0000 2.0000 0.0000 Constraint 696 1067 0.8000 1.0000 2.0000 0.0000 Constraint 696 1059 0.8000 1.0000 2.0000 0.0000 Constraint 696 1052 0.8000 1.0000 2.0000 0.0000 Constraint 696 1043 0.8000 1.0000 2.0000 0.0000 Constraint 696 1038 0.8000 1.0000 2.0000 0.0000 Constraint 696 1033 0.8000 1.0000 2.0000 0.0000 Constraint 696 1025 0.8000 1.0000 2.0000 0.0000 Constraint 696 1017 0.8000 1.0000 2.0000 0.0000 Constraint 696 1012 0.8000 1.0000 2.0000 0.0000 Constraint 696 1001 0.8000 1.0000 2.0000 0.0000 Constraint 696 992 0.8000 1.0000 2.0000 0.0000 Constraint 696 986 0.8000 1.0000 2.0000 0.0000 Constraint 696 977 0.8000 1.0000 2.0000 0.0000 Constraint 696 969 0.8000 1.0000 2.0000 0.0000 Constraint 696 961 0.8000 1.0000 2.0000 0.0000 Constraint 696 955 0.8000 1.0000 2.0000 0.0000 Constraint 696 950 0.8000 1.0000 2.0000 0.0000 Constraint 696 940 0.8000 1.0000 2.0000 0.0000 Constraint 696 932 0.8000 1.0000 2.0000 0.0000 Constraint 696 927 0.8000 1.0000 2.0000 0.0000 Constraint 696 916 0.8000 1.0000 2.0000 0.0000 Constraint 696 909 0.8000 1.0000 2.0000 0.0000 Constraint 696 901 0.8000 1.0000 2.0000 0.0000 Constraint 696 887 0.8000 1.0000 2.0000 0.0000 Constraint 696 878 0.8000 1.0000 2.0000 0.0000 Constraint 696 869 0.8000 1.0000 2.0000 0.0000 Constraint 696 858 0.8000 1.0000 2.0000 0.0000 Constraint 696 849 0.8000 1.0000 2.0000 0.0000 Constraint 696 844 0.8000 1.0000 2.0000 0.0000 Constraint 696 833 0.8000 1.0000 2.0000 0.0000 Constraint 696 825 0.8000 1.0000 2.0000 0.0000 Constraint 696 809 0.8000 1.0000 2.0000 0.0000 Constraint 696 801 0.8000 1.0000 2.0000 0.0000 Constraint 696 793 0.8000 1.0000 2.0000 0.0000 Constraint 696 782 0.8000 1.0000 2.0000 0.0000 Constraint 696 771 0.8000 1.0000 2.0000 0.0000 Constraint 696 758 0.8000 1.0000 2.0000 0.0000 Constraint 696 752 0.8000 1.0000 2.0000 0.0000 Constraint 696 746 0.8000 1.0000 2.0000 0.0000 Constraint 696 738 0.8000 1.0000 2.0000 0.0000 Constraint 696 732 0.8000 1.0000 2.0000 0.0000 Constraint 696 725 0.8000 1.0000 2.0000 0.0000 Constraint 696 714 0.8000 1.0000 2.0000 0.0000 Constraint 696 707 0.8000 1.0000 2.0000 0.0000 Constraint 685 1144 0.8000 1.0000 2.0000 0.0000 Constraint 685 1135 0.8000 1.0000 2.0000 0.0000 Constraint 685 1126 0.8000 1.0000 2.0000 0.0000 Constraint 685 1115 0.8000 1.0000 2.0000 0.0000 Constraint 685 1106 0.8000 1.0000 2.0000 0.0000 Constraint 685 1101 0.8000 1.0000 2.0000 0.0000 Constraint 685 1093 0.8000 1.0000 2.0000 0.0000 Constraint 685 1082 0.8000 1.0000 2.0000 0.0000 Constraint 685 1075 0.8000 1.0000 2.0000 0.0000 Constraint 685 1067 0.8000 1.0000 2.0000 0.0000 Constraint 685 1059 0.8000 1.0000 2.0000 0.0000 Constraint 685 1052 0.8000 1.0000 2.0000 0.0000 Constraint 685 1043 0.8000 1.0000 2.0000 0.0000 Constraint 685 1038 0.8000 1.0000 2.0000 0.0000 Constraint 685 1033 0.8000 1.0000 2.0000 0.0000 Constraint 685 1025 0.8000 1.0000 2.0000 0.0000 Constraint 685 1017 0.8000 1.0000 2.0000 0.0000 Constraint 685 1012 0.8000 1.0000 2.0000 0.0000 Constraint 685 1001 0.8000 1.0000 2.0000 0.0000 Constraint 685 992 0.8000 1.0000 2.0000 0.0000 Constraint 685 986 0.8000 1.0000 2.0000 0.0000 Constraint 685 977 0.8000 1.0000 2.0000 0.0000 Constraint 685 969 0.8000 1.0000 2.0000 0.0000 Constraint 685 961 0.8000 1.0000 2.0000 0.0000 Constraint 685 955 0.8000 1.0000 2.0000 0.0000 Constraint 685 950 0.8000 1.0000 2.0000 0.0000 Constraint 685 940 0.8000 1.0000 2.0000 0.0000 Constraint 685 932 0.8000 1.0000 2.0000 0.0000 Constraint 685 927 0.8000 1.0000 2.0000 0.0000 Constraint 685 916 0.8000 1.0000 2.0000 0.0000 Constraint 685 909 0.8000 1.0000 2.0000 0.0000 Constraint 685 901 0.8000 1.0000 2.0000 0.0000 Constraint 685 887 0.8000 1.0000 2.0000 0.0000 Constraint 685 878 0.8000 1.0000 2.0000 0.0000 Constraint 685 869 0.8000 1.0000 2.0000 0.0000 Constraint 685 844 0.8000 1.0000 2.0000 0.0000 Constraint 685 825 0.8000 1.0000 2.0000 0.0000 Constraint 685 809 0.8000 1.0000 2.0000 0.0000 Constraint 685 801 0.8000 1.0000 2.0000 0.0000 Constraint 685 793 0.8000 1.0000 2.0000 0.0000 Constraint 685 782 0.8000 1.0000 2.0000 0.0000 Constraint 685 771 0.8000 1.0000 2.0000 0.0000 Constraint 685 758 0.8000 1.0000 2.0000 0.0000 Constraint 685 752 0.8000 1.0000 2.0000 0.0000 Constraint 685 746 0.8000 1.0000 2.0000 0.0000 Constraint 685 738 0.8000 1.0000 2.0000 0.0000 Constraint 685 732 0.8000 1.0000 2.0000 0.0000 Constraint 685 725 0.8000 1.0000 2.0000 0.0000 Constraint 685 714 0.8000 1.0000 2.0000 0.0000 Constraint 685 707 0.8000 1.0000 2.0000 0.0000 Constraint 685 696 0.8000 1.0000 2.0000 0.0000 Constraint 673 1144 0.8000 1.0000 2.0000 0.0000 Constraint 673 1135 0.8000 1.0000 2.0000 0.0000 Constraint 673 1126 0.8000 1.0000 2.0000 0.0000 Constraint 673 1115 0.8000 1.0000 2.0000 0.0000 Constraint 673 1106 0.8000 1.0000 2.0000 0.0000 Constraint 673 1101 0.8000 1.0000 2.0000 0.0000 Constraint 673 1093 0.8000 1.0000 2.0000 0.0000 Constraint 673 1082 0.8000 1.0000 2.0000 0.0000 Constraint 673 1075 0.8000 1.0000 2.0000 0.0000 Constraint 673 1067 0.8000 1.0000 2.0000 0.0000 Constraint 673 1059 0.8000 1.0000 2.0000 0.0000 Constraint 673 1052 0.8000 1.0000 2.0000 0.0000 Constraint 673 1043 0.8000 1.0000 2.0000 0.0000 Constraint 673 1038 0.8000 1.0000 2.0000 0.0000 Constraint 673 1033 0.8000 1.0000 2.0000 0.0000 Constraint 673 1025 0.8000 1.0000 2.0000 0.0000 Constraint 673 1017 0.8000 1.0000 2.0000 0.0000 Constraint 673 1012 0.8000 1.0000 2.0000 0.0000 Constraint 673 1001 0.8000 1.0000 2.0000 0.0000 Constraint 673 992 0.8000 1.0000 2.0000 0.0000 Constraint 673 986 0.8000 1.0000 2.0000 0.0000 Constraint 673 977 0.8000 1.0000 2.0000 0.0000 Constraint 673 969 0.8000 1.0000 2.0000 0.0000 Constraint 673 961 0.8000 1.0000 2.0000 0.0000 Constraint 673 955 0.8000 1.0000 2.0000 0.0000 Constraint 673 950 0.8000 1.0000 2.0000 0.0000 Constraint 673 940 0.8000 1.0000 2.0000 0.0000 Constraint 673 932 0.8000 1.0000 2.0000 0.0000 Constraint 673 927 0.8000 1.0000 2.0000 0.0000 Constraint 673 916 0.8000 1.0000 2.0000 0.0000 Constraint 673 909 0.8000 1.0000 2.0000 0.0000 Constraint 673 901 0.8000 1.0000 2.0000 0.0000 Constraint 673 887 0.8000 1.0000 2.0000 0.0000 Constraint 673 878 0.8000 1.0000 2.0000 0.0000 Constraint 673 869 0.8000 1.0000 2.0000 0.0000 Constraint 673 858 0.8000 1.0000 2.0000 0.0000 Constraint 673 849 0.8000 1.0000 2.0000 0.0000 Constraint 673 844 0.8000 1.0000 2.0000 0.0000 Constraint 673 833 0.8000 1.0000 2.0000 0.0000 Constraint 673 825 0.8000 1.0000 2.0000 0.0000 Constraint 673 809 0.8000 1.0000 2.0000 0.0000 Constraint 673 801 0.8000 1.0000 2.0000 0.0000 Constraint 673 793 0.8000 1.0000 2.0000 0.0000 Constraint 673 782 0.8000 1.0000 2.0000 0.0000 Constraint 673 771 0.8000 1.0000 2.0000 0.0000 Constraint 673 758 0.8000 1.0000 2.0000 0.0000 Constraint 673 752 0.8000 1.0000 2.0000 0.0000 Constraint 673 746 0.8000 1.0000 2.0000 0.0000 Constraint 673 738 0.8000 1.0000 2.0000 0.0000 Constraint 673 732 0.8000 1.0000 2.0000 0.0000 Constraint 673 725 0.8000 1.0000 2.0000 0.0000 Constraint 673 714 0.8000 1.0000 2.0000 0.0000 Constraint 673 707 0.8000 1.0000 2.0000 0.0000 Constraint 673 696 0.8000 1.0000 2.0000 0.0000 Constraint 673 685 0.8000 1.0000 2.0000 0.0000 Constraint 664 1144 0.8000 1.0000 2.0000 0.0000 Constraint 664 1135 0.8000 1.0000 2.0000 0.0000 Constraint 664 1126 0.8000 1.0000 2.0000 0.0000 Constraint 664 1115 0.8000 1.0000 2.0000 0.0000 Constraint 664 1106 0.8000 1.0000 2.0000 0.0000 Constraint 664 1101 0.8000 1.0000 2.0000 0.0000 Constraint 664 1093 0.8000 1.0000 2.0000 0.0000 Constraint 664 1082 0.8000 1.0000 2.0000 0.0000 Constraint 664 1075 0.8000 1.0000 2.0000 0.0000 Constraint 664 1067 0.8000 1.0000 2.0000 0.0000 Constraint 664 1059 0.8000 1.0000 2.0000 0.0000 Constraint 664 1052 0.8000 1.0000 2.0000 0.0000 Constraint 664 1043 0.8000 1.0000 2.0000 0.0000 Constraint 664 1038 0.8000 1.0000 2.0000 0.0000 Constraint 664 1033 0.8000 1.0000 2.0000 0.0000 Constraint 664 1025 0.8000 1.0000 2.0000 0.0000 Constraint 664 1017 0.8000 1.0000 2.0000 0.0000 Constraint 664 1012 0.8000 1.0000 2.0000 0.0000 Constraint 664 1001 0.8000 1.0000 2.0000 0.0000 Constraint 664 992 0.8000 1.0000 2.0000 0.0000 Constraint 664 986 0.8000 1.0000 2.0000 0.0000 Constraint 664 977 0.8000 1.0000 2.0000 0.0000 Constraint 664 969 0.8000 1.0000 2.0000 0.0000 Constraint 664 961 0.8000 1.0000 2.0000 0.0000 Constraint 664 955 0.8000 1.0000 2.0000 0.0000 Constraint 664 950 0.8000 1.0000 2.0000 0.0000 Constraint 664 940 0.8000 1.0000 2.0000 0.0000 Constraint 664 932 0.8000 1.0000 2.0000 0.0000 Constraint 664 927 0.8000 1.0000 2.0000 0.0000 Constraint 664 916 0.8000 1.0000 2.0000 0.0000 Constraint 664 909 0.8000 1.0000 2.0000 0.0000 Constraint 664 901 0.8000 1.0000 2.0000 0.0000 Constraint 664 887 0.8000 1.0000 2.0000 0.0000 Constraint 664 878 0.8000 1.0000 2.0000 0.0000 Constraint 664 869 0.8000 1.0000 2.0000 0.0000 Constraint 664 858 0.8000 1.0000 2.0000 0.0000 Constraint 664 849 0.8000 1.0000 2.0000 0.0000 Constraint 664 844 0.8000 1.0000 2.0000 0.0000 Constraint 664 833 0.8000 1.0000 2.0000 0.0000 Constraint 664 825 0.8000 1.0000 2.0000 0.0000 Constraint 664 809 0.8000 1.0000 2.0000 0.0000 Constraint 664 801 0.8000 1.0000 2.0000 0.0000 Constraint 664 793 0.8000 1.0000 2.0000 0.0000 Constraint 664 782 0.8000 1.0000 2.0000 0.0000 Constraint 664 771 0.8000 1.0000 2.0000 0.0000 Constraint 664 758 0.8000 1.0000 2.0000 0.0000 Constraint 664 752 0.8000 1.0000 2.0000 0.0000 Constraint 664 746 0.8000 1.0000 2.0000 0.0000 Constraint 664 738 0.8000 1.0000 2.0000 0.0000 Constraint 664 732 0.8000 1.0000 2.0000 0.0000 Constraint 664 725 0.8000 1.0000 2.0000 0.0000 Constraint 664 714 0.8000 1.0000 2.0000 0.0000 Constraint 664 707 0.8000 1.0000 2.0000 0.0000 Constraint 664 696 0.8000 1.0000 2.0000 0.0000 Constraint 664 685 0.8000 1.0000 2.0000 0.0000 Constraint 664 673 0.8000 1.0000 2.0000 0.0000 Constraint 657 1144 0.8000 1.0000 2.0000 0.0000 Constraint 657 1135 0.8000 1.0000 2.0000 0.0000 Constraint 657 1126 0.8000 1.0000 2.0000 0.0000 Constraint 657 1115 0.8000 1.0000 2.0000 0.0000 Constraint 657 1106 0.8000 1.0000 2.0000 0.0000 Constraint 657 1101 0.8000 1.0000 2.0000 0.0000 Constraint 657 1093 0.8000 1.0000 2.0000 0.0000 Constraint 657 1082 0.8000 1.0000 2.0000 0.0000 Constraint 657 1075 0.8000 1.0000 2.0000 0.0000 Constraint 657 1067 0.8000 1.0000 2.0000 0.0000 Constraint 657 1059 0.8000 1.0000 2.0000 0.0000 Constraint 657 1052 0.8000 1.0000 2.0000 0.0000 Constraint 657 1043 0.8000 1.0000 2.0000 0.0000 Constraint 657 1038 0.8000 1.0000 2.0000 0.0000 Constraint 657 1033 0.8000 1.0000 2.0000 0.0000 Constraint 657 1025 0.8000 1.0000 2.0000 0.0000 Constraint 657 1017 0.8000 1.0000 2.0000 0.0000 Constraint 657 1012 0.8000 1.0000 2.0000 0.0000 Constraint 657 1001 0.8000 1.0000 2.0000 0.0000 Constraint 657 992 0.8000 1.0000 2.0000 0.0000 Constraint 657 986 0.8000 1.0000 2.0000 0.0000 Constraint 657 977 0.8000 1.0000 2.0000 0.0000 Constraint 657 969 0.8000 1.0000 2.0000 0.0000 Constraint 657 961 0.8000 1.0000 2.0000 0.0000 Constraint 657 955 0.8000 1.0000 2.0000 0.0000 Constraint 657 950 0.8000 1.0000 2.0000 0.0000 Constraint 657 940 0.8000 1.0000 2.0000 0.0000 Constraint 657 932 0.8000 1.0000 2.0000 0.0000 Constraint 657 927 0.8000 1.0000 2.0000 0.0000 Constraint 657 916 0.8000 1.0000 2.0000 0.0000 Constraint 657 909 0.8000 1.0000 2.0000 0.0000 Constraint 657 901 0.8000 1.0000 2.0000 0.0000 Constraint 657 887 0.8000 1.0000 2.0000 0.0000 Constraint 657 878 0.8000 1.0000 2.0000 0.0000 Constraint 657 869 0.8000 1.0000 2.0000 0.0000 Constraint 657 858 0.8000 1.0000 2.0000 0.0000 Constraint 657 849 0.8000 1.0000 2.0000 0.0000 Constraint 657 844 0.8000 1.0000 2.0000 0.0000 Constraint 657 833 0.8000 1.0000 2.0000 0.0000 Constraint 657 825 0.8000 1.0000 2.0000 0.0000 Constraint 657 809 0.8000 1.0000 2.0000 0.0000 Constraint 657 801 0.8000 1.0000 2.0000 0.0000 Constraint 657 793 0.8000 1.0000 2.0000 0.0000 Constraint 657 782 0.8000 1.0000 2.0000 0.0000 Constraint 657 771 0.8000 1.0000 2.0000 0.0000 Constraint 657 758 0.8000 1.0000 2.0000 0.0000 Constraint 657 752 0.8000 1.0000 2.0000 0.0000 Constraint 657 746 0.8000 1.0000 2.0000 0.0000 Constraint 657 738 0.8000 1.0000 2.0000 0.0000 Constraint 657 725 0.8000 1.0000 2.0000 0.0000 Constraint 657 714 0.8000 1.0000 2.0000 0.0000 Constraint 657 707 0.8000 1.0000 2.0000 0.0000 Constraint 657 696 0.8000 1.0000 2.0000 0.0000 Constraint 657 685 0.8000 1.0000 2.0000 0.0000 Constraint 657 673 0.8000 1.0000 2.0000 0.0000 Constraint 657 664 0.8000 1.0000 2.0000 0.0000 Constraint 649 1144 0.8000 1.0000 2.0000 0.0000 Constraint 649 1135 0.8000 1.0000 2.0000 0.0000 Constraint 649 1126 0.8000 1.0000 2.0000 0.0000 Constraint 649 1115 0.8000 1.0000 2.0000 0.0000 Constraint 649 1106 0.8000 1.0000 2.0000 0.0000 Constraint 649 1101 0.8000 1.0000 2.0000 0.0000 Constraint 649 1093 0.8000 1.0000 2.0000 0.0000 Constraint 649 1082 0.8000 1.0000 2.0000 0.0000 Constraint 649 1075 0.8000 1.0000 2.0000 0.0000 Constraint 649 1067 0.8000 1.0000 2.0000 0.0000 Constraint 649 1059 0.8000 1.0000 2.0000 0.0000 Constraint 649 1052 0.8000 1.0000 2.0000 0.0000 Constraint 649 1043 0.8000 1.0000 2.0000 0.0000 Constraint 649 1038 0.8000 1.0000 2.0000 0.0000 Constraint 649 1033 0.8000 1.0000 2.0000 0.0000 Constraint 649 1025 0.8000 1.0000 2.0000 0.0000 Constraint 649 1017 0.8000 1.0000 2.0000 0.0000 Constraint 649 1012 0.8000 1.0000 2.0000 0.0000 Constraint 649 1001 0.8000 1.0000 2.0000 0.0000 Constraint 649 992 0.8000 1.0000 2.0000 0.0000 Constraint 649 986 0.8000 1.0000 2.0000 0.0000 Constraint 649 977 0.8000 1.0000 2.0000 0.0000 Constraint 649 969 0.8000 1.0000 2.0000 0.0000 Constraint 649 961 0.8000 1.0000 2.0000 0.0000 Constraint 649 955 0.8000 1.0000 2.0000 0.0000 Constraint 649 950 0.8000 1.0000 2.0000 0.0000 Constraint 649 940 0.8000 1.0000 2.0000 0.0000 Constraint 649 932 0.8000 1.0000 2.0000 0.0000 Constraint 649 927 0.8000 1.0000 2.0000 0.0000 Constraint 649 916 0.8000 1.0000 2.0000 0.0000 Constraint 649 909 0.8000 1.0000 2.0000 0.0000 Constraint 649 901 0.8000 1.0000 2.0000 0.0000 Constraint 649 887 0.8000 1.0000 2.0000 0.0000 Constraint 649 878 0.8000 1.0000 2.0000 0.0000 Constraint 649 869 0.8000 1.0000 2.0000 0.0000 Constraint 649 858 0.8000 1.0000 2.0000 0.0000 Constraint 649 849 0.8000 1.0000 2.0000 0.0000 Constraint 649 844 0.8000 1.0000 2.0000 0.0000 Constraint 649 833 0.8000 1.0000 2.0000 0.0000 Constraint 649 825 0.8000 1.0000 2.0000 0.0000 Constraint 649 809 0.8000 1.0000 2.0000 0.0000 Constraint 649 793 0.8000 1.0000 2.0000 0.0000 Constraint 649 758 0.8000 1.0000 2.0000 0.0000 Constraint 649 752 0.8000 1.0000 2.0000 0.0000 Constraint 649 746 0.8000 1.0000 2.0000 0.0000 Constraint 649 738 0.8000 1.0000 2.0000 0.0000 Constraint 649 714 0.8000 1.0000 2.0000 0.0000 Constraint 649 707 0.8000 1.0000 2.0000 0.0000 Constraint 649 696 0.8000 1.0000 2.0000 0.0000 Constraint 649 685 0.8000 1.0000 2.0000 0.0000 Constraint 649 673 0.8000 1.0000 2.0000 0.0000 Constraint 649 664 0.8000 1.0000 2.0000 0.0000 Constraint 649 657 0.8000 1.0000 2.0000 0.0000 Constraint 644 1144 0.8000 1.0000 2.0000 0.0000 Constraint 644 1135 0.8000 1.0000 2.0000 0.0000 Constraint 644 1126 0.8000 1.0000 2.0000 0.0000 Constraint 644 1115 0.8000 1.0000 2.0000 0.0000 Constraint 644 1106 0.8000 1.0000 2.0000 0.0000 Constraint 644 1101 0.8000 1.0000 2.0000 0.0000 Constraint 644 1093 0.8000 1.0000 2.0000 0.0000 Constraint 644 1082 0.8000 1.0000 2.0000 0.0000 Constraint 644 1075 0.8000 1.0000 2.0000 0.0000 Constraint 644 1067 0.8000 1.0000 2.0000 0.0000 Constraint 644 1059 0.8000 1.0000 2.0000 0.0000 Constraint 644 1052 0.8000 1.0000 2.0000 0.0000 Constraint 644 1043 0.8000 1.0000 2.0000 0.0000 Constraint 644 1038 0.8000 1.0000 2.0000 0.0000 Constraint 644 1033 0.8000 1.0000 2.0000 0.0000 Constraint 644 1025 0.8000 1.0000 2.0000 0.0000 Constraint 644 1017 0.8000 1.0000 2.0000 0.0000 Constraint 644 1012 0.8000 1.0000 2.0000 0.0000 Constraint 644 1001 0.8000 1.0000 2.0000 0.0000 Constraint 644 992 0.8000 1.0000 2.0000 0.0000 Constraint 644 986 0.8000 1.0000 2.0000 0.0000 Constraint 644 977 0.8000 1.0000 2.0000 0.0000 Constraint 644 969 0.8000 1.0000 2.0000 0.0000 Constraint 644 961 0.8000 1.0000 2.0000 0.0000 Constraint 644 955 0.8000 1.0000 2.0000 0.0000 Constraint 644 950 0.8000 1.0000 2.0000 0.0000 Constraint 644 940 0.8000 1.0000 2.0000 0.0000 Constraint 644 932 0.8000 1.0000 2.0000 0.0000 Constraint 644 927 0.8000 1.0000 2.0000 0.0000 Constraint 644 916 0.8000 1.0000 2.0000 0.0000 Constraint 644 909 0.8000 1.0000 2.0000 0.0000 Constraint 644 901 0.8000 1.0000 2.0000 0.0000 Constraint 644 887 0.8000 1.0000 2.0000 0.0000 Constraint 644 878 0.8000 1.0000 2.0000 0.0000 Constraint 644 869 0.8000 1.0000 2.0000 0.0000 Constraint 644 858 0.8000 1.0000 2.0000 0.0000 Constraint 644 849 0.8000 1.0000 2.0000 0.0000 Constraint 644 844 0.8000 1.0000 2.0000 0.0000 Constraint 644 833 0.8000 1.0000 2.0000 0.0000 Constraint 644 809 0.8000 1.0000 2.0000 0.0000 Constraint 644 738 0.8000 1.0000 2.0000 0.0000 Constraint 644 707 0.8000 1.0000 2.0000 0.0000 Constraint 644 696 0.8000 1.0000 2.0000 0.0000 Constraint 644 685 0.8000 1.0000 2.0000 0.0000 Constraint 644 673 0.8000 1.0000 2.0000 0.0000 Constraint 644 664 0.8000 1.0000 2.0000 0.0000 Constraint 644 657 0.8000 1.0000 2.0000 0.0000 Constraint 644 649 0.8000 1.0000 2.0000 0.0000 Constraint 634 1144 0.8000 1.0000 2.0000 0.0000 Constraint 634 1135 0.8000 1.0000 2.0000 0.0000 Constraint 634 1126 0.8000 1.0000 2.0000 0.0000 Constraint 634 1115 0.8000 1.0000 2.0000 0.0000 Constraint 634 1106 0.8000 1.0000 2.0000 0.0000 Constraint 634 1101 0.8000 1.0000 2.0000 0.0000 Constraint 634 1093 0.8000 1.0000 2.0000 0.0000 Constraint 634 1082 0.8000 1.0000 2.0000 0.0000 Constraint 634 1075 0.8000 1.0000 2.0000 0.0000 Constraint 634 1067 0.8000 1.0000 2.0000 0.0000 Constraint 634 1059 0.8000 1.0000 2.0000 0.0000 Constraint 634 1052 0.8000 1.0000 2.0000 0.0000 Constraint 634 1043 0.8000 1.0000 2.0000 0.0000 Constraint 634 1038 0.8000 1.0000 2.0000 0.0000 Constraint 634 1033 0.8000 1.0000 2.0000 0.0000 Constraint 634 1025 0.8000 1.0000 2.0000 0.0000 Constraint 634 1017 0.8000 1.0000 2.0000 0.0000 Constraint 634 1012 0.8000 1.0000 2.0000 0.0000 Constraint 634 1001 0.8000 1.0000 2.0000 0.0000 Constraint 634 992 0.8000 1.0000 2.0000 0.0000 Constraint 634 986 0.8000 1.0000 2.0000 0.0000 Constraint 634 977 0.8000 1.0000 2.0000 0.0000 Constraint 634 969 0.8000 1.0000 2.0000 0.0000 Constraint 634 961 0.8000 1.0000 2.0000 0.0000 Constraint 634 955 0.8000 1.0000 2.0000 0.0000 Constraint 634 950 0.8000 1.0000 2.0000 0.0000 Constraint 634 940 0.8000 1.0000 2.0000 0.0000 Constraint 634 932 0.8000 1.0000 2.0000 0.0000 Constraint 634 927 0.8000 1.0000 2.0000 0.0000 Constraint 634 916 0.8000 1.0000 2.0000 0.0000 Constraint 634 909 0.8000 1.0000 2.0000 0.0000 Constraint 634 901 0.8000 1.0000 2.0000 0.0000 Constraint 634 887 0.8000 1.0000 2.0000 0.0000 Constraint 634 878 0.8000 1.0000 2.0000 0.0000 Constraint 634 869 0.8000 1.0000 2.0000 0.0000 Constraint 634 858 0.8000 1.0000 2.0000 0.0000 Constraint 634 849 0.8000 1.0000 2.0000 0.0000 Constraint 634 809 0.8000 1.0000 2.0000 0.0000 Constraint 634 782 0.8000 1.0000 2.0000 0.0000 Constraint 634 771 0.8000 1.0000 2.0000 0.0000 Constraint 634 752 0.8000 1.0000 2.0000 0.0000 Constraint 634 696 0.8000 1.0000 2.0000 0.0000 Constraint 634 685 0.8000 1.0000 2.0000 0.0000 Constraint 634 673 0.8000 1.0000 2.0000 0.0000 Constraint 634 664 0.8000 1.0000 2.0000 0.0000 Constraint 634 657 0.8000 1.0000 2.0000 0.0000 Constraint 634 649 0.8000 1.0000 2.0000 0.0000 Constraint 634 644 0.8000 1.0000 2.0000 0.0000 Constraint 623 1144 0.8000 1.0000 2.0000 0.0000 Constraint 623 1135 0.8000 1.0000 2.0000 0.0000 Constraint 623 1126 0.8000 1.0000 2.0000 0.0000 Constraint 623 1115 0.8000 1.0000 2.0000 0.0000 Constraint 623 1106 0.8000 1.0000 2.0000 0.0000 Constraint 623 1101 0.8000 1.0000 2.0000 0.0000 Constraint 623 1093 0.8000 1.0000 2.0000 0.0000 Constraint 623 1082 0.8000 1.0000 2.0000 0.0000 Constraint 623 1075 0.8000 1.0000 2.0000 0.0000 Constraint 623 1067 0.8000 1.0000 2.0000 0.0000 Constraint 623 1059 0.8000 1.0000 2.0000 0.0000 Constraint 623 1052 0.8000 1.0000 2.0000 0.0000 Constraint 623 1043 0.8000 1.0000 2.0000 0.0000 Constraint 623 1038 0.8000 1.0000 2.0000 0.0000 Constraint 623 1033 0.8000 1.0000 2.0000 0.0000 Constraint 623 1025 0.8000 1.0000 2.0000 0.0000 Constraint 623 1017 0.8000 1.0000 2.0000 0.0000 Constraint 623 1012 0.8000 1.0000 2.0000 0.0000 Constraint 623 1001 0.8000 1.0000 2.0000 0.0000 Constraint 623 992 0.8000 1.0000 2.0000 0.0000 Constraint 623 986 0.8000 1.0000 2.0000 0.0000 Constraint 623 977 0.8000 1.0000 2.0000 0.0000 Constraint 623 969 0.8000 1.0000 2.0000 0.0000 Constraint 623 961 0.8000 1.0000 2.0000 0.0000 Constraint 623 955 0.8000 1.0000 2.0000 0.0000 Constraint 623 950 0.8000 1.0000 2.0000 0.0000 Constraint 623 940 0.8000 1.0000 2.0000 0.0000 Constraint 623 932 0.8000 1.0000 2.0000 0.0000 Constraint 623 927 0.8000 1.0000 2.0000 0.0000 Constraint 623 916 0.8000 1.0000 2.0000 0.0000 Constraint 623 909 0.8000 1.0000 2.0000 0.0000 Constraint 623 901 0.8000 1.0000 2.0000 0.0000 Constraint 623 887 0.8000 1.0000 2.0000 0.0000 Constraint 623 878 0.8000 1.0000 2.0000 0.0000 Constraint 623 869 0.8000 1.0000 2.0000 0.0000 Constraint 623 858 0.8000 1.0000 2.0000 0.0000 Constraint 623 849 0.8000 1.0000 2.0000 0.0000 Constraint 623 844 0.8000 1.0000 2.0000 0.0000 Constraint 623 782 0.8000 1.0000 2.0000 0.0000 Constraint 623 771 0.8000 1.0000 2.0000 0.0000 Constraint 623 758 0.8000 1.0000 2.0000 0.0000 Constraint 623 752 0.8000 1.0000 2.0000 0.0000 Constraint 623 685 0.8000 1.0000 2.0000 0.0000 Constraint 623 673 0.8000 1.0000 2.0000 0.0000 Constraint 623 664 0.8000 1.0000 2.0000 0.0000 Constraint 623 657 0.8000 1.0000 2.0000 0.0000 Constraint 623 649 0.8000 1.0000 2.0000 0.0000 Constraint 623 644 0.8000 1.0000 2.0000 0.0000 Constraint 623 634 0.8000 1.0000 2.0000 0.0000 Constraint 616 1144 0.8000 1.0000 2.0000 0.0000 Constraint 616 1135 0.8000 1.0000 2.0000 0.0000 Constraint 616 1126 0.8000 1.0000 2.0000 0.0000 Constraint 616 1115 0.8000 1.0000 2.0000 0.0000 Constraint 616 1106 0.8000 1.0000 2.0000 0.0000 Constraint 616 1101 0.8000 1.0000 2.0000 0.0000 Constraint 616 1093 0.8000 1.0000 2.0000 0.0000 Constraint 616 1082 0.8000 1.0000 2.0000 0.0000 Constraint 616 1075 0.8000 1.0000 2.0000 0.0000 Constraint 616 1067 0.8000 1.0000 2.0000 0.0000 Constraint 616 1059 0.8000 1.0000 2.0000 0.0000 Constraint 616 1052 0.8000 1.0000 2.0000 0.0000 Constraint 616 1043 0.8000 1.0000 2.0000 0.0000 Constraint 616 1038 0.8000 1.0000 2.0000 0.0000 Constraint 616 1033 0.8000 1.0000 2.0000 0.0000 Constraint 616 1025 0.8000 1.0000 2.0000 0.0000 Constraint 616 1017 0.8000 1.0000 2.0000 0.0000 Constraint 616 1012 0.8000 1.0000 2.0000 0.0000 Constraint 616 1001 0.8000 1.0000 2.0000 0.0000 Constraint 616 992 0.8000 1.0000 2.0000 0.0000 Constraint 616 986 0.8000 1.0000 2.0000 0.0000 Constraint 616 977 0.8000 1.0000 2.0000 0.0000 Constraint 616 969 0.8000 1.0000 2.0000 0.0000 Constraint 616 961 0.8000 1.0000 2.0000 0.0000 Constraint 616 955 0.8000 1.0000 2.0000 0.0000 Constraint 616 950 0.8000 1.0000 2.0000 0.0000 Constraint 616 940 0.8000 1.0000 2.0000 0.0000 Constraint 616 932 0.8000 1.0000 2.0000 0.0000 Constraint 616 927 0.8000 1.0000 2.0000 0.0000 Constraint 616 916 0.8000 1.0000 2.0000 0.0000 Constraint 616 909 0.8000 1.0000 2.0000 0.0000 Constraint 616 901 0.8000 1.0000 2.0000 0.0000 Constraint 616 887 0.8000 1.0000 2.0000 0.0000 Constraint 616 878 0.8000 1.0000 2.0000 0.0000 Constraint 616 869 0.8000 1.0000 2.0000 0.0000 Constraint 616 849 0.8000 1.0000 2.0000 0.0000 Constraint 616 801 0.8000 1.0000 2.0000 0.0000 Constraint 616 793 0.8000 1.0000 2.0000 0.0000 Constraint 616 782 0.8000 1.0000 2.0000 0.0000 Constraint 616 673 0.8000 1.0000 2.0000 0.0000 Constraint 616 664 0.8000 1.0000 2.0000 0.0000 Constraint 616 657 0.8000 1.0000 2.0000 0.0000 Constraint 616 649 0.8000 1.0000 2.0000 0.0000 Constraint 616 644 0.8000 1.0000 2.0000 0.0000 Constraint 616 634 0.8000 1.0000 2.0000 0.0000 Constraint 616 623 0.8000 1.0000 2.0000 0.0000 Constraint 608 1144 0.8000 1.0000 2.0000 0.0000 Constraint 608 1135 0.8000 1.0000 2.0000 0.0000 Constraint 608 1126 0.8000 1.0000 2.0000 0.0000 Constraint 608 1115 0.8000 1.0000 2.0000 0.0000 Constraint 608 1106 0.8000 1.0000 2.0000 0.0000 Constraint 608 1101 0.8000 1.0000 2.0000 0.0000 Constraint 608 1093 0.8000 1.0000 2.0000 0.0000 Constraint 608 1082 0.8000 1.0000 2.0000 0.0000 Constraint 608 1075 0.8000 1.0000 2.0000 0.0000 Constraint 608 1067 0.8000 1.0000 2.0000 0.0000 Constraint 608 1059 0.8000 1.0000 2.0000 0.0000 Constraint 608 1052 0.8000 1.0000 2.0000 0.0000 Constraint 608 1043 0.8000 1.0000 2.0000 0.0000 Constraint 608 1038 0.8000 1.0000 2.0000 0.0000 Constraint 608 1033 0.8000 1.0000 2.0000 0.0000 Constraint 608 1025 0.8000 1.0000 2.0000 0.0000 Constraint 608 1017 0.8000 1.0000 2.0000 0.0000 Constraint 608 1012 0.8000 1.0000 2.0000 0.0000 Constraint 608 1001 0.8000 1.0000 2.0000 0.0000 Constraint 608 992 0.8000 1.0000 2.0000 0.0000 Constraint 608 986 0.8000 1.0000 2.0000 0.0000 Constraint 608 977 0.8000 1.0000 2.0000 0.0000 Constraint 608 969 0.8000 1.0000 2.0000 0.0000 Constraint 608 961 0.8000 1.0000 2.0000 0.0000 Constraint 608 955 0.8000 1.0000 2.0000 0.0000 Constraint 608 950 0.8000 1.0000 2.0000 0.0000 Constraint 608 940 0.8000 1.0000 2.0000 0.0000 Constraint 608 932 0.8000 1.0000 2.0000 0.0000 Constraint 608 927 0.8000 1.0000 2.0000 0.0000 Constraint 608 916 0.8000 1.0000 2.0000 0.0000 Constraint 608 909 0.8000 1.0000 2.0000 0.0000 Constraint 608 901 0.8000 1.0000 2.0000 0.0000 Constraint 608 887 0.8000 1.0000 2.0000 0.0000 Constraint 608 878 0.8000 1.0000 2.0000 0.0000 Constraint 608 869 0.8000 1.0000 2.0000 0.0000 Constraint 608 793 0.8000 1.0000 2.0000 0.0000 Constraint 608 782 0.8000 1.0000 2.0000 0.0000 Constraint 608 771 0.8000 1.0000 2.0000 0.0000 Constraint 608 673 0.8000 1.0000 2.0000 0.0000 Constraint 608 664 0.8000 1.0000 2.0000 0.0000 Constraint 608 657 0.8000 1.0000 2.0000 0.0000 Constraint 608 649 0.8000 1.0000 2.0000 0.0000 Constraint 608 644 0.8000 1.0000 2.0000 0.0000 Constraint 608 634 0.8000 1.0000 2.0000 0.0000 Constraint 608 623 0.8000 1.0000 2.0000 0.0000 Constraint 608 616 0.8000 1.0000 2.0000 0.0000 Constraint 600 1144 0.8000 1.0000 2.0000 0.0000 Constraint 600 1135 0.8000 1.0000 2.0000 0.0000 Constraint 600 1126 0.8000 1.0000 2.0000 0.0000 Constraint 600 1115 0.8000 1.0000 2.0000 0.0000 Constraint 600 1106 0.8000 1.0000 2.0000 0.0000 Constraint 600 1101 0.8000 1.0000 2.0000 0.0000 Constraint 600 1093 0.8000 1.0000 2.0000 0.0000 Constraint 600 1082 0.8000 1.0000 2.0000 0.0000 Constraint 600 1075 0.8000 1.0000 2.0000 0.0000 Constraint 600 1067 0.8000 1.0000 2.0000 0.0000 Constraint 600 1059 0.8000 1.0000 2.0000 0.0000 Constraint 600 1052 0.8000 1.0000 2.0000 0.0000 Constraint 600 1043 0.8000 1.0000 2.0000 0.0000 Constraint 600 1038 0.8000 1.0000 2.0000 0.0000 Constraint 600 1033 0.8000 1.0000 2.0000 0.0000 Constraint 600 1025 0.8000 1.0000 2.0000 0.0000 Constraint 600 1017 0.8000 1.0000 2.0000 0.0000 Constraint 600 1012 0.8000 1.0000 2.0000 0.0000 Constraint 600 1001 0.8000 1.0000 2.0000 0.0000 Constraint 600 992 0.8000 1.0000 2.0000 0.0000 Constraint 600 986 0.8000 1.0000 2.0000 0.0000 Constraint 600 977 0.8000 1.0000 2.0000 0.0000 Constraint 600 969 0.8000 1.0000 2.0000 0.0000 Constraint 600 961 0.8000 1.0000 2.0000 0.0000 Constraint 600 955 0.8000 1.0000 2.0000 0.0000 Constraint 600 950 0.8000 1.0000 2.0000 0.0000 Constraint 600 940 0.8000 1.0000 2.0000 0.0000 Constraint 600 932 0.8000 1.0000 2.0000 0.0000 Constraint 600 927 0.8000 1.0000 2.0000 0.0000 Constraint 600 916 0.8000 1.0000 2.0000 0.0000 Constraint 600 909 0.8000 1.0000 2.0000 0.0000 Constraint 600 887 0.8000 1.0000 2.0000 0.0000 Constraint 600 878 0.8000 1.0000 2.0000 0.0000 Constraint 600 869 0.8000 1.0000 2.0000 0.0000 Constraint 600 696 0.8000 1.0000 2.0000 0.0000 Constraint 600 673 0.8000 1.0000 2.0000 0.0000 Constraint 600 664 0.8000 1.0000 2.0000 0.0000 Constraint 600 657 0.8000 1.0000 2.0000 0.0000 Constraint 600 649 0.8000 1.0000 2.0000 0.0000 Constraint 600 644 0.8000 1.0000 2.0000 0.0000 Constraint 600 634 0.8000 1.0000 2.0000 0.0000 Constraint 600 623 0.8000 1.0000 2.0000 0.0000 Constraint 600 616 0.8000 1.0000 2.0000 0.0000 Constraint 600 608 0.8000 1.0000 2.0000 0.0000 Constraint 581 1144 0.8000 1.0000 2.0000 0.0000 Constraint 581 1135 0.8000 1.0000 2.0000 0.0000 Constraint 581 1126 0.8000 1.0000 2.0000 0.0000 Constraint 581 1115 0.8000 1.0000 2.0000 0.0000 Constraint 581 1106 0.8000 1.0000 2.0000 0.0000 Constraint 581 1101 0.8000 1.0000 2.0000 0.0000 Constraint 581 1093 0.8000 1.0000 2.0000 0.0000 Constraint 581 1082 0.8000 1.0000 2.0000 0.0000 Constraint 581 1075 0.8000 1.0000 2.0000 0.0000 Constraint 581 1067 0.8000 1.0000 2.0000 0.0000 Constraint 581 1059 0.8000 1.0000 2.0000 0.0000 Constraint 581 1052 0.8000 1.0000 2.0000 0.0000 Constraint 581 1043 0.8000 1.0000 2.0000 0.0000 Constraint 581 1038 0.8000 1.0000 2.0000 0.0000 Constraint 581 1033 0.8000 1.0000 2.0000 0.0000 Constraint 581 1025 0.8000 1.0000 2.0000 0.0000 Constraint 581 1017 0.8000 1.0000 2.0000 0.0000 Constraint 581 1012 0.8000 1.0000 2.0000 0.0000 Constraint 581 1001 0.8000 1.0000 2.0000 0.0000 Constraint 581 992 0.8000 1.0000 2.0000 0.0000 Constraint 581 986 0.8000 1.0000 2.0000 0.0000 Constraint 581 977 0.8000 1.0000 2.0000 0.0000 Constraint 581 969 0.8000 1.0000 2.0000 0.0000 Constraint 581 961 0.8000 1.0000 2.0000 0.0000 Constraint 581 955 0.8000 1.0000 2.0000 0.0000 Constraint 581 950 0.8000 1.0000 2.0000 0.0000 Constraint 581 940 0.8000 1.0000 2.0000 0.0000 Constraint 581 932 0.8000 1.0000 2.0000 0.0000 Constraint 581 927 0.8000 1.0000 2.0000 0.0000 Constraint 581 916 0.8000 1.0000 2.0000 0.0000 Constraint 581 909 0.8000 1.0000 2.0000 0.0000 Constraint 581 901 0.8000 1.0000 2.0000 0.0000 Constraint 581 887 0.8000 1.0000 2.0000 0.0000 Constraint 581 878 0.8000 1.0000 2.0000 0.0000 Constraint 581 869 0.8000 1.0000 2.0000 0.0000 Constraint 581 858 0.8000 1.0000 2.0000 0.0000 Constraint 581 849 0.8000 1.0000 2.0000 0.0000 Constraint 581 844 0.8000 1.0000 2.0000 0.0000 Constraint 581 833 0.8000 1.0000 2.0000 0.0000 Constraint 581 825 0.8000 1.0000 2.0000 0.0000 Constraint 581 809 0.8000 1.0000 2.0000 0.0000 Constraint 581 801 0.8000 1.0000 2.0000 0.0000 Constraint 581 793 0.8000 1.0000 2.0000 0.0000 Constraint 581 782 0.8000 1.0000 2.0000 0.0000 Constraint 581 771 0.8000 1.0000 2.0000 0.0000 Constraint 581 758 0.8000 1.0000 2.0000 0.0000 Constraint 581 752 0.8000 1.0000 2.0000 0.0000 Constraint 581 746 0.8000 1.0000 2.0000 0.0000 Constraint 581 738 0.8000 1.0000 2.0000 0.0000 Constraint 581 732 0.8000 1.0000 2.0000 0.0000 Constraint 581 725 0.8000 1.0000 2.0000 0.0000 Constraint 581 714 0.8000 1.0000 2.0000 0.0000 Constraint 581 707 0.8000 1.0000 2.0000 0.0000 Constraint 581 696 0.8000 1.0000 2.0000 0.0000 Constraint 581 685 0.8000 1.0000 2.0000 0.0000 Constraint 581 673 0.8000 1.0000 2.0000 0.0000 Constraint 581 664 0.8000 1.0000 2.0000 0.0000 Constraint 581 657 0.8000 1.0000 2.0000 0.0000 Constraint 581 649 0.8000 1.0000 2.0000 0.0000 Constraint 581 644 0.8000 1.0000 2.0000 0.0000 Constraint 581 634 0.8000 1.0000 2.0000 0.0000 Constraint 581 623 0.8000 1.0000 2.0000 0.0000 Constraint 581 616 0.8000 1.0000 2.0000 0.0000 Constraint 581 608 0.8000 1.0000 2.0000 0.0000 Constraint 581 600 0.8000 1.0000 2.0000 0.0000 Constraint 572 1144 0.8000 1.0000 2.0000 0.0000 Constraint 572 1135 0.8000 1.0000 2.0000 0.0000 Constraint 572 1126 0.8000 1.0000 2.0000 0.0000 Constraint 572 1115 0.8000 1.0000 2.0000 0.0000 Constraint 572 1106 0.8000 1.0000 2.0000 0.0000 Constraint 572 1101 0.8000 1.0000 2.0000 0.0000 Constraint 572 1093 0.8000 1.0000 2.0000 0.0000 Constraint 572 1082 0.8000 1.0000 2.0000 0.0000 Constraint 572 1075 0.8000 1.0000 2.0000 0.0000 Constraint 572 1067 0.8000 1.0000 2.0000 0.0000 Constraint 572 1059 0.8000 1.0000 2.0000 0.0000 Constraint 572 1052 0.8000 1.0000 2.0000 0.0000 Constraint 572 1043 0.8000 1.0000 2.0000 0.0000 Constraint 572 1038 0.8000 1.0000 2.0000 0.0000 Constraint 572 1033 0.8000 1.0000 2.0000 0.0000 Constraint 572 1025 0.8000 1.0000 2.0000 0.0000 Constraint 572 1017 0.8000 1.0000 2.0000 0.0000 Constraint 572 1012 0.8000 1.0000 2.0000 0.0000 Constraint 572 1001 0.8000 1.0000 2.0000 0.0000 Constraint 572 992 0.8000 1.0000 2.0000 0.0000 Constraint 572 986 0.8000 1.0000 2.0000 0.0000 Constraint 572 977 0.8000 1.0000 2.0000 0.0000 Constraint 572 969 0.8000 1.0000 2.0000 0.0000 Constraint 572 961 0.8000 1.0000 2.0000 0.0000 Constraint 572 955 0.8000 1.0000 2.0000 0.0000 Constraint 572 950 0.8000 1.0000 2.0000 0.0000 Constraint 572 940 0.8000 1.0000 2.0000 0.0000 Constraint 572 932 0.8000 1.0000 2.0000 0.0000 Constraint 572 927 0.8000 1.0000 2.0000 0.0000 Constraint 572 916 0.8000 1.0000 2.0000 0.0000 Constraint 572 909 0.8000 1.0000 2.0000 0.0000 Constraint 572 901 0.8000 1.0000 2.0000 0.0000 Constraint 572 887 0.8000 1.0000 2.0000 0.0000 Constraint 572 878 0.8000 1.0000 2.0000 0.0000 Constraint 572 869 0.8000 1.0000 2.0000 0.0000 Constraint 572 858 0.8000 1.0000 2.0000 0.0000 Constraint 572 849 0.8000 1.0000 2.0000 0.0000 Constraint 572 844 0.8000 1.0000 2.0000 0.0000 Constraint 572 825 0.8000 1.0000 2.0000 0.0000 Constraint 572 801 0.8000 1.0000 2.0000 0.0000 Constraint 572 793 0.8000 1.0000 2.0000 0.0000 Constraint 572 782 0.8000 1.0000 2.0000 0.0000 Constraint 572 771 0.8000 1.0000 2.0000 0.0000 Constraint 572 758 0.8000 1.0000 2.0000 0.0000 Constraint 572 752 0.8000 1.0000 2.0000 0.0000 Constraint 572 685 0.8000 1.0000 2.0000 0.0000 Constraint 572 673 0.8000 1.0000 2.0000 0.0000 Constraint 572 664 0.8000 1.0000 2.0000 0.0000 Constraint 572 657 0.8000 1.0000 2.0000 0.0000 Constraint 572 649 0.8000 1.0000 2.0000 0.0000 Constraint 572 644 0.8000 1.0000 2.0000 0.0000 Constraint 572 634 0.8000 1.0000 2.0000 0.0000 Constraint 572 623 0.8000 1.0000 2.0000 0.0000 Constraint 572 616 0.8000 1.0000 2.0000 0.0000 Constraint 572 608 0.8000 1.0000 2.0000 0.0000 Constraint 572 600 0.8000 1.0000 2.0000 0.0000 Constraint 572 581 0.8000 1.0000 2.0000 0.0000 Constraint 564 1144 0.8000 1.0000 2.0000 0.0000 Constraint 564 1135 0.8000 1.0000 2.0000 0.0000 Constraint 564 1126 0.8000 1.0000 2.0000 0.0000 Constraint 564 1115 0.8000 1.0000 2.0000 0.0000 Constraint 564 1106 0.8000 1.0000 2.0000 0.0000 Constraint 564 1101 0.8000 1.0000 2.0000 0.0000 Constraint 564 1093 0.8000 1.0000 2.0000 0.0000 Constraint 564 1082 0.8000 1.0000 2.0000 0.0000 Constraint 564 1075 0.8000 1.0000 2.0000 0.0000 Constraint 564 1067 0.8000 1.0000 2.0000 0.0000 Constraint 564 1059 0.8000 1.0000 2.0000 0.0000 Constraint 564 1052 0.8000 1.0000 2.0000 0.0000 Constraint 564 1043 0.8000 1.0000 2.0000 0.0000 Constraint 564 1038 0.8000 1.0000 2.0000 0.0000 Constraint 564 1033 0.8000 1.0000 2.0000 0.0000 Constraint 564 1025 0.8000 1.0000 2.0000 0.0000 Constraint 564 1017 0.8000 1.0000 2.0000 0.0000 Constraint 564 1012 0.8000 1.0000 2.0000 0.0000 Constraint 564 1001 0.8000 1.0000 2.0000 0.0000 Constraint 564 992 0.8000 1.0000 2.0000 0.0000 Constraint 564 986 0.8000 1.0000 2.0000 0.0000 Constraint 564 977 0.8000 1.0000 2.0000 0.0000 Constraint 564 969 0.8000 1.0000 2.0000 0.0000 Constraint 564 961 0.8000 1.0000 2.0000 0.0000 Constraint 564 955 0.8000 1.0000 2.0000 0.0000 Constraint 564 950 0.8000 1.0000 2.0000 0.0000 Constraint 564 940 0.8000 1.0000 2.0000 0.0000 Constraint 564 932 0.8000 1.0000 2.0000 0.0000 Constraint 564 927 0.8000 1.0000 2.0000 0.0000 Constraint 564 916 0.8000 1.0000 2.0000 0.0000 Constraint 564 909 0.8000 1.0000 2.0000 0.0000 Constraint 564 901 0.8000 1.0000 2.0000 0.0000 Constraint 564 887 0.8000 1.0000 2.0000 0.0000 Constraint 564 878 0.8000 1.0000 2.0000 0.0000 Constraint 564 869 0.8000 1.0000 2.0000 0.0000 Constraint 564 858 0.8000 1.0000 2.0000 0.0000 Constraint 564 849 0.8000 1.0000 2.0000 0.0000 Constraint 564 844 0.8000 1.0000 2.0000 0.0000 Constraint 564 825 0.8000 1.0000 2.0000 0.0000 Constraint 564 809 0.8000 1.0000 2.0000 0.0000 Constraint 564 801 0.8000 1.0000 2.0000 0.0000 Constraint 564 793 0.8000 1.0000 2.0000 0.0000 Constraint 564 782 0.8000 1.0000 2.0000 0.0000 Constraint 564 771 0.8000 1.0000 2.0000 0.0000 Constraint 564 758 0.8000 1.0000 2.0000 0.0000 Constraint 564 752 0.8000 1.0000 2.0000 0.0000 Constraint 564 738 0.8000 1.0000 2.0000 0.0000 Constraint 564 732 0.8000 1.0000 2.0000 0.0000 Constraint 564 696 0.8000 1.0000 2.0000 0.0000 Constraint 564 673 0.8000 1.0000 2.0000 0.0000 Constraint 564 664 0.8000 1.0000 2.0000 0.0000 Constraint 564 657 0.8000 1.0000 2.0000 0.0000 Constraint 564 649 0.8000 1.0000 2.0000 0.0000 Constraint 564 644 0.8000 1.0000 2.0000 0.0000 Constraint 564 634 0.8000 1.0000 2.0000 0.0000 Constraint 564 623 0.8000 1.0000 2.0000 0.0000 Constraint 564 616 0.8000 1.0000 2.0000 0.0000 Constraint 564 608 0.8000 1.0000 2.0000 0.0000 Constraint 564 600 0.8000 1.0000 2.0000 0.0000 Constraint 564 581 0.8000 1.0000 2.0000 0.0000 Constraint 564 572 0.8000 1.0000 2.0000 0.0000 Constraint 555 1144 0.8000 1.0000 2.0000 0.0000 Constraint 555 1135 0.8000 1.0000 2.0000 0.0000 Constraint 555 1126 0.8000 1.0000 2.0000 0.0000 Constraint 555 1115 0.8000 1.0000 2.0000 0.0000 Constraint 555 1106 0.8000 1.0000 2.0000 0.0000 Constraint 555 1101 0.8000 1.0000 2.0000 0.0000 Constraint 555 1093 0.8000 1.0000 2.0000 0.0000 Constraint 555 1082 0.8000 1.0000 2.0000 0.0000 Constraint 555 1075 0.8000 1.0000 2.0000 0.0000 Constraint 555 1067 0.8000 1.0000 2.0000 0.0000 Constraint 555 1059 0.8000 1.0000 2.0000 0.0000 Constraint 555 1052 0.8000 1.0000 2.0000 0.0000 Constraint 555 1043 0.8000 1.0000 2.0000 0.0000 Constraint 555 1038 0.8000 1.0000 2.0000 0.0000 Constraint 555 1033 0.8000 1.0000 2.0000 0.0000 Constraint 555 1025 0.8000 1.0000 2.0000 0.0000 Constraint 555 1017 0.8000 1.0000 2.0000 0.0000 Constraint 555 1012 0.8000 1.0000 2.0000 0.0000 Constraint 555 1001 0.8000 1.0000 2.0000 0.0000 Constraint 555 992 0.8000 1.0000 2.0000 0.0000 Constraint 555 986 0.8000 1.0000 2.0000 0.0000 Constraint 555 977 0.8000 1.0000 2.0000 0.0000 Constraint 555 969 0.8000 1.0000 2.0000 0.0000 Constraint 555 961 0.8000 1.0000 2.0000 0.0000 Constraint 555 955 0.8000 1.0000 2.0000 0.0000 Constraint 555 950 0.8000 1.0000 2.0000 0.0000 Constraint 555 940 0.8000 1.0000 2.0000 0.0000 Constraint 555 932 0.8000 1.0000 2.0000 0.0000 Constraint 555 927 0.8000 1.0000 2.0000 0.0000 Constraint 555 916 0.8000 1.0000 2.0000 0.0000 Constraint 555 909 0.8000 1.0000 2.0000 0.0000 Constraint 555 901 0.8000 1.0000 2.0000 0.0000 Constraint 555 887 0.8000 1.0000 2.0000 0.0000 Constraint 555 878 0.8000 1.0000 2.0000 0.0000 Constraint 555 869 0.8000 1.0000 2.0000 0.0000 Constraint 555 858 0.8000 1.0000 2.0000 0.0000 Constraint 555 849 0.8000 1.0000 2.0000 0.0000 Constraint 555 844 0.8000 1.0000 2.0000 0.0000 Constraint 555 833 0.8000 1.0000 2.0000 0.0000 Constraint 555 825 0.8000 1.0000 2.0000 0.0000 Constraint 555 809 0.8000 1.0000 2.0000 0.0000 Constraint 555 801 0.8000 1.0000 2.0000 0.0000 Constraint 555 793 0.8000 1.0000 2.0000 0.0000 Constraint 555 782 0.8000 1.0000 2.0000 0.0000 Constraint 555 771 0.8000 1.0000 2.0000 0.0000 Constraint 555 758 0.8000 1.0000 2.0000 0.0000 Constraint 555 752 0.8000 1.0000 2.0000 0.0000 Constraint 555 746 0.8000 1.0000 2.0000 0.0000 Constraint 555 738 0.8000 1.0000 2.0000 0.0000 Constraint 555 732 0.8000 1.0000 2.0000 0.0000 Constraint 555 725 0.8000 1.0000 2.0000 0.0000 Constraint 555 714 0.8000 1.0000 2.0000 0.0000 Constraint 555 707 0.8000 1.0000 2.0000 0.0000 Constraint 555 696 0.8000 1.0000 2.0000 0.0000 Constraint 555 685 0.8000 1.0000 2.0000 0.0000 Constraint 555 673 0.8000 1.0000 2.0000 0.0000 Constraint 555 664 0.8000 1.0000 2.0000 0.0000 Constraint 555 657 0.8000 1.0000 2.0000 0.0000 Constraint 555 649 0.8000 1.0000 2.0000 0.0000 Constraint 555 644 0.8000 1.0000 2.0000 0.0000 Constraint 555 634 0.8000 1.0000 2.0000 0.0000 Constraint 555 623 0.8000 1.0000 2.0000 0.0000 Constraint 555 616 0.8000 1.0000 2.0000 0.0000 Constraint 555 608 0.8000 1.0000 2.0000 0.0000 Constraint 555 600 0.8000 1.0000 2.0000 0.0000 Constraint 555 581 0.8000 1.0000 2.0000 0.0000 Constraint 555 572 0.8000 1.0000 2.0000 0.0000 Constraint 555 564 0.8000 1.0000 2.0000 0.0000 Constraint 544 1144 0.8000 1.0000 2.0000 0.0000 Constraint 544 1135 0.8000 1.0000 2.0000 0.0000 Constraint 544 1126 0.8000 1.0000 2.0000 0.0000 Constraint 544 1115 0.8000 1.0000 2.0000 0.0000 Constraint 544 1106 0.8000 1.0000 2.0000 0.0000 Constraint 544 1101 0.8000 1.0000 2.0000 0.0000 Constraint 544 1093 0.8000 1.0000 2.0000 0.0000 Constraint 544 1082 0.8000 1.0000 2.0000 0.0000 Constraint 544 1075 0.8000 1.0000 2.0000 0.0000 Constraint 544 1067 0.8000 1.0000 2.0000 0.0000 Constraint 544 1059 0.8000 1.0000 2.0000 0.0000 Constraint 544 1052 0.8000 1.0000 2.0000 0.0000 Constraint 544 1043 0.8000 1.0000 2.0000 0.0000 Constraint 544 1038 0.8000 1.0000 2.0000 0.0000 Constraint 544 1033 0.8000 1.0000 2.0000 0.0000 Constraint 544 1025 0.8000 1.0000 2.0000 0.0000 Constraint 544 1017 0.8000 1.0000 2.0000 0.0000 Constraint 544 1012 0.8000 1.0000 2.0000 0.0000 Constraint 544 1001 0.8000 1.0000 2.0000 0.0000 Constraint 544 992 0.8000 1.0000 2.0000 0.0000 Constraint 544 986 0.8000 1.0000 2.0000 0.0000 Constraint 544 977 0.8000 1.0000 2.0000 0.0000 Constraint 544 969 0.8000 1.0000 2.0000 0.0000 Constraint 544 961 0.8000 1.0000 2.0000 0.0000 Constraint 544 955 0.8000 1.0000 2.0000 0.0000 Constraint 544 950 0.8000 1.0000 2.0000 0.0000 Constraint 544 940 0.8000 1.0000 2.0000 0.0000 Constraint 544 932 0.8000 1.0000 2.0000 0.0000 Constraint 544 927 0.8000 1.0000 2.0000 0.0000 Constraint 544 916 0.8000 1.0000 2.0000 0.0000 Constraint 544 909 0.8000 1.0000 2.0000 0.0000 Constraint 544 901 0.8000 1.0000 2.0000 0.0000 Constraint 544 887 0.8000 1.0000 2.0000 0.0000 Constraint 544 878 0.8000 1.0000 2.0000 0.0000 Constraint 544 869 0.8000 1.0000 2.0000 0.0000 Constraint 544 858 0.8000 1.0000 2.0000 0.0000 Constraint 544 849 0.8000 1.0000 2.0000 0.0000 Constraint 544 844 0.8000 1.0000 2.0000 0.0000 Constraint 544 833 0.8000 1.0000 2.0000 0.0000 Constraint 544 825 0.8000 1.0000 2.0000 0.0000 Constraint 544 809 0.8000 1.0000 2.0000 0.0000 Constraint 544 801 0.8000 1.0000 2.0000 0.0000 Constraint 544 793 0.8000 1.0000 2.0000 0.0000 Constraint 544 782 0.8000 1.0000 2.0000 0.0000 Constraint 544 771 0.8000 1.0000 2.0000 0.0000 Constraint 544 758 0.8000 1.0000 2.0000 0.0000 Constraint 544 752 0.8000 1.0000 2.0000 0.0000 Constraint 544 746 0.8000 1.0000 2.0000 0.0000 Constraint 544 738 0.8000 1.0000 2.0000 0.0000 Constraint 544 732 0.8000 1.0000 2.0000 0.0000 Constraint 544 725 0.8000 1.0000 2.0000 0.0000 Constraint 544 714 0.8000 1.0000 2.0000 0.0000 Constraint 544 707 0.8000 1.0000 2.0000 0.0000 Constraint 544 696 0.8000 1.0000 2.0000 0.0000 Constraint 544 685 0.8000 1.0000 2.0000 0.0000 Constraint 544 673 0.8000 1.0000 2.0000 0.0000 Constraint 544 664 0.8000 1.0000 2.0000 0.0000 Constraint 544 657 0.8000 1.0000 2.0000 0.0000 Constraint 544 649 0.8000 1.0000 2.0000 0.0000 Constraint 544 644 0.8000 1.0000 2.0000 0.0000 Constraint 544 634 0.8000 1.0000 2.0000 0.0000 Constraint 544 616 0.8000 1.0000 2.0000 0.0000 Constraint 544 608 0.8000 1.0000 2.0000 0.0000 Constraint 544 600 0.8000 1.0000 2.0000 0.0000 Constraint 544 581 0.8000 1.0000 2.0000 0.0000 Constraint 544 572 0.8000 1.0000 2.0000 0.0000 Constraint 544 564 0.8000 1.0000 2.0000 0.0000 Constraint 544 555 0.8000 1.0000 2.0000 0.0000 Constraint 536 1144 0.8000 1.0000 2.0000 0.0000 Constraint 536 1135 0.8000 1.0000 2.0000 0.0000 Constraint 536 1126 0.8000 1.0000 2.0000 0.0000 Constraint 536 1115 0.8000 1.0000 2.0000 0.0000 Constraint 536 1106 0.8000 1.0000 2.0000 0.0000 Constraint 536 1101 0.8000 1.0000 2.0000 0.0000 Constraint 536 1093 0.8000 1.0000 2.0000 0.0000 Constraint 536 1082 0.8000 1.0000 2.0000 0.0000 Constraint 536 1075 0.8000 1.0000 2.0000 0.0000 Constraint 536 1067 0.8000 1.0000 2.0000 0.0000 Constraint 536 1059 0.8000 1.0000 2.0000 0.0000 Constraint 536 1052 0.8000 1.0000 2.0000 0.0000 Constraint 536 1043 0.8000 1.0000 2.0000 0.0000 Constraint 536 1038 0.8000 1.0000 2.0000 0.0000 Constraint 536 1033 0.8000 1.0000 2.0000 0.0000 Constraint 536 1025 0.8000 1.0000 2.0000 0.0000 Constraint 536 1017 0.8000 1.0000 2.0000 0.0000 Constraint 536 1012 0.8000 1.0000 2.0000 0.0000 Constraint 536 1001 0.8000 1.0000 2.0000 0.0000 Constraint 536 992 0.8000 1.0000 2.0000 0.0000 Constraint 536 986 0.8000 1.0000 2.0000 0.0000 Constraint 536 977 0.8000 1.0000 2.0000 0.0000 Constraint 536 969 0.8000 1.0000 2.0000 0.0000 Constraint 536 961 0.8000 1.0000 2.0000 0.0000 Constraint 536 955 0.8000 1.0000 2.0000 0.0000 Constraint 536 950 0.8000 1.0000 2.0000 0.0000 Constraint 536 940 0.8000 1.0000 2.0000 0.0000 Constraint 536 932 0.8000 1.0000 2.0000 0.0000 Constraint 536 927 0.8000 1.0000 2.0000 0.0000 Constraint 536 916 0.8000 1.0000 2.0000 0.0000 Constraint 536 909 0.8000 1.0000 2.0000 0.0000 Constraint 536 901 0.8000 1.0000 2.0000 0.0000 Constraint 536 887 0.8000 1.0000 2.0000 0.0000 Constraint 536 878 0.8000 1.0000 2.0000 0.0000 Constraint 536 869 0.8000 1.0000 2.0000 0.0000 Constraint 536 858 0.8000 1.0000 2.0000 0.0000 Constraint 536 849 0.8000 1.0000 2.0000 0.0000 Constraint 536 844 0.8000 1.0000 2.0000 0.0000 Constraint 536 825 0.8000 1.0000 2.0000 0.0000 Constraint 536 801 0.8000 1.0000 2.0000 0.0000 Constraint 536 793 0.8000 1.0000 2.0000 0.0000 Constraint 536 782 0.8000 1.0000 2.0000 0.0000 Constraint 536 771 0.8000 1.0000 2.0000 0.0000 Constraint 536 758 0.8000 1.0000 2.0000 0.0000 Constraint 536 752 0.8000 1.0000 2.0000 0.0000 Constraint 536 746 0.8000 1.0000 2.0000 0.0000 Constraint 536 673 0.8000 1.0000 2.0000 0.0000 Constraint 536 664 0.8000 1.0000 2.0000 0.0000 Constraint 536 649 0.8000 1.0000 2.0000 0.0000 Constraint 536 644 0.8000 1.0000 2.0000 0.0000 Constraint 536 634 0.8000 1.0000 2.0000 0.0000 Constraint 536 616 0.8000 1.0000 2.0000 0.0000 Constraint 536 600 0.8000 1.0000 2.0000 0.0000 Constraint 536 581 0.8000 1.0000 2.0000 0.0000 Constraint 536 572 0.8000 1.0000 2.0000 0.0000 Constraint 536 564 0.8000 1.0000 2.0000 0.0000 Constraint 536 555 0.8000 1.0000 2.0000 0.0000 Constraint 536 544 0.8000 1.0000 2.0000 0.0000 Constraint 528 1144 0.8000 1.0000 2.0000 0.0000 Constraint 528 1135 0.8000 1.0000 2.0000 0.0000 Constraint 528 1126 0.8000 1.0000 2.0000 0.0000 Constraint 528 1115 0.8000 1.0000 2.0000 0.0000 Constraint 528 1106 0.8000 1.0000 2.0000 0.0000 Constraint 528 1101 0.8000 1.0000 2.0000 0.0000 Constraint 528 1093 0.8000 1.0000 2.0000 0.0000 Constraint 528 1082 0.8000 1.0000 2.0000 0.0000 Constraint 528 1075 0.8000 1.0000 2.0000 0.0000 Constraint 528 1067 0.8000 1.0000 2.0000 0.0000 Constraint 528 1059 0.8000 1.0000 2.0000 0.0000 Constraint 528 1052 0.8000 1.0000 2.0000 0.0000 Constraint 528 1043 0.8000 1.0000 2.0000 0.0000 Constraint 528 1038 0.8000 1.0000 2.0000 0.0000 Constraint 528 1033 0.8000 1.0000 2.0000 0.0000 Constraint 528 1025 0.8000 1.0000 2.0000 0.0000 Constraint 528 1017 0.8000 1.0000 2.0000 0.0000 Constraint 528 1012 0.8000 1.0000 2.0000 0.0000 Constraint 528 1001 0.8000 1.0000 2.0000 0.0000 Constraint 528 992 0.8000 1.0000 2.0000 0.0000 Constraint 528 986 0.8000 1.0000 2.0000 0.0000 Constraint 528 977 0.8000 1.0000 2.0000 0.0000 Constraint 528 969 0.8000 1.0000 2.0000 0.0000 Constraint 528 961 0.8000 1.0000 2.0000 0.0000 Constraint 528 955 0.8000 1.0000 2.0000 0.0000 Constraint 528 950 0.8000 1.0000 2.0000 0.0000 Constraint 528 940 0.8000 1.0000 2.0000 0.0000 Constraint 528 932 0.8000 1.0000 2.0000 0.0000 Constraint 528 927 0.8000 1.0000 2.0000 0.0000 Constraint 528 916 0.8000 1.0000 2.0000 0.0000 Constraint 528 909 0.8000 1.0000 2.0000 0.0000 Constraint 528 901 0.8000 1.0000 2.0000 0.0000 Constraint 528 887 0.8000 1.0000 2.0000 0.0000 Constraint 528 878 0.8000 1.0000 2.0000 0.0000 Constraint 528 869 0.8000 1.0000 2.0000 0.0000 Constraint 528 858 0.8000 1.0000 2.0000 0.0000 Constraint 528 849 0.8000 1.0000 2.0000 0.0000 Constraint 528 844 0.8000 1.0000 2.0000 0.0000 Constraint 528 833 0.8000 1.0000 2.0000 0.0000 Constraint 528 825 0.8000 1.0000 2.0000 0.0000 Constraint 528 809 0.8000 1.0000 2.0000 0.0000 Constraint 528 801 0.8000 1.0000 2.0000 0.0000 Constraint 528 793 0.8000 1.0000 2.0000 0.0000 Constraint 528 782 0.8000 1.0000 2.0000 0.0000 Constraint 528 771 0.8000 1.0000 2.0000 0.0000 Constraint 528 758 0.8000 1.0000 2.0000 0.0000 Constraint 528 752 0.8000 1.0000 2.0000 0.0000 Constraint 528 746 0.8000 1.0000 2.0000 0.0000 Constraint 528 738 0.8000 1.0000 2.0000 0.0000 Constraint 528 732 0.8000 1.0000 2.0000 0.0000 Constraint 528 725 0.8000 1.0000 2.0000 0.0000 Constraint 528 714 0.8000 1.0000 2.0000 0.0000 Constraint 528 707 0.8000 1.0000 2.0000 0.0000 Constraint 528 696 0.8000 1.0000 2.0000 0.0000 Constraint 528 685 0.8000 1.0000 2.0000 0.0000 Constraint 528 673 0.8000 1.0000 2.0000 0.0000 Constraint 528 664 0.8000 1.0000 2.0000 0.0000 Constraint 528 657 0.8000 1.0000 2.0000 0.0000 Constraint 528 649 0.8000 1.0000 2.0000 0.0000 Constraint 528 644 0.8000 1.0000 2.0000 0.0000 Constraint 528 634 0.8000 1.0000 2.0000 0.0000 Constraint 528 623 0.8000 1.0000 2.0000 0.0000 Constraint 528 616 0.8000 1.0000 2.0000 0.0000 Constraint 528 608 0.8000 1.0000 2.0000 0.0000 Constraint 528 600 0.8000 1.0000 2.0000 0.0000 Constraint 528 581 0.8000 1.0000 2.0000 0.0000 Constraint 528 572 0.8000 1.0000 2.0000 0.0000 Constraint 528 564 0.8000 1.0000 2.0000 0.0000 Constraint 528 555 0.8000 1.0000 2.0000 0.0000 Constraint 528 544 0.8000 1.0000 2.0000 0.0000 Constraint 528 536 0.8000 1.0000 2.0000 0.0000 Constraint 523 1144 0.8000 1.0000 2.0000 0.0000 Constraint 523 1135 0.8000 1.0000 2.0000 0.0000 Constraint 523 1126 0.8000 1.0000 2.0000 0.0000 Constraint 523 1115 0.8000 1.0000 2.0000 0.0000 Constraint 523 1106 0.8000 1.0000 2.0000 0.0000 Constraint 523 1101 0.8000 1.0000 2.0000 0.0000 Constraint 523 1093 0.8000 1.0000 2.0000 0.0000 Constraint 523 1082 0.8000 1.0000 2.0000 0.0000 Constraint 523 1075 0.8000 1.0000 2.0000 0.0000 Constraint 523 1067 0.8000 1.0000 2.0000 0.0000 Constraint 523 1059 0.8000 1.0000 2.0000 0.0000 Constraint 523 1052 0.8000 1.0000 2.0000 0.0000 Constraint 523 1043 0.8000 1.0000 2.0000 0.0000 Constraint 523 1038 0.8000 1.0000 2.0000 0.0000 Constraint 523 1033 0.8000 1.0000 2.0000 0.0000 Constraint 523 1025 0.8000 1.0000 2.0000 0.0000 Constraint 523 1017 0.8000 1.0000 2.0000 0.0000 Constraint 523 1012 0.8000 1.0000 2.0000 0.0000 Constraint 523 1001 0.8000 1.0000 2.0000 0.0000 Constraint 523 992 0.8000 1.0000 2.0000 0.0000 Constraint 523 986 0.8000 1.0000 2.0000 0.0000 Constraint 523 977 0.8000 1.0000 2.0000 0.0000 Constraint 523 969 0.8000 1.0000 2.0000 0.0000 Constraint 523 961 0.8000 1.0000 2.0000 0.0000 Constraint 523 955 0.8000 1.0000 2.0000 0.0000 Constraint 523 950 0.8000 1.0000 2.0000 0.0000 Constraint 523 940 0.8000 1.0000 2.0000 0.0000 Constraint 523 932 0.8000 1.0000 2.0000 0.0000 Constraint 523 927 0.8000 1.0000 2.0000 0.0000 Constraint 523 916 0.8000 1.0000 2.0000 0.0000 Constraint 523 909 0.8000 1.0000 2.0000 0.0000 Constraint 523 901 0.8000 1.0000 2.0000 0.0000 Constraint 523 887 0.8000 1.0000 2.0000 0.0000 Constraint 523 878 0.8000 1.0000 2.0000 0.0000 Constraint 523 869 0.8000 1.0000 2.0000 0.0000 Constraint 523 858 0.8000 1.0000 2.0000 0.0000 Constraint 523 849 0.8000 1.0000 2.0000 0.0000 Constraint 523 844 0.8000 1.0000 2.0000 0.0000 Constraint 523 833 0.8000 1.0000 2.0000 0.0000 Constraint 523 825 0.8000 1.0000 2.0000 0.0000 Constraint 523 809 0.8000 1.0000 2.0000 0.0000 Constraint 523 801 0.8000 1.0000 2.0000 0.0000 Constraint 523 793 0.8000 1.0000 2.0000 0.0000 Constraint 523 782 0.8000 1.0000 2.0000 0.0000 Constraint 523 771 0.8000 1.0000 2.0000 0.0000 Constraint 523 758 0.8000 1.0000 2.0000 0.0000 Constraint 523 752 0.8000 1.0000 2.0000 0.0000 Constraint 523 746 0.8000 1.0000 2.0000 0.0000 Constraint 523 738 0.8000 1.0000 2.0000 0.0000 Constraint 523 732 0.8000 1.0000 2.0000 0.0000 Constraint 523 725 0.8000 1.0000 2.0000 0.0000 Constraint 523 714 0.8000 1.0000 2.0000 0.0000 Constraint 523 707 0.8000 1.0000 2.0000 0.0000 Constraint 523 696 0.8000 1.0000 2.0000 0.0000 Constraint 523 685 0.8000 1.0000 2.0000 0.0000 Constraint 523 673 0.8000 1.0000 2.0000 0.0000 Constraint 523 664 0.8000 1.0000 2.0000 0.0000 Constraint 523 657 0.8000 1.0000 2.0000 0.0000 Constraint 523 649 0.8000 1.0000 2.0000 0.0000 Constraint 523 644 0.8000 1.0000 2.0000 0.0000 Constraint 523 634 0.8000 1.0000 2.0000 0.0000 Constraint 523 623 0.8000 1.0000 2.0000 0.0000 Constraint 523 616 0.8000 1.0000 2.0000 0.0000 Constraint 523 608 0.8000 1.0000 2.0000 0.0000 Constraint 523 600 0.8000 1.0000 2.0000 0.0000 Constraint 523 581 0.8000 1.0000 2.0000 0.0000 Constraint 523 572 0.8000 1.0000 2.0000 0.0000 Constraint 523 564 0.8000 1.0000 2.0000 0.0000 Constraint 523 555 0.8000 1.0000 2.0000 0.0000 Constraint 523 544 0.8000 1.0000 2.0000 0.0000 Constraint 523 536 0.8000 1.0000 2.0000 0.0000 Constraint 523 528 0.8000 1.0000 2.0000 0.0000 Constraint 518 1144 0.8000 1.0000 2.0000 0.0000 Constraint 518 1135 0.8000 1.0000 2.0000 0.0000 Constraint 518 1126 0.8000 1.0000 2.0000 0.0000 Constraint 518 1115 0.8000 1.0000 2.0000 0.0000 Constraint 518 1106 0.8000 1.0000 2.0000 0.0000 Constraint 518 1101 0.8000 1.0000 2.0000 0.0000 Constraint 518 1093 0.8000 1.0000 2.0000 0.0000 Constraint 518 1082 0.8000 1.0000 2.0000 0.0000 Constraint 518 1075 0.8000 1.0000 2.0000 0.0000 Constraint 518 1067 0.8000 1.0000 2.0000 0.0000 Constraint 518 1059 0.8000 1.0000 2.0000 0.0000 Constraint 518 1052 0.8000 1.0000 2.0000 0.0000 Constraint 518 1043 0.8000 1.0000 2.0000 0.0000 Constraint 518 1038 0.8000 1.0000 2.0000 0.0000 Constraint 518 1033 0.8000 1.0000 2.0000 0.0000 Constraint 518 1025 0.8000 1.0000 2.0000 0.0000 Constraint 518 1017 0.8000 1.0000 2.0000 0.0000 Constraint 518 1012 0.8000 1.0000 2.0000 0.0000 Constraint 518 1001 0.8000 1.0000 2.0000 0.0000 Constraint 518 992 0.8000 1.0000 2.0000 0.0000 Constraint 518 986 0.8000 1.0000 2.0000 0.0000 Constraint 518 977 0.8000 1.0000 2.0000 0.0000 Constraint 518 969 0.8000 1.0000 2.0000 0.0000 Constraint 518 961 0.8000 1.0000 2.0000 0.0000 Constraint 518 955 0.8000 1.0000 2.0000 0.0000 Constraint 518 950 0.8000 1.0000 2.0000 0.0000 Constraint 518 940 0.8000 1.0000 2.0000 0.0000 Constraint 518 932 0.8000 1.0000 2.0000 0.0000 Constraint 518 927 0.8000 1.0000 2.0000 0.0000 Constraint 518 916 0.8000 1.0000 2.0000 0.0000 Constraint 518 909 0.8000 1.0000 2.0000 0.0000 Constraint 518 901 0.8000 1.0000 2.0000 0.0000 Constraint 518 887 0.8000 1.0000 2.0000 0.0000 Constraint 518 878 0.8000 1.0000 2.0000 0.0000 Constraint 518 869 0.8000 1.0000 2.0000 0.0000 Constraint 518 858 0.8000 1.0000 2.0000 0.0000 Constraint 518 849 0.8000 1.0000 2.0000 0.0000 Constraint 518 844 0.8000 1.0000 2.0000 0.0000 Constraint 518 833 0.8000 1.0000 2.0000 0.0000 Constraint 518 825 0.8000 1.0000 2.0000 0.0000 Constraint 518 809 0.8000 1.0000 2.0000 0.0000 Constraint 518 801 0.8000 1.0000 2.0000 0.0000 Constraint 518 793 0.8000 1.0000 2.0000 0.0000 Constraint 518 782 0.8000 1.0000 2.0000 0.0000 Constraint 518 771 0.8000 1.0000 2.0000 0.0000 Constraint 518 758 0.8000 1.0000 2.0000 0.0000 Constraint 518 752 0.8000 1.0000 2.0000 0.0000 Constraint 518 746 0.8000 1.0000 2.0000 0.0000 Constraint 518 738 0.8000 1.0000 2.0000 0.0000 Constraint 518 732 0.8000 1.0000 2.0000 0.0000 Constraint 518 725 0.8000 1.0000 2.0000 0.0000 Constraint 518 714 0.8000 1.0000 2.0000 0.0000 Constraint 518 707 0.8000 1.0000 2.0000 0.0000 Constraint 518 696 0.8000 1.0000 2.0000 0.0000 Constraint 518 685 0.8000 1.0000 2.0000 0.0000 Constraint 518 673 0.8000 1.0000 2.0000 0.0000 Constraint 518 664 0.8000 1.0000 2.0000 0.0000 Constraint 518 657 0.8000 1.0000 2.0000 0.0000 Constraint 518 649 0.8000 1.0000 2.0000 0.0000 Constraint 518 644 0.8000 1.0000 2.0000 0.0000 Constraint 518 634 0.8000 1.0000 2.0000 0.0000 Constraint 518 623 0.8000 1.0000 2.0000 0.0000 Constraint 518 616 0.8000 1.0000 2.0000 0.0000 Constraint 518 608 0.8000 1.0000 2.0000 0.0000 Constraint 518 600 0.8000 1.0000 2.0000 0.0000 Constraint 518 581 0.8000 1.0000 2.0000 0.0000 Constraint 518 572 0.8000 1.0000 2.0000 0.0000 Constraint 518 564 0.8000 1.0000 2.0000 0.0000 Constraint 518 555 0.8000 1.0000 2.0000 0.0000 Constraint 518 544 0.8000 1.0000 2.0000 0.0000 Constraint 518 536 0.8000 1.0000 2.0000 0.0000 Constraint 518 528 0.8000 1.0000 2.0000 0.0000 Constraint 518 523 0.8000 1.0000 2.0000 0.0000 Constraint 510 1144 0.8000 1.0000 2.0000 0.0000 Constraint 510 1135 0.8000 1.0000 2.0000 0.0000 Constraint 510 1126 0.8000 1.0000 2.0000 0.0000 Constraint 510 1115 0.8000 1.0000 2.0000 0.0000 Constraint 510 1106 0.8000 1.0000 2.0000 0.0000 Constraint 510 1101 0.8000 1.0000 2.0000 0.0000 Constraint 510 1093 0.8000 1.0000 2.0000 0.0000 Constraint 510 1082 0.8000 1.0000 2.0000 0.0000 Constraint 510 1075 0.8000 1.0000 2.0000 0.0000 Constraint 510 1067 0.8000 1.0000 2.0000 0.0000 Constraint 510 1059 0.8000 1.0000 2.0000 0.0000 Constraint 510 1052 0.8000 1.0000 2.0000 0.0000 Constraint 510 1043 0.8000 1.0000 2.0000 0.0000 Constraint 510 1038 0.8000 1.0000 2.0000 0.0000 Constraint 510 1033 0.8000 1.0000 2.0000 0.0000 Constraint 510 1025 0.8000 1.0000 2.0000 0.0000 Constraint 510 1017 0.8000 1.0000 2.0000 0.0000 Constraint 510 1012 0.8000 1.0000 2.0000 0.0000 Constraint 510 1001 0.8000 1.0000 2.0000 0.0000 Constraint 510 992 0.8000 1.0000 2.0000 0.0000 Constraint 510 986 0.8000 1.0000 2.0000 0.0000 Constraint 510 977 0.8000 1.0000 2.0000 0.0000 Constraint 510 969 0.8000 1.0000 2.0000 0.0000 Constraint 510 961 0.8000 1.0000 2.0000 0.0000 Constraint 510 955 0.8000 1.0000 2.0000 0.0000 Constraint 510 950 0.8000 1.0000 2.0000 0.0000 Constraint 510 940 0.8000 1.0000 2.0000 0.0000 Constraint 510 932 0.8000 1.0000 2.0000 0.0000 Constraint 510 927 0.8000 1.0000 2.0000 0.0000 Constraint 510 916 0.8000 1.0000 2.0000 0.0000 Constraint 510 909 0.8000 1.0000 2.0000 0.0000 Constraint 510 901 0.8000 1.0000 2.0000 0.0000 Constraint 510 887 0.8000 1.0000 2.0000 0.0000 Constraint 510 878 0.8000 1.0000 2.0000 0.0000 Constraint 510 869 0.8000 1.0000 2.0000 0.0000 Constraint 510 858 0.8000 1.0000 2.0000 0.0000 Constraint 510 849 0.8000 1.0000 2.0000 0.0000 Constraint 510 844 0.8000 1.0000 2.0000 0.0000 Constraint 510 833 0.8000 1.0000 2.0000 0.0000 Constraint 510 825 0.8000 1.0000 2.0000 0.0000 Constraint 510 809 0.8000 1.0000 2.0000 0.0000 Constraint 510 801 0.8000 1.0000 2.0000 0.0000 Constraint 510 793 0.8000 1.0000 2.0000 0.0000 Constraint 510 782 0.8000 1.0000 2.0000 0.0000 Constraint 510 771 0.8000 1.0000 2.0000 0.0000 Constraint 510 758 0.8000 1.0000 2.0000 0.0000 Constraint 510 752 0.8000 1.0000 2.0000 0.0000 Constraint 510 746 0.8000 1.0000 2.0000 0.0000 Constraint 510 738 0.8000 1.0000 2.0000 0.0000 Constraint 510 732 0.8000 1.0000 2.0000 0.0000 Constraint 510 725 0.8000 1.0000 2.0000 0.0000 Constraint 510 714 0.8000 1.0000 2.0000 0.0000 Constraint 510 707 0.8000 1.0000 2.0000 0.0000 Constraint 510 696 0.8000 1.0000 2.0000 0.0000 Constraint 510 685 0.8000 1.0000 2.0000 0.0000 Constraint 510 673 0.8000 1.0000 2.0000 0.0000 Constraint 510 664 0.8000 1.0000 2.0000 0.0000 Constraint 510 657 0.8000 1.0000 2.0000 0.0000 Constraint 510 649 0.8000 1.0000 2.0000 0.0000 Constraint 510 644 0.8000 1.0000 2.0000 0.0000 Constraint 510 634 0.8000 1.0000 2.0000 0.0000 Constraint 510 623 0.8000 1.0000 2.0000 0.0000 Constraint 510 616 0.8000 1.0000 2.0000 0.0000 Constraint 510 608 0.8000 1.0000 2.0000 0.0000 Constraint 510 600 0.8000 1.0000 2.0000 0.0000 Constraint 510 581 0.8000 1.0000 2.0000 0.0000 Constraint 510 572 0.8000 1.0000 2.0000 0.0000 Constraint 510 564 0.8000 1.0000 2.0000 0.0000 Constraint 510 555 0.8000 1.0000 2.0000 0.0000 Constraint 510 544 0.8000 1.0000 2.0000 0.0000 Constraint 510 536 0.8000 1.0000 2.0000 0.0000 Constraint 510 528 0.8000 1.0000 2.0000 0.0000 Constraint 510 523 0.8000 1.0000 2.0000 0.0000 Constraint 510 518 0.8000 1.0000 2.0000 0.0000 Constraint 502 1144 0.8000 1.0000 2.0000 0.0000 Constraint 502 1135 0.8000 1.0000 2.0000 0.0000 Constraint 502 1126 0.8000 1.0000 2.0000 0.0000 Constraint 502 1115 0.8000 1.0000 2.0000 0.0000 Constraint 502 1106 0.8000 1.0000 2.0000 0.0000 Constraint 502 1101 0.8000 1.0000 2.0000 0.0000 Constraint 502 1093 0.8000 1.0000 2.0000 0.0000 Constraint 502 1082 0.8000 1.0000 2.0000 0.0000 Constraint 502 1075 0.8000 1.0000 2.0000 0.0000 Constraint 502 1067 0.8000 1.0000 2.0000 0.0000 Constraint 502 1059 0.8000 1.0000 2.0000 0.0000 Constraint 502 1052 0.8000 1.0000 2.0000 0.0000 Constraint 502 1043 0.8000 1.0000 2.0000 0.0000 Constraint 502 1038 0.8000 1.0000 2.0000 0.0000 Constraint 502 1033 0.8000 1.0000 2.0000 0.0000 Constraint 502 1025 0.8000 1.0000 2.0000 0.0000 Constraint 502 1017 0.8000 1.0000 2.0000 0.0000 Constraint 502 1012 0.8000 1.0000 2.0000 0.0000 Constraint 502 1001 0.8000 1.0000 2.0000 0.0000 Constraint 502 992 0.8000 1.0000 2.0000 0.0000 Constraint 502 986 0.8000 1.0000 2.0000 0.0000 Constraint 502 977 0.8000 1.0000 2.0000 0.0000 Constraint 502 969 0.8000 1.0000 2.0000 0.0000 Constraint 502 961 0.8000 1.0000 2.0000 0.0000 Constraint 502 955 0.8000 1.0000 2.0000 0.0000 Constraint 502 950 0.8000 1.0000 2.0000 0.0000 Constraint 502 940 0.8000 1.0000 2.0000 0.0000 Constraint 502 932 0.8000 1.0000 2.0000 0.0000 Constraint 502 927 0.8000 1.0000 2.0000 0.0000 Constraint 502 916 0.8000 1.0000 2.0000 0.0000 Constraint 502 909 0.8000 1.0000 2.0000 0.0000 Constraint 502 901 0.8000 1.0000 2.0000 0.0000 Constraint 502 887 0.8000 1.0000 2.0000 0.0000 Constraint 502 878 0.8000 1.0000 2.0000 0.0000 Constraint 502 869 0.8000 1.0000 2.0000 0.0000 Constraint 502 858 0.8000 1.0000 2.0000 0.0000 Constraint 502 849 0.8000 1.0000 2.0000 0.0000 Constraint 502 844 0.8000 1.0000 2.0000 0.0000 Constraint 502 833 0.8000 1.0000 2.0000 0.0000 Constraint 502 825 0.8000 1.0000 2.0000 0.0000 Constraint 502 809 0.8000 1.0000 2.0000 0.0000 Constraint 502 801 0.8000 1.0000 2.0000 0.0000 Constraint 502 793 0.8000 1.0000 2.0000 0.0000 Constraint 502 782 0.8000 1.0000 2.0000 0.0000 Constraint 502 771 0.8000 1.0000 2.0000 0.0000 Constraint 502 758 0.8000 1.0000 2.0000 0.0000 Constraint 502 752 0.8000 1.0000 2.0000 0.0000 Constraint 502 746 0.8000 1.0000 2.0000 0.0000 Constraint 502 738 0.8000 1.0000 2.0000 0.0000 Constraint 502 732 0.8000 1.0000 2.0000 0.0000 Constraint 502 725 0.8000 1.0000 2.0000 0.0000 Constraint 502 714 0.8000 1.0000 2.0000 0.0000 Constraint 502 707 0.8000 1.0000 2.0000 0.0000 Constraint 502 696 0.8000 1.0000 2.0000 0.0000 Constraint 502 685 0.8000 1.0000 2.0000 0.0000 Constraint 502 673 0.8000 1.0000 2.0000 0.0000 Constraint 502 664 0.8000 1.0000 2.0000 0.0000 Constraint 502 657 0.8000 1.0000 2.0000 0.0000 Constraint 502 649 0.8000 1.0000 2.0000 0.0000 Constraint 502 644 0.8000 1.0000 2.0000 0.0000 Constraint 502 634 0.8000 1.0000 2.0000 0.0000 Constraint 502 623 0.8000 1.0000 2.0000 0.0000 Constraint 502 616 0.8000 1.0000 2.0000 0.0000 Constraint 502 608 0.8000 1.0000 2.0000 0.0000 Constraint 502 600 0.8000 1.0000 2.0000 0.0000 Constraint 502 581 0.8000 1.0000 2.0000 0.0000 Constraint 502 572 0.8000 1.0000 2.0000 0.0000 Constraint 502 564 0.8000 1.0000 2.0000 0.0000 Constraint 502 555 0.8000 1.0000 2.0000 0.0000 Constraint 502 544 0.8000 1.0000 2.0000 0.0000 Constraint 502 536 0.8000 1.0000 2.0000 0.0000 Constraint 502 528 0.8000 1.0000 2.0000 0.0000 Constraint 502 523 0.8000 1.0000 2.0000 0.0000 Constraint 502 518 0.8000 1.0000 2.0000 0.0000 Constraint 502 510 0.8000 1.0000 2.0000 0.0000 Constraint 496 1144 0.8000 1.0000 2.0000 0.0000 Constraint 496 1135 0.8000 1.0000 2.0000 0.0000 Constraint 496 1126 0.8000 1.0000 2.0000 0.0000 Constraint 496 1115 0.8000 1.0000 2.0000 0.0000 Constraint 496 1106 0.8000 1.0000 2.0000 0.0000 Constraint 496 1101 0.8000 1.0000 2.0000 0.0000 Constraint 496 1093 0.8000 1.0000 2.0000 0.0000 Constraint 496 1082 0.8000 1.0000 2.0000 0.0000 Constraint 496 1075 0.8000 1.0000 2.0000 0.0000 Constraint 496 1067 0.8000 1.0000 2.0000 0.0000 Constraint 496 1059 0.8000 1.0000 2.0000 0.0000 Constraint 496 1052 0.8000 1.0000 2.0000 0.0000 Constraint 496 1043 0.8000 1.0000 2.0000 0.0000 Constraint 496 1038 0.8000 1.0000 2.0000 0.0000 Constraint 496 1033 0.8000 1.0000 2.0000 0.0000 Constraint 496 1025 0.8000 1.0000 2.0000 0.0000 Constraint 496 1017 0.8000 1.0000 2.0000 0.0000 Constraint 496 1012 0.8000 1.0000 2.0000 0.0000 Constraint 496 1001 0.8000 1.0000 2.0000 0.0000 Constraint 496 992 0.8000 1.0000 2.0000 0.0000 Constraint 496 986 0.8000 1.0000 2.0000 0.0000 Constraint 496 977 0.8000 1.0000 2.0000 0.0000 Constraint 496 969 0.8000 1.0000 2.0000 0.0000 Constraint 496 961 0.8000 1.0000 2.0000 0.0000 Constraint 496 955 0.8000 1.0000 2.0000 0.0000 Constraint 496 950 0.8000 1.0000 2.0000 0.0000 Constraint 496 940 0.8000 1.0000 2.0000 0.0000 Constraint 496 932 0.8000 1.0000 2.0000 0.0000 Constraint 496 927 0.8000 1.0000 2.0000 0.0000 Constraint 496 916 0.8000 1.0000 2.0000 0.0000 Constraint 496 909 0.8000 1.0000 2.0000 0.0000 Constraint 496 901 0.8000 1.0000 2.0000 0.0000 Constraint 496 887 0.8000 1.0000 2.0000 0.0000 Constraint 496 878 0.8000 1.0000 2.0000 0.0000 Constraint 496 869 0.8000 1.0000 2.0000 0.0000 Constraint 496 858 0.8000 1.0000 2.0000 0.0000 Constraint 496 849 0.8000 1.0000 2.0000 0.0000 Constraint 496 844 0.8000 1.0000 2.0000 0.0000 Constraint 496 833 0.8000 1.0000 2.0000 0.0000 Constraint 496 825 0.8000 1.0000 2.0000 0.0000 Constraint 496 809 0.8000 1.0000 2.0000 0.0000 Constraint 496 801 0.8000 1.0000 2.0000 0.0000 Constraint 496 793 0.8000 1.0000 2.0000 0.0000 Constraint 496 782 0.8000 1.0000 2.0000 0.0000 Constraint 496 771 0.8000 1.0000 2.0000 0.0000 Constraint 496 758 0.8000 1.0000 2.0000 0.0000 Constraint 496 752 0.8000 1.0000 2.0000 0.0000 Constraint 496 746 0.8000 1.0000 2.0000 0.0000 Constraint 496 738 0.8000 1.0000 2.0000 0.0000 Constraint 496 732 0.8000 1.0000 2.0000 0.0000 Constraint 496 725 0.8000 1.0000 2.0000 0.0000 Constraint 496 714 0.8000 1.0000 2.0000 0.0000 Constraint 496 707 0.8000 1.0000 2.0000 0.0000 Constraint 496 696 0.8000 1.0000 2.0000 0.0000 Constraint 496 685 0.8000 1.0000 2.0000 0.0000 Constraint 496 673 0.8000 1.0000 2.0000 0.0000 Constraint 496 664 0.8000 1.0000 2.0000 0.0000 Constraint 496 657 0.8000 1.0000 2.0000 0.0000 Constraint 496 649 0.8000 1.0000 2.0000 0.0000 Constraint 496 644 0.8000 1.0000 2.0000 0.0000 Constraint 496 634 0.8000 1.0000 2.0000 0.0000 Constraint 496 623 0.8000 1.0000 2.0000 0.0000 Constraint 496 616 0.8000 1.0000 2.0000 0.0000 Constraint 496 608 0.8000 1.0000 2.0000 0.0000 Constraint 496 600 0.8000 1.0000 2.0000 0.0000 Constraint 496 581 0.8000 1.0000 2.0000 0.0000 Constraint 496 572 0.8000 1.0000 2.0000 0.0000 Constraint 496 564 0.8000 1.0000 2.0000 0.0000 Constraint 496 555 0.8000 1.0000 2.0000 0.0000 Constraint 496 544 0.8000 1.0000 2.0000 0.0000 Constraint 496 536 0.8000 1.0000 2.0000 0.0000 Constraint 496 528 0.8000 1.0000 2.0000 0.0000 Constraint 496 523 0.8000 1.0000 2.0000 0.0000 Constraint 496 518 0.8000 1.0000 2.0000 0.0000 Constraint 496 510 0.8000 1.0000 2.0000 0.0000 Constraint 496 502 0.8000 1.0000 2.0000 0.0000 Constraint 490 1144 0.8000 1.0000 2.0000 0.0000 Constraint 490 1135 0.8000 1.0000 2.0000 0.0000 Constraint 490 1126 0.8000 1.0000 2.0000 0.0000 Constraint 490 1115 0.8000 1.0000 2.0000 0.0000 Constraint 490 1106 0.8000 1.0000 2.0000 0.0000 Constraint 490 1101 0.8000 1.0000 2.0000 0.0000 Constraint 490 1093 0.8000 1.0000 2.0000 0.0000 Constraint 490 1082 0.8000 1.0000 2.0000 0.0000 Constraint 490 1075 0.8000 1.0000 2.0000 0.0000 Constraint 490 1067 0.8000 1.0000 2.0000 0.0000 Constraint 490 1059 0.8000 1.0000 2.0000 0.0000 Constraint 490 1052 0.8000 1.0000 2.0000 0.0000 Constraint 490 1043 0.8000 1.0000 2.0000 0.0000 Constraint 490 1038 0.8000 1.0000 2.0000 0.0000 Constraint 490 1033 0.8000 1.0000 2.0000 0.0000 Constraint 490 1025 0.8000 1.0000 2.0000 0.0000 Constraint 490 1017 0.8000 1.0000 2.0000 0.0000 Constraint 490 1012 0.8000 1.0000 2.0000 0.0000 Constraint 490 1001 0.8000 1.0000 2.0000 0.0000 Constraint 490 992 0.8000 1.0000 2.0000 0.0000 Constraint 490 986 0.8000 1.0000 2.0000 0.0000 Constraint 490 977 0.8000 1.0000 2.0000 0.0000 Constraint 490 969 0.8000 1.0000 2.0000 0.0000 Constraint 490 961 0.8000 1.0000 2.0000 0.0000 Constraint 490 955 0.8000 1.0000 2.0000 0.0000 Constraint 490 950 0.8000 1.0000 2.0000 0.0000 Constraint 490 940 0.8000 1.0000 2.0000 0.0000 Constraint 490 932 0.8000 1.0000 2.0000 0.0000 Constraint 490 927 0.8000 1.0000 2.0000 0.0000 Constraint 490 916 0.8000 1.0000 2.0000 0.0000 Constraint 490 909 0.8000 1.0000 2.0000 0.0000 Constraint 490 901 0.8000 1.0000 2.0000 0.0000 Constraint 490 887 0.8000 1.0000 2.0000 0.0000 Constraint 490 878 0.8000 1.0000 2.0000 0.0000 Constraint 490 869 0.8000 1.0000 2.0000 0.0000 Constraint 490 858 0.8000 1.0000 2.0000 0.0000 Constraint 490 849 0.8000 1.0000 2.0000 0.0000 Constraint 490 844 0.8000 1.0000 2.0000 0.0000 Constraint 490 833 0.8000 1.0000 2.0000 0.0000 Constraint 490 825 0.8000 1.0000 2.0000 0.0000 Constraint 490 809 0.8000 1.0000 2.0000 0.0000 Constraint 490 801 0.8000 1.0000 2.0000 0.0000 Constraint 490 793 0.8000 1.0000 2.0000 0.0000 Constraint 490 782 0.8000 1.0000 2.0000 0.0000 Constraint 490 771 0.8000 1.0000 2.0000 0.0000 Constraint 490 758 0.8000 1.0000 2.0000 0.0000 Constraint 490 752 0.8000 1.0000 2.0000 0.0000 Constraint 490 746 0.8000 1.0000 2.0000 0.0000 Constraint 490 738 0.8000 1.0000 2.0000 0.0000 Constraint 490 732 0.8000 1.0000 2.0000 0.0000 Constraint 490 725 0.8000 1.0000 2.0000 0.0000 Constraint 490 714 0.8000 1.0000 2.0000 0.0000 Constraint 490 707 0.8000 1.0000 2.0000 0.0000 Constraint 490 696 0.8000 1.0000 2.0000 0.0000 Constraint 490 685 0.8000 1.0000 2.0000 0.0000 Constraint 490 673 0.8000 1.0000 2.0000 0.0000 Constraint 490 664 0.8000 1.0000 2.0000 0.0000 Constraint 490 657 0.8000 1.0000 2.0000 0.0000 Constraint 490 649 0.8000 1.0000 2.0000 0.0000 Constraint 490 644 0.8000 1.0000 2.0000 0.0000 Constraint 490 634 0.8000 1.0000 2.0000 0.0000 Constraint 490 623 0.8000 1.0000 2.0000 0.0000 Constraint 490 616 0.8000 1.0000 2.0000 0.0000 Constraint 490 608 0.8000 1.0000 2.0000 0.0000 Constraint 490 600 0.8000 1.0000 2.0000 0.0000 Constraint 490 581 0.8000 1.0000 2.0000 0.0000 Constraint 490 572 0.8000 1.0000 2.0000 0.0000 Constraint 490 564 0.8000 1.0000 2.0000 0.0000 Constraint 490 555 0.8000 1.0000 2.0000 0.0000 Constraint 490 544 0.8000 1.0000 2.0000 0.0000 Constraint 490 536 0.8000 1.0000 2.0000 0.0000 Constraint 490 528 0.8000 1.0000 2.0000 0.0000 Constraint 490 523 0.8000 1.0000 2.0000 0.0000 Constraint 490 518 0.8000 1.0000 2.0000 0.0000 Constraint 490 510 0.8000 1.0000 2.0000 0.0000 Constraint 490 502 0.8000 1.0000 2.0000 0.0000 Constraint 490 496 0.8000 1.0000 2.0000 0.0000 Constraint 479 1144 0.8000 1.0000 2.0000 0.0000 Constraint 479 1135 0.8000 1.0000 2.0000 0.0000 Constraint 479 1126 0.8000 1.0000 2.0000 0.0000 Constraint 479 1115 0.8000 1.0000 2.0000 0.0000 Constraint 479 1106 0.8000 1.0000 2.0000 0.0000 Constraint 479 1101 0.8000 1.0000 2.0000 0.0000 Constraint 479 1093 0.8000 1.0000 2.0000 0.0000 Constraint 479 1082 0.8000 1.0000 2.0000 0.0000 Constraint 479 1075 0.8000 1.0000 2.0000 0.0000 Constraint 479 1067 0.8000 1.0000 2.0000 0.0000 Constraint 479 1059 0.8000 1.0000 2.0000 0.0000 Constraint 479 1052 0.8000 1.0000 2.0000 0.0000 Constraint 479 1043 0.8000 1.0000 2.0000 0.0000 Constraint 479 1038 0.8000 1.0000 2.0000 0.0000 Constraint 479 1033 0.8000 1.0000 2.0000 0.0000 Constraint 479 1025 0.8000 1.0000 2.0000 0.0000 Constraint 479 1017 0.8000 1.0000 2.0000 0.0000 Constraint 479 1012 0.8000 1.0000 2.0000 0.0000 Constraint 479 1001 0.8000 1.0000 2.0000 0.0000 Constraint 479 992 0.8000 1.0000 2.0000 0.0000 Constraint 479 986 0.8000 1.0000 2.0000 0.0000 Constraint 479 977 0.8000 1.0000 2.0000 0.0000 Constraint 479 969 0.8000 1.0000 2.0000 0.0000 Constraint 479 961 0.8000 1.0000 2.0000 0.0000 Constraint 479 955 0.8000 1.0000 2.0000 0.0000 Constraint 479 950 0.8000 1.0000 2.0000 0.0000 Constraint 479 940 0.8000 1.0000 2.0000 0.0000 Constraint 479 932 0.8000 1.0000 2.0000 0.0000 Constraint 479 927 0.8000 1.0000 2.0000 0.0000 Constraint 479 916 0.8000 1.0000 2.0000 0.0000 Constraint 479 909 0.8000 1.0000 2.0000 0.0000 Constraint 479 901 0.8000 1.0000 2.0000 0.0000 Constraint 479 887 0.8000 1.0000 2.0000 0.0000 Constraint 479 878 0.8000 1.0000 2.0000 0.0000 Constraint 479 869 0.8000 1.0000 2.0000 0.0000 Constraint 479 858 0.8000 1.0000 2.0000 0.0000 Constraint 479 849 0.8000 1.0000 2.0000 0.0000 Constraint 479 844 0.8000 1.0000 2.0000 0.0000 Constraint 479 833 0.8000 1.0000 2.0000 0.0000 Constraint 479 825 0.8000 1.0000 2.0000 0.0000 Constraint 479 809 0.8000 1.0000 2.0000 0.0000 Constraint 479 801 0.8000 1.0000 2.0000 0.0000 Constraint 479 793 0.8000 1.0000 2.0000 0.0000 Constraint 479 782 0.8000 1.0000 2.0000 0.0000 Constraint 479 771 0.8000 1.0000 2.0000 0.0000 Constraint 479 758 0.8000 1.0000 2.0000 0.0000 Constraint 479 752 0.8000 1.0000 2.0000 0.0000 Constraint 479 746 0.8000 1.0000 2.0000 0.0000 Constraint 479 738 0.8000 1.0000 2.0000 0.0000 Constraint 479 732 0.8000 1.0000 2.0000 0.0000 Constraint 479 725 0.8000 1.0000 2.0000 0.0000 Constraint 479 714 0.8000 1.0000 2.0000 0.0000 Constraint 479 707 0.8000 1.0000 2.0000 0.0000 Constraint 479 696 0.8000 1.0000 2.0000 0.0000 Constraint 479 685 0.8000 1.0000 2.0000 0.0000 Constraint 479 673 0.8000 1.0000 2.0000 0.0000 Constraint 479 664 0.8000 1.0000 2.0000 0.0000 Constraint 479 657 0.8000 1.0000 2.0000 0.0000 Constraint 479 649 0.8000 1.0000 2.0000 0.0000 Constraint 479 644 0.8000 1.0000 2.0000 0.0000 Constraint 479 634 0.8000 1.0000 2.0000 0.0000 Constraint 479 623 0.8000 1.0000 2.0000 0.0000 Constraint 479 616 0.8000 1.0000 2.0000 0.0000 Constraint 479 608 0.8000 1.0000 2.0000 0.0000 Constraint 479 600 0.8000 1.0000 2.0000 0.0000 Constraint 479 581 0.8000 1.0000 2.0000 0.0000 Constraint 479 572 0.8000 1.0000 2.0000 0.0000 Constraint 479 564 0.8000 1.0000 2.0000 0.0000 Constraint 479 555 0.8000 1.0000 2.0000 0.0000 Constraint 479 544 0.8000 1.0000 2.0000 0.0000 Constraint 479 536 0.8000 1.0000 2.0000 0.0000 Constraint 479 528 0.8000 1.0000 2.0000 0.0000 Constraint 479 523 0.8000 1.0000 2.0000 0.0000 Constraint 479 518 0.8000 1.0000 2.0000 0.0000 Constraint 479 510 0.8000 1.0000 2.0000 0.0000 Constraint 479 502 0.8000 1.0000 2.0000 0.0000 Constraint 479 496 0.8000 1.0000 2.0000 0.0000 Constraint 479 490 0.8000 1.0000 2.0000 0.0000 Constraint 471 1144 0.8000 1.0000 2.0000 0.0000 Constraint 471 1135 0.8000 1.0000 2.0000 0.0000 Constraint 471 1126 0.8000 1.0000 2.0000 0.0000 Constraint 471 1115 0.8000 1.0000 2.0000 0.0000 Constraint 471 1106 0.8000 1.0000 2.0000 0.0000 Constraint 471 1101 0.8000 1.0000 2.0000 0.0000 Constraint 471 1093 0.8000 1.0000 2.0000 0.0000 Constraint 471 1082 0.8000 1.0000 2.0000 0.0000 Constraint 471 1075 0.8000 1.0000 2.0000 0.0000 Constraint 471 1067 0.8000 1.0000 2.0000 0.0000 Constraint 471 1059 0.8000 1.0000 2.0000 0.0000 Constraint 471 1043 0.8000 1.0000 2.0000 0.0000 Constraint 471 1038 0.8000 1.0000 2.0000 0.0000 Constraint 471 1033 0.8000 1.0000 2.0000 0.0000 Constraint 471 1025 0.8000 1.0000 2.0000 0.0000 Constraint 471 1017 0.8000 1.0000 2.0000 0.0000 Constraint 471 1012 0.8000 1.0000 2.0000 0.0000 Constraint 471 1001 0.8000 1.0000 2.0000 0.0000 Constraint 471 992 0.8000 1.0000 2.0000 0.0000 Constraint 471 986 0.8000 1.0000 2.0000 0.0000 Constraint 471 977 0.8000 1.0000 2.0000 0.0000 Constraint 471 969 0.8000 1.0000 2.0000 0.0000 Constraint 471 961 0.8000 1.0000 2.0000 0.0000 Constraint 471 955 0.8000 1.0000 2.0000 0.0000 Constraint 471 950 0.8000 1.0000 2.0000 0.0000 Constraint 471 940 0.8000 1.0000 2.0000 0.0000 Constraint 471 932 0.8000 1.0000 2.0000 0.0000 Constraint 471 927 0.8000 1.0000 2.0000 0.0000 Constraint 471 916 0.8000 1.0000 2.0000 0.0000 Constraint 471 909 0.8000 1.0000 2.0000 0.0000 Constraint 471 901 0.8000 1.0000 2.0000 0.0000 Constraint 471 887 0.8000 1.0000 2.0000 0.0000 Constraint 471 878 0.8000 1.0000 2.0000 0.0000 Constraint 471 869 0.8000 1.0000 2.0000 0.0000 Constraint 471 858 0.8000 1.0000 2.0000 0.0000 Constraint 471 849 0.8000 1.0000 2.0000 0.0000 Constraint 471 844 0.8000 1.0000 2.0000 0.0000 Constraint 471 833 0.8000 1.0000 2.0000 0.0000 Constraint 471 825 0.8000 1.0000 2.0000 0.0000 Constraint 471 809 0.8000 1.0000 2.0000 0.0000 Constraint 471 801 0.8000 1.0000 2.0000 0.0000 Constraint 471 793 0.8000 1.0000 2.0000 0.0000 Constraint 471 782 0.8000 1.0000 2.0000 0.0000 Constraint 471 771 0.8000 1.0000 2.0000 0.0000 Constraint 471 758 0.8000 1.0000 2.0000 0.0000 Constraint 471 752 0.8000 1.0000 2.0000 0.0000 Constraint 471 746 0.8000 1.0000 2.0000 0.0000 Constraint 471 738 0.8000 1.0000 2.0000 0.0000 Constraint 471 732 0.8000 1.0000 2.0000 0.0000 Constraint 471 725 0.8000 1.0000 2.0000 0.0000 Constraint 471 714 0.8000 1.0000 2.0000 0.0000 Constraint 471 707 0.8000 1.0000 2.0000 0.0000 Constraint 471 696 0.8000 1.0000 2.0000 0.0000 Constraint 471 685 0.8000 1.0000 2.0000 0.0000 Constraint 471 673 0.8000 1.0000 2.0000 0.0000 Constraint 471 664 0.8000 1.0000 2.0000 0.0000 Constraint 471 657 0.8000 1.0000 2.0000 0.0000 Constraint 471 649 0.8000 1.0000 2.0000 0.0000 Constraint 471 644 0.8000 1.0000 2.0000 0.0000 Constraint 471 634 0.8000 1.0000 2.0000 0.0000 Constraint 471 623 0.8000 1.0000 2.0000 0.0000 Constraint 471 616 0.8000 1.0000 2.0000 0.0000 Constraint 471 608 0.8000 1.0000 2.0000 0.0000 Constraint 471 600 0.8000 1.0000 2.0000 0.0000 Constraint 471 581 0.8000 1.0000 2.0000 0.0000 Constraint 471 572 0.8000 1.0000 2.0000 0.0000 Constraint 471 564 0.8000 1.0000 2.0000 0.0000 Constraint 471 555 0.8000 1.0000 2.0000 0.0000 Constraint 471 544 0.8000 1.0000 2.0000 0.0000 Constraint 471 536 0.8000 1.0000 2.0000 0.0000 Constraint 471 528 0.8000 1.0000 2.0000 0.0000 Constraint 471 523 0.8000 1.0000 2.0000 0.0000 Constraint 471 518 0.8000 1.0000 2.0000 0.0000 Constraint 471 510 0.8000 1.0000 2.0000 0.0000 Constraint 471 502 0.8000 1.0000 2.0000 0.0000 Constraint 471 496 0.8000 1.0000 2.0000 0.0000 Constraint 471 490 0.8000 1.0000 2.0000 0.0000 Constraint 471 479 0.8000 1.0000 2.0000 0.0000 Constraint 460 1144 0.8000 1.0000 2.0000 0.0000 Constraint 460 1126 0.8000 1.0000 2.0000 0.0000 Constraint 460 1115 0.8000 1.0000 2.0000 0.0000 Constraint 460 1101 0.8000 1.0000 2.0000 0.0000 Constraint 460 1093 0.8000 1.0000 2.0000 0.0000 Constraint 460 1075 0.8000 1.0000 2.0000 0.0000 Constraint 460 1067 0.8000 1.0000 2.0000 0.0000 Constraint 460 1043 0.8000 1.0000 2.0000 0.0000 Constraint 460 1025 0.8000 1.0000 2.0000 0.0000 Constraint 460 1017 0.8000 1.0000 2.0000 0.0000 Constraint 460 1012 0.8000 1.0000 2.0000 0.0000 Constraint 460 1001 0.8000 1.0000 2.0000 0.0000 Constraint 460 992 0.8000 1.0000 2.0000 0.0000 Constraint 460 986 0.8000 1.0000 2.0000 0.0000 Constraint 460 977 0.8000 1.0000 2.0000 0.0000 Constraint 460 969 0.8000 1.0000 2.0000 0.0000 Constraint 460 961 0.8000 1.0000 2.0000 0.0000 Constraint 460 955 0.8000 1.0000 2.0000 0.0000 Constraint 460 950 0.8000 1.0000 2.0000 0.0000 Constraint 460 940 0.8000 1.0000 2.0000 0.0000 Constraint 460 932 0.8000 1.0000 2.0000 0.0000 Constraint 460 927 0.8000 1.0000 2.0000 0.0000 Constraint 460 916 0.8000 1.0000 2.0000 0.0000 Constraint 460 909 0.8000 1.0000 2.0000 0.0000 Constraint 460 901 0.8000 1.0000 2.0000 0.0000 Constraint 460 887 0.8000 1.0000 2.0000 0.0000 Constraint 460 878 0.8000 1.0000 2.0000 0.0000 Constraint 460 869 0.8000 1.0000 2.0000 0.0000 Constraint 460 858 0.8000 1.0000 2.0000 0.0000 Constraint 460 849 0.8000 1.0000 2.0000 0.0000 Constraint 460 844 0.8000 1.0000 2.0000 0.0000 Constraint 460 833 0.8000 1.0000 2.0000 0.0000 Constraint 460 825 0.8000 1.0000 2.0000 0.0000 Constraint 460 809 0.8000 1.0000 2.0000 0.0000 Constraint 460 801 0.8000 1.0000 2.0000 0.0000 Constraint 460 793 0.8000 1.0000 2.0000 0.0000 Constraint 460 782 0.8000 1.0000 2.0000 0.0000 Constraint 460 771 0.8000 1.0000 2.0000 0.0000 Constraint 460 758 0.8000 1.0000 2.0000 0.0000 Constraint 460 752 0.8000 1.0000 2.0000 0.0000 Constraint 460 746 0.8000 1.0000 2.0000 0.0000 Constraint 460 738 0.8000 1.0000 2.0000 0.0000 Constraint 460 732 0.8000 1.0000 2.0000 0.0000 Constraint 460 725 0.8000 1.0000 2.0000 0.0000 Constraint 460 714 0.8000 1.0000 2.0000 0.0000 Constraint 460 707 0.8000 1.0000 2.0000 0.0000 Constraint 460 696 0.8000 1.0000 2.0000 0.0000 Constraint 460 685 0.8000 1.0000 2.0000 0.0000 Constraint 460 673 0.8000 1.0000 2.0000 0.0000 Constraint 460 664 0.8000 1.0000 2.0000 0.0000 Constraint 460 657 0.8000 1.0000 2.0000 0.0000 Constraint 460 649 0.8000 1.0000 2.0000 0.0000 Constraint 460 644 0.8000 1.0000 2.0000 0.0000 Constraint 460 634 0.8000 1.0000 2.0000 0.0000 Constraint 460 623 0.8000 1.0000 2.0000 0.0000 Constraint 460 616 0.8000 1.0000 2.0000 0.0000 Constraint 460 608 0.8000 1.0000 2.0000 0.0000 Constraint 460 600 0.8000 1.0000 2.0000 0.0000 Constraint 460 581 0.8000 1.0000 2.0000 0.0000 Constraint 460 572 0.8000 1.0000 2.0000 0.0000 Constraint 460 564 0.8000 1.0000 2.0000 0.0000 Constraint 460 555 0.8000 1.0000 2.0000 0.0000 Constraint 460 544 0.8000 1.0000 2.0000 0.0000 Constraint 460 536 0.8000 1.0000 2.0000 0.0000 Constraint 460 528 0.8000 1.0000 2.0000 0.0000 Constraint 460 523 0.8000 1.0000 2.0000 0.0000 Constraint 460 518 0.8000 1.0000 2.0000 0.0000 Constraint 460 510 0.8000 1.0000 2.0000 0.0000 Constraint 460 502 0.8000 1.0000 2.0000 0.0000 Constraint 460 496 0.8000 1.0000 2.0000 0.0000 Constraint 460 490 0.8000 1.0000 2.0000 0.0000 Constraint 460 479 0.8000 1.0000 2.0000 0.0000 Constraint 460 471 0.8000 1.0000 2.0000 0.0000 Constraint 451 1144 0.8000 1.0000 2.0000 0.0000 Constraint 451 1135 0.8000 1.0000 2.0000 0.0000 Constraint 451 1126 0.8000 1.0000 2.0000 0.0000 Constraint 451 1115 0.8000 1.0000 2.0000 0.0000 Constraint 451 1106 0.8000 1.0000 2.0000 0.0000 Constraint 451 1101 0.8000 1.0000 2.0000 0.0000 Constraint 451 1093 0.8000 1.0000 2.0000 0.0000 Constraint 451 1082 0.8000 1.0000 2.0000 0.0000 Constraint 451 1075 0.8000 1.0000 2.0000 0.0000 Constraint 451 1067 0.8000 1.0000 2.0000 0.0000 Constraint 451 1059 0.8000 1.0000 2.0000 0.0000 Constraint 451 1052 0.8000 1.0000 2.0000 0.0000 Constraint 451 1043 0.8000 1.0000 2.0000 0.0000 Constraint 451 1033 0.8000 1.0000 2.0000 0.0000 Constraint 451 1025 0.8000 1.0000 2.0000 0.0000 Constraint 451 1017 0.8000 1.0000 2.0000 0.0000 Constraint 451 1012 0.8000 1.0000 2.0000 0.0000 Constraint 451 1001 0.8000 1.0000 2.0000 0.0000 Constraint 451 992 0.8000 1.0000 2.0000 0.0000 Constraint 451 986 0.8000 1.0000 2.0000 0.0000 Constraint 451 977 0.8000 1.0000 2.0000 0.0000 Constraint 451 969 0.8000 1.0000 2.0000 0.0000 Constraint 451 961 0.8000 1.0000 2.0000 0.0000 Constraint 451 955 0.8000 1.0000 2.0000 0.0000 Constraint 451 950 0.8000 1.0000 2.0000 0.0000 Constraint 451 940 0.8000 1.0000 2.0000 0.0000 Constraint 451 932 0.8000 1.0000 2.0000 0.0000 Constraint 451 927 0.8000 1.0000 2.0000 0.0000 Constraint 451 916 0.8000 1.0000 2.0000 0.0000 Constraint 451 909 0.8000 1.0000 2.0000 0.0000 Constraint 451 901 0.8000 1.0000 2.0000 0.0000 Constraint 451 887 0.8000 1.0000 2.0000 0.0000 Constraint 451 878 0.8000 1.0000 2.0000 0.0000 Constraint 451 869 0.8000 1.0000 2.0000 0.0000 Constraint 451 858 0.8000 1.0000 2.0000 0.0000 Constraint 451 849 0.8000 1.0000 2.0000 0.0000 Constraint 451 844 0.8000 1.0000 2.0000 0.0000 Constraint 451 833 0.8000 1.0000 2.0000 0.0000 Constraint 451 825 0.8000 1.0000 2.0000 0.0000 Constraint 451 809 0.8000 1.0000 2.0000 0.0000 Constraint 451 801 0.8000 1.0000 2.0000 0.0000 Constraint 451 793 0.8000 1.0000 2.0000 0.0000 Constraint 451 782 0.8000 1.0000 2.0000 0.0000 Constraint 451 771 0.8000 1.0000 2.0000 0.0000 Constraint 451 758 0.8000 1.0000 2.0000 0.0000 Constraint 451 752 0.8000 1.0000 2.0000 0.0000 Constraint 451 746 0.8000 1.0000 2.0000 0.0000 Constraint 451 738 0.8000 1.0000 2.0000 0.0000 Constraint 451 732 0.8000 1.0000 2.0000 0.0000 Constraint 451 725 0.8000 1.0000 2.0000 0.0000 Constraint 451 714 0.8000 1.0000 2.0000 0.0000 Constraint 451 707 0.8000 1.0000 2.0000 0.0000 Constraint 451 696 0.8000 1.0000 2.0000 0.0000 Constraint 451 685 0.8000 1.0000 2.0000 0.0000 Constraint 451 673 0.8000 1.0000 2.0000 0.0000 Constraint 451 664 0.8000 1.0000 2.0000 0.0000 Constraint 451 657 0.8000 1.0000 2.0000 0.0000 Constraint 451 649 0.8000 1.0000 2.0000 0.0000 Constraint 451 644 0.8000 1.0000 2.0000 0.0000 Constraint 451 634 0.8000 1.0000 2.0000 0.0000 Constraint 451 623 0.8000 1.0000 2.0000 0.0000 Constraint 451 616 0.8000 1.0000 2.0000 0.0000 Constraint 451 608 0.8000 1.0000 2.0000 0.0000 Constraint 451 600 0.8000 1.0000 2.0000 0.0000 Constraint 451 581 0.8000 1.0000 2.0000 0.0000 Constraint 451 572 0.8000 1.0000 2.0000 0.0000 Constraint 451 564 0.8000 1.0000 2.0000 0.0000 Constraint 451 555 0.8000 1.0000 2.0000 0.0000 Constraint 451 544 0.8000 1.0000 2.0000 0.0000 Constraint 451 536 0.8000 1.0000 2.0000 0.0000 Constraint 451 523 0.8000 1.0000 2.0000 0.0000 Constraint 451 518 0.8000 1.0000 2.0000 0.0000 Constraint 451 510 0.8000 1.0000 2.0000 0.0000 Constraint 451 502 0.8000 1.0000 2.0000 0.0000 Constraint 451 496 0.8000 1.0000 2.0000 0.0000 Constraint 451 490 0.8000 1.0000 2.0000 0.0000 Constraint 451 479 0.8000 1.0000 2.0000 0.0000 Constraint 451 471 0.8000 1.0000 2.0000 0.0000 Constraint 451 460 0.8000 1.0000 2.0000 0.0000 Constraint 446 1144 0.8000 1.0000 2.0000 0.0000 Constraint 446 1135 0.8000 1.0000 2.0000 0.0000 Constraint 446 1126 0.8000 1.0000 2.0000 0.0000 Constraint 446 1106 0.8000 1.0000 2.0000 0.0000 Constraint 446 1101 0.8000 1.0000 2.0000 0.0000 Constraint 446 1082 0.8000 1.0000 2.0000 0.0000 Constraint 446 1075 0.8000 1.0000 2.0000 0.0000 Constraint 446 1067 0.8000 1.0000 2.0000 0.0000 Constraint 446 1059 0.8000 1.0000 2.0000 0.0000 Constraint 446 1052 0.8000 1.0000 2.0000 0.0000 Constraint 446 1043 0.8000 1.0000 2.0000 0.0000 Constraint 446 1038 0.8000 1.0000 2.0000 0.0000 Constraint 446 1033 0.8000 1.0000 2.0000 0.0000 Constraint 446 1025 0.8000 1.0000 2.0000 0.0000 Constraint 446 1017 0.8000 1.0000 2.0000 0.0000 Constraint 446 1012 0.8000 1.0000 2.0000 0.0000 Constraint 446 1001 0.8000 1.0000 2.0000 0.0000 Constraint 446 992 0.8000 1.0000 2.0000 0.0000 Constraint 446 986 0.8000 1.0000 2.0000 0.0000 Constraint 446 977 0.8000 1.0000 2.0000 0.0000 Constraint 446 969 0.8000 1.0000 2.0000 0.0000 Constraint 446 961 0.8000 1.0000 2.0000 0.0000 Constraint 446 955 0.8000 1.0000 2.0000 0.0000 Constraint 446 950 0.8000 1.0000 2.0000 0.0000 Constraint 446 940 0.8000 1.0000 2.0000 0.0000 Constraint 446 932 0.8000 1.0000 2.0000 0.0000 Constraint 446 927 0.8000 1.0000 2.0000 0.0000 Constraint 446 916 0.8000 1.0000 2.0000 0.0000 Constraint 446 909 0.8000 1.0000 2.0000 0.0000 Constraint 446 901 0.8000 1.0000 2.0000 0.0000 Constraint 446 887 0.8000 1.0000 2.0000 0.0000 Constraint 446 878 0.8000 1.0000 2.0000 0.0000 Constraint 446 869 0.8000 1.0000 2.0000 0.0000 Constraint 446 858 0.8000 1.0000 2.0000 0.0000 Constraint 446 849 0.8000 1.0000 2.0000 0.0000 Constraint 446 844 0.8000 1.0000 2.0000 0.0000 Constraint 446 833 0.8000 1.0000 2.0000 0.0000 Constraint 446 825 0.8000 1.0000 2.0000 0.0000 Constraint 446 809 0.8000 1.0000 2.0000 0.0000 Constraint 446 801 0.8000 1.0000 2.0000 0.0000 Constraint 446 793 0.8000 1.0000 2.0000 0.0000 Constraint 446 782 0.8000 1.0000 2.0000 0.0000 Constraint 446 771 0.8000 1.0000 2.0000 0.0000 Constraint 446 758 0.8000 1.0000 2.0000 0.0000 Constraint 446 752 0.8000 1.0000 2.0000 0.0000 Constraint 446 746 0.8000 1.0000 2.0000 0.0000 Constraint 446 738 0.8000 1.0000 2.0000 0.0000 Constraint 446 732 0.8000 1.0000 2.0000 0.0000 Constraint 446 725 0.8000 1.0000 2.0000 0.0000 Constraint 446 714 0.8000 1.0000 2.0000 0.0000 Constraint 446 707 0.8000 1.0000 2.0000 0.0000 Constraint 446 696 0.8000 1.0000 2.0000 0.0000 Constraint 446 685 0.8000 1.0000 2.0000 0.0000 Constraint 446 673 0.8000 1.0000 2.0000 0.0000 Constraint 446 664 0.8000 1.0000 2.0000 0.0000 Constraint 446 657 0.8000 1.0000 2.0000 0.0000 Constraint 446 649 0.8000 1.0000 2.0000 0.0000 Constraint 446 644 0.8000 1.0000 2.0000 0.0000 Constraint 446 634 0.8000 1.0000 2.0000 0.0000 Constraint 446 623 0.8000 1.0000 2.0000 0.0000 Constraint 446 616 0.8000 1.0000 2.0000 0.0000 Constraint 446 608 0.8000 1.0000 2.0000 0.0000 Constraint 446 600 0.8000 1.0000 2.0000 0.0000 Constraint 446 581 0.8000 1.0000 2.0000 0.0000 Constraint 446 572 0.8000 1.0000 2.0000 0.0000 Constraint 446 564 0.8000 1.0000 2.0000 0.0000 Constraint 446 555 0.8000 1.0000 2.0000 0.0000 Constraint 446 544 0.8000 1.0000 2.0000 0.0000 Constraint 446 536 0.8000 1.0000 2.0000 0.0000 Constraint 446 528 0.8000 1.0000 2.0000 0.0000 Constraint 446 523 0.8000 1.0000 2.0000 0.0000 Constraint 446 518 0.8000 1.0000 2.0000 0.0000 Constraint 446 510 0.8000 1.0000 2.0000 0.0000 Constraint 446 502 0.8000 1.0000 2.0000 0.0000 Constraint 446 496 0.8000 1.0000 2.0000 0.0000 Constraint 446 490 0.8000 1.0000 2.0000 0.0000 Constraint 446 479 0.8000 1.0000 2.0000 0.0000 Constraint 446 471 0.8000 1.0000 2.0000 0.0000 Constraint 446 460 0.8000 1.0000 2.0000 0.0000 Constraint 446 451 0.8000 1.0000 2.0000 0.0000 Constraint 441 1144 0.8000 1.0000 2.0000 0.0000 Constraint 441 1135 0.8000 1.0000 2.0000 0.0000 Constraint 441 1126 0.8000 1.0000 2.0000 0.0000 Constraint 441 1115 0.8000 1.0000 2.0000 0.0000 Constraint 441 1106 0.8000 1.0000 2.0000 0.0000 Constraint 441 1101 0.8000 1.0000 2.0000 0.0000 Constraint 441 1075 0.8000 1.0000 2.0000 0.0000 Constraint 441 1067 0.8000 1.0000 2.0000 0.0000 Constraint 441 1059 0.8000 1.0000 2.0000 0.0000 Constraint 441 1052 0.8000 1.0000 2.0000 0.0000 Constraint 441 1043 0.8000 1.0000 2.0000 0.0000 Constraint 441 1038 0.8000 1.0000 2.0000 0.0000 Constraint 441 1033 0.8000 1.0000 2.0000 0.0000 Constraint 441 1025 0.8000 1.0000 2.0000 0.0000 Constraint 441 1017 0.8000 1.0000 2.0000 0.0000 Constraint 441 1012 0.8000 1.0000 2.0000 0.0000 Constraint 441 1001 0.8000 1.0000 2.0000 0.0000 Constraint 441 992 0.8000 1.0000 2.0000 0.0000 Constraint 441 986 0.8000 1.0000 2.0000 0.0000 Constraint 441 977 0.8000 1.0000 2.0000 0.0000 Constraint 441 969 0.8000 1.0000 2.0000 0.0000 Constraint 441 961 0.8000 1.0000 2.0000 0.0000 Constraint 441 955 0.8000 1.0000 2.0000 0.0000 Constraint 441 950 0.8000 1.0000 2.0000 0.0000 Constraint 441 940 0.8000 1.0000 2.0000 0.0000 Constraint 441 932 0.8000 1.0000 2.0000 0.0000 Constraint 441 927 0.8000 1.0000 2.0000 0.0000 Constraint 441 916 0.8000 1.0000 2.0000 0.0000 Constraint 441 909 0.8000 1.0000 2.0000 0.0000 Constraint 441 901 0.8000 1.0000 2.0000 0.0000 Constraint 441 887 0.8000 1.0000 2.0000 0.0000 Constraint 441 878 0.8000 1.0000 2.0000 0.0000 Constraint 441 869 0.8000 1.0000 2.0000 0.0000 Constraint 441 858 0.8000 1.0000 2.0000 0.0000 Constraint 441 849 0.8000 1.0000 2.0000 0.0000 Constraint 441 844 0.8000 1.0000 2.0000 0.0000 Constraint 441 833 0.8000 1.0000 2.0000 0.0000 Constraint 441 825 0.8000 1.0000 2.0000 0.0000 Constraint 441 809 0.8000 1.0000 2.0000 0.0000 Constraint 441 801 0.8000 1.0000 2.0000 0.0000 Constraint 441 793 0.8000 1.0000 2.0000 0.0000 Constraint 441 782 0.8000 1.0000 2.0000 0.0000 Constraint 441 771 0.8000 1.0000 2.0000 0.0000 Constraint 441 758 0.8000 1.0000 2.0000 0.0000 Constraint 441 752 0.8000 1.0000 2.0000 0.0000 Constraint 441 746 0.8000 1.0000 2.0000 0.0000 Constraint 441 738 0.8000 1.0000 2.0000 0.0000 Constraint 441 732 0.8000 1.0000 2.0000 0.0000 Constraint 441 725 0.8000 1.0000 2.0000 0.0000 Constraint 441 714 0.8000 1.0000 2.0000 0.0000 Constraint 441 707 0.8000 1.0000 2.0000 0.0000 Constraint 441 696 0.8000 1.0000 2.0000 0.0000 Constraint 441 685 0.8000 1.0000 2.0000 0.0000 Constraint 441 673 0.8000 1.0000 2.0000 0.0000 Constraint 441 664 0.8000 1.0000 2.0000 0.0000 Constraint 441 657 0.8000 1.0000 2.0000 0.0000 Constraint 441 649 0.8000 1.0000 2.0000 0.0000 Constraint 441 644 0.8000 1.0000 2.0000 0.0000 Constraint 441 634 0.8000 1.0000 2.0000 0.0000 Constraint 441 623 0.8000 1.0000 2.0000 0.0000 Constraint 441 616 0.8000 1.0000 2.0000 0.0000 Constraint 441 608 0.8000 1.0000 2.0000 0.0000 Constraint 441 600 0.8000 1.0000 2.0000 0.0000 Constraint 441 581 0.8000 1.0000 2.0000 0.0000 Constraint 441 572 0.8000 1.0000 2.0000 0.0000 Constraint 441 564 0.8000 1.0000 2.0000 0.0000 Constraint 441 555 0.8000 1.0000 2.0000 0.0000 Constraint 441 544 0.8000 1.0000 2.0000 0.0000 Constraint 441 536 0.8000 1.0000 2.0000 0.0000 Constraint 441 528 0.8000 1.0000 2.0000 0.0000 Constraint 441 523 0.8000 1.0000 2.0000 0.0000 Constraint 441 518 0.8000 1.0000 2.0000 0.0000 Constraint 441 510 0.8000 1.0000 2.0000 0.0000 Constraint 441 502 0.8000 1.0000 2.0000 0.0000 Constraint 441 496 0.8000 1.0000 2.0000 0.0000 Constraint 441 490 0.8000 1.0000 2.0000 0.0000 Constraint 441 479 0.8000 1.0000 2.0000 0.0000 Constraint 441 471 0.8000 1.0000 2.0000 0.0000 Constraint 441 460 0.8000 1.0000 2.0000 0.0000 Constraint 441 451 0.8000 1.0000 2.0000 0.0000 Constraint 441 446 0.8000 1.0000 2.0000 0.0000 Constraint 436 1144 0.8000 1.0000 2.0000 0.0000 Constraint 436 1135 0.8000 1.0000 2.0000 0.0000 Constraint 436 1126 0.8000 1.0000 2.0000 0.0000 Constraint 436 1115 0.8000 1.0000 2.0000 0.0000 Constraint 436 1106 0.8000 1.0000 2.0000 0.0000 Constraint 436 1101 0.8000 1.0000 2.0000 0.0000 Constraint 436 1093 0.8000 1.0000 2.0000 0.0000 Constraint 436 1082 0.8000 1.0000 2.0000 0.0000 Constraint 436 1075 0.8000 1.0000 2.0000 0.0000 Constraint 436 1067 0.8000 1.0000 2.0000 0.0000 Constraint 436 1059 0.8000 1.0000 2.0000 0.0000 Constraint 436 1052 0.8000 1.0000 2.0000 0.0000 Constraint 436 1043 0.8000 1.0000 2.0000 0.0000 Constraint 436 1038 0.8000 1.0000 2.0000 0.0000 Constraint 436 1033 0.8000 1.0000 2.0000 0.0000 Constraint 436 1025 0.8000 1.0000 2.0000 0.0000 Constraint 436 1017 0.8000 1.0000 2.0000 0.0000 Constraint 436 1012 0.8000 1.0000 2.0000 0.0000 Constraint 436 1001 0.8000 1.0000 2.0000 0.0000 Constraint 436 992 0.8000 1.0000 2.0000 0.0000 Constraint 436 986 0.8000 1.0000 2.0000 0.0000 Constraint 436 977 0.8000 1.0000 2.0000 0.0000 Constraint 436 969 0.8000 1.0000 2.0000 0.0000 Constraint 436 961 0.8000 1.0000 2.0000 0.0000 Constraint 436 955 0.8000 1.0000 2.0000 0.0000 Constraint 436 950 0.8000 1.0000 2.0000 0.0000 Constraint 436 940 0.8000 1.0000 2.0000 0.0000 Constraint 436 932 0.8000 1.0000 2.0000 0.0000 Constraint 436 927 0.8000 1.0000 2.0000 0.0000 Constraint 436 916 0.8000 1.0000 2.0000 0.0000 Constraint 436 909 0.8000 1.0000 2.0000 0.0000 Constraint 436 901 0.8000 1.0000 2.0000 0.0000 Constraint 436 887 0.8000 1.0000 2.0000 0.0000 Constraint 436 878 0.8000 1.0000 2.0000 0.0000 Constraint 436 869 0.8000 1.0000 2.0000 0.0000 Constraint 436 858 0.8000 1.0000 2.0000 0.0000 Constraint 436 849 0.8000 1.0000 2.0000 0.0000 Constraint 436 844 0.8000 1.0000 2.0000 0.0000 Constraint 436 833 0.8000 1.0000 2.0000 0.0000 Constraint 436 825 0.8000 1.0000 2.0000 0.0000 Constraint 436 809 0.8000 1.0000 2.0000 0.0000 Constraint 436 801 0.8000 1.0000 2.0000 0.0000 Constraint 436 793 0.8000 1.0000 2.0000 0.0000 Constraint 436 782 0.8000 1.0000 2.0000 0.0000 Constraint 436 771 0.8000 1.0000 2.0000 0.0000 Constraint 436 758 0.8000 1.0000 2.0000 0.0000 Constraint 436 752 0.8000 1.0000 2.0000 0.0000 Constraint 436 746 0.8000 1.0000 2.0000 0.0000 Constraint 436 738 0.8000 1.0000 2.0000 0.0000 Constraint 436 732 0.8000 1.0000 2.0000 0.0000 Constraint 436 725 0.8000 1.0000 2.0000 0.0000 Constraint 436 714 0.8000 1.0000 2.0000 0.0000 Constraint 436 707 0.8000 1.0000 2.0000 0.0000 Constraint 436 696 0.8000 1.0000 2.0000 0.0000 Constraint 436 685 0.8000 1.0000 2.0000 0.0000 Constraint 436 673 0.8000 1.0000 2.0000 0.0000 Constraint 436 664 0.8000 1.0000 2.0000 0.0000 Constraint 436 657 0.8000 1.0000 2.0000 0.0000 Constraint 436 649 0.8000 1.0000 2.0000 0.0000 Constraint 436 644 0.8000 1.0000 2.0000 0.0000 Constraint 436 634 0.8000 1.0000 2.0000 0.0000 Constraint 436 623 0.8000 1.0000 2.0000 0.0000 Constraint 436 616 0.8000 1.0000 2.0000 0.0000 Constraint 436 608 0.8000 1.0000 2.0000 0.0000 Constraint 436 600 0.8000 1.0000 2.0000 0.0000 Constraint 436 581 0.8000 1.0000 2.0000 0.0000 Constraint 436 572 0.8000 1.0000 2.0000 0.0000 Constraint 436 564 0.8000 1.0000 2.0000 0.0000 Constraint 436 555 0.8000 1.0000 2.0000 0.0000 Constraint 436 544 0.8000 1.0000 2.0000 0.0000 Constraint 436 536 0.8000 1.0000 2.0000 0.0000 Constraint 436 528 0.8000 1.0000 2.0000 0.0000 Constraint 436 523 0.8000 1.0000 2.0000 0.0000 Constraint 436 496 0.8000 1.0000 2.0000 0.0000 Constraint 436 490 0.8000 1.0000 2.0000 0.0000 Constraint 436 479 0.8000 1.0000 2.0000 0.0000 Constraint 436 471 0.8000 1.0000 2.0000 0.0000 Constraint 436 460 0.8000 1.0000 2.0000 0.0000 Constraint 436 451 0.8000 1.0000 2.0000 0.0000 Constraint 436 446 0.8000 1.0000 2.0000 0.0000 Constraint 436 441 0.8000 1.0000 2.0000 0.0000 Constraint 428 1144 0.8000 1.0000 2.0000 0.0000 Constraint 428 1135 0.8000 1.0000 2.0000 0.0000 Constraint 428 1126 0.8000 1.0000 2.0000 0.0000 Constraint 428 1115 0.8000 1.0000 2.0000 0.0000 Constraint 428 1106 0.8000 1.0000 2.0000 0.0000 Constraint 428 1101 0.8000 1.0000 2.0000 0.0000 Constraint 428 1093 0.8000 1.0000 2.0000 0.0000 Constraint 428 1082 0.8000 1.0000 2.0000 0.0000 Constraint 428 1075 0.8000 1.0000 2.0000 0.0000 Constraint 428 1067 0.8000 1.0000 2.0000 0.0000 Constraint 428 1059 0.8000 1.0000 2.0000 0.0000 Constraint 428 1052 0.8000 1.0000 2.0000 0.0000 Constraint 428 1043 0.8000 1.0000 2.0000 0.0000 Constraint 428 1038 0.8000 1.0000 2.0000 0.0000 Constraint 428 1033 0.8000 1.0000 2.0000 0.0000 Constraint 428 1025 0.8000 1.0000 2.0000 0.0000 Constraint 428 1017 0.8000 1.0000 2.0000 0.0000 Constraint 428 1012 0.8000 1.0000 2.0000 0.0000 Constraint 428 1001 0.8000 1.0000 2.0000 0.0000 Constraint 428 992 0.8000 1.0000 2.0000 0.0000 Constraint 428 986 0.8000 1.0000 2.0000 0.0000 Constraint 428 977 0.8000 1.0000 2.0000 0.0000 Constraint 428 969 0.8000 1.0000 2.0000 0.0000 Constraint 428 961 0.8000 1.0000 2.0000 0.0000 Constraint 428 955 0.8000 1.0000 2.0000 0.0000 Constraint 428 950 0.8000 1.0000 2.0000 0.0000 Constraint 428 940 0.8000 1.0000 2.0000 0.0000 Constraint 428 932 0.8000 1.0000 2.0000 0.0000 Constraint 428 927 0.8000 1.0000 2.0000 0.0000 Constraint 428 916 0.8000 1.0000 2.0000 0.0000 Constraint 428 909 0.8000 1.0000 2.0000 0.0000 Constraint 428 901 0.8000 1.0000 2.0000 0.0000 Constraint 428 887 0.8000 1.0000 2.0000 0.0000 Constraint 428 878 0.8000 1.0000 2.0000 0.0000 Constraint 428 869 0.8000 1.0000 2.0000 0.0000 Constraint 428 858 0.8000 1.0000 2.0000 0.0000 Constraint 428 849 0.8000 1.0000 2.0000 0.0000 Constraint 428 844 0.8000 1.0000 2.0000 0.0000 Constraint 428 833 0.8000 1.0000 2.0000 0.0000 Constraint 428 825 0.8000 1.0000 2.0000 0.0000 Constraint 428 801 0.8000 1.0000 2.0000 0.0000 Constraint 428 793 0.8000 1.0000 2.0000 0.0000 Constraint 428 782 0.8000 1.0000 2.0000 0.0000 Constraint 428 771 0.8000 1.0000 2.0000 0.0000 Constraint 428 758 0.8000 1.0000 2.0000 0.0000 Constraint 428 752 0.8000 1.0000 2.0000 0.0000 Constraint 428 746 0.8000 1.0000 2.0000 0.0000 Constraint 428 685 0.8000 1.0000 2.0000 0.0000 Constraint 428 673 0.8000 1.0000 2.0000 0.0000 Constraint 428 664 0.8000 1.0000 2.0000 0.0000 Constraint 428 657 0.8000 1.0000 2.0000 0.0000 Constraint 428 649 0.8000 1.0000 2.0000 0.0000 Constraint 428 644 0.8000 1.0000 2.0000 0.0000 Constraint 428 634 0.8000 1.0000 2.0000 0.0000 Constraint 428 623 0.8000 1.0000 2.0000 0.0000 Constraint 428 616 0.8000 1.0000 2.0000 0.0000 Constraint 428 608 0.8000 1.0000 2.0000 0.0000 Constraint 428 600 0.8000 1.0000 2.0000 0.0000 Constraint 428 581 0.8000 1.0000 2.0000 0.0000 Constraint 428 572 0.8000 1.0000 2.0000 0.0000 Constraint 428 564 0.8000 1.0000 2.0000 0.0000 Constraint 428 555 0.8000 1.0000 2.0000 0.0000 Constraint 428 544 0.8000 1.0000 2.0000 0.0000 Constraint 428 523 0.8000 1.0000 2.0000 0.0000 Constraint 428 518 0.8000 1.0000 2.0000 0.0000 Constraint 428 502 0.8000 1.0000 2.0000 0.0000 Constraint 428 496 0.8000 1.0000 2.0000 0.0000 Constraint 428 490 0.8000 1.0000 2.0000 0.0000 Constraint 428 479 0.8000 1.0000 2.0000 0.0000 Constraint 428 471 0.8000 1.0000 2.0000 0.0000 Constraint 428 460 0.8000 1.0000 2.0000 0.0000 Constraint 428 451 0.8000 1.0000 2.0000 0.0000 Constraint 428 446 0.8000 1.0000 2.0000 0.0000 Constraint 428 441 0.8000 1.0000 2.0000 0.0000 Constraint 428 436 0.8000 1.0000 2.0000 0.0000 Constraint 419 1144 0.8000 1.0000 2.0000 0.0000 Constraint 419 1135 0.8000 1.0000 2.0000 0.0000 Constraint 419 1126 0.8000 1.0000 2.0000 0.0000 Constraint 419 1115 0.8000 1.0000 2.0000 0.0000 Constraint 419 1106 0.8000 1.0000 2.0000 0.0000 Constraint 419 1101 0.8000 1.0000 2.0000 0.0000 Constraint 419 1093 0.8000 1.0000 2.0000 0.0000 Constraint 419 1082 0.8000 1.0000 2.0000 0.0000 Constraint 419 1075 0.8000 1.0000 2.0000 0.0000 Constraint 419 1067 0.8000 1.0000 2.0000 0.0000 Constraint 419 1059 0.8000 1.0000 2.0000 0.0000 Constraint 419 1052 0.8000 1.0000 2.0000 0.0000 Constraint 419 1043 0.8000 1.0000 2.0000 0.0000 Constraint 419 1038 0.8000 1.0000 2.0000 0.0000 Constraint 419 1033 0.8000 1.0000 2.0000 0.0000 Constraint 419 1025 0.8000 1.0000 2.0000 0.0000 Constraint 419 1017 0.8000 1.0000 2.0000 0.0000 Constraint 419 1012 0.8000 1.0000 2.0000 0.0000 Constraint 419 1001 0.8000 1.0000 2.0000 0.0000 Constraint 419 992 0.8000 1.0000 2.0000 0.0000 Constraint 419 986 0.8000 1.0000 2.0000 0.0000 Constraint 419 977 0.8000 1.0000 2.0000 0.0000 Constraint 419 969 0.8000 1.0000 2.0000 0.0000 Constraint 419 961 0.8000 1.0000 2.0000 0.0000 Constraint 419 955 0.8000 1.0000 2.0000 0.0000 Constraint 419 950 0.8000 1.0000 2.0000 0.0000 Constraint 419 940 0.8000 1.0000 2.0000 0.0000 Constraint 419 932 0.8000 1.0000 2.0000 0.0000 Constraint 419 927 0.8000 1.0000 2.0000 0.0000 Constraint 419 916 0.8000 1.0000 2.0000 0.0000 Constraint 419 909 0.8000 1.0000 2.0000 0.0000 Constraint 419 901 0.8000 1.0000 2.0000 0.0000 Constraint 419 887 0.8000 1.0000 2.0000 0.0000 Constraint 419 878 0.8000 1.0000 2.0000 0.0000 Constraint 419 869 0.8000 1.0000 2.0000 0.0000 Constraint 419 858 0.8000 1.0000 2.0000 0.0000 Constraint 419 849 0.8000 1.0000 2.0000 0.0000 Constraint 419 844 0.8000 1.0000 2.0000 0.0000 Constraint 419 833 0.8000 1.0000 2.0000 0.0000 Constraint 419 825 0.8000 1.0000 2.0000 0.0000 Constraint 419 809 0.8000 1.0000 2.0000 0.0000 Constraint 419 801 0.8000 1.0000 2.0000 0.0000 Constraint 419 793 0.8000 1.0000 2.0000 0.0000 Constraint 419 782 0.8000 1.0000 2.0000 0.0000 Constraint 419 771 0.8000 1.0000 2.0000 0.0000 Constraint 419 758 0.8000 1.0000 2.0000 0.0000 Constraint 419 752 0.8000 1.0000 2.0000 0.0000 Constraint 419 746 0.8000 1.0000 2.0000 0.0000 Constraint 419 738 0.8000 1.0000 2.0000 0.0000 Constraint 419 732 0.8000 1.0000 2.0000 0.0000 Constraint 419 714 0.8000 1.0000 2.0000 0.0000 Constraint 419 707 0.8000 1.0000 2.0000 0.0000 Constraint 419 696 0.8000 1.0000 2.0000 0.0000 Constraint 419 685 0.8000 1.0000 2.0000 0.0000 Constraint 419 673 0.8000 1.0000 2.0000 0.0000 Constraint 419 664 0.8000 1.0000 2.0000 0.0000 Constraint 419 657 0.8000 1.0000 2.0000 0.0000 Constraint 419 649 0.8000 1.0000 2.0000 0.0000 Constraint 419 644 0.8000 1.0000 2.0000 0.0000 Constraint 419 634 0.8000 1.0000 2.0000 0.0000 Constraint 419 623 0.8000 1.0000 2.0000 0.0000 Constraint 419 616 0.8000 1.0000 2.0000 0.0000 Constraint 419 608 0.8000 1.0000 2.0000 0.0000 Constraint 419 600 0.8000 1.0000 2.0000 0.0000 Constraint 419 581 0.8000 1.0000 2.0000 0.0000 Constraint 419 572 0.8000 1.0000 2.0000 0.0000 Constraint 419 564 0.8000 1.0000 2.0000 0.0000 Constraint 419 555 0.8000 1.0000 2.0000 0.0000 Constraint 419 544 0.8000 1.0000 2.0000 0.0000 Constraint 419 536 0.8000 1.0000 2.0000 0.0000 Constraint 419 528 0.8000 1.0000 2.0000 0.0000 Constraint 419 523 0.8000 1.0000 2.0000 0.0000 Constraint 419 518 0.8000 1.0000 2.0000 0.0000 Constraint 419 510 0.8000 1.0000 2.0000 0.0000 Constraint 419 502 0.8000 1.0000 2.0000 0.0000 Constraint 419 496 0.8000 1.0000 2.0000 0.0000 Constraint 419 490 0.8000 1.0000 2.0000 0.0000 Constraint 419 479 0.8000 1.0000 2.0000 0.0000 Constraint 419 471 0.8000 1.0000 2.0000 0.0000 Constraint 419 460 0.8000 1.0000 2.0000 0.0000 Constraint 419 451 0.8000 1.0000 2.0000 0.0000 Constraint 419 446 0.8000 1.0000 2.0000 0.0000 Constraint 419 441 0.8000 1.0000 2.0000 0.0000 Constraint 419 436 0.8000 1.0000 2.0000 0.0000 Constraint 419 428 0.8000 1.0000 2.0000 0.0000 Constraint 413 1144 0.8000 1.0000 2.0000 0.0000 Constraint 413 1135 0.8000 1.0000 2.0000 0.0000 Constraint 413 1126 0.8000 1.0000 2.0000 0.0000 Constraint 413 1115 0.8000 1.0000 2.0000 0.0000 Constraint 413 1106 0.8000 1.0000 2.0000 0.0000 Constraint 413 1101 0.8000 1.0000 2.0000 0.0000 Constraint 413 1093 0.8000 1.0000 2.0000 0.0000 Constraint 413 1082 0.8000 1.0000 2.0000 0.0000 Constraint 413 1075 0.8000 1.0000 2.0000 0.0000 Constraint 413 1067 0.8000 1.0000 2.0000 0.0000 Constraint 413 1059 0.8000 1.0000 2.0000 0.0000 Constraint 413 1052 0.8000 1.0000 2.0000 0.0000 Constraint 413 1043 0.8000 1.0000 2.0000 0.0000 Constraint 413 1038 0.8000 1.0000 2.0000 0.0000 Constraint 413 1033 0.8000 1.0000 2.0000 0.0000 Constraint 413 1025 0.8000 1.0000 2.0000 0.0000 Constraint 413 1017 0.8000 1.0000 2.0000 0.0000 Constraint 413 1012 0.8000 1.0000 2.0000 0.0000 Constraint 413 1001 0.8000 1.0000 2.0000 0.0000 Constraint 413 992 0.8000 1.0000 2.0000 0.0000 Constraint 413 986 0.8000 1.0000 2.0000 0.0000 Constraint 413 977 0.8000 1.0000 2.0000 0.0000 Constraint 413 969 0.8000 1.0000 2.0000 0.0000 Constraint 413 961 0.8000 1.0000 2.0000 0.0000 Constraint 413 955 0.8000 1.0000 2.0000 0.0000 Constraint 413 950 0.8000 1.0000 2.0000 0.0000 Constraint 413 940 0.8000 1.0000 2.0000 0.0000 Constraint 413 932 0.8000 1.0000 2.0000 0.0000 Constraint 413 927 0.8000 1.0000 2.0000 0.0000 Constraint 413 916 0.8000 1.0000 2.0000 0.0000 Constraint 413 909 0.8000 1.0000 2.0000 0.0000 Constraint 413 901 0.8000 1.0000 2.0000 0.0000 Constraint 413 887 0.8000 1.0000 2.0000 0.0000 Constraint 413 878 0.8000 1.0000 2.0000 0.0000 Constraint 413 869 0.8000 1.0000 2.0000 0.0000 Constraint 413 858 0.8000 1.0000 2.0000 0.0000 Constraint 413 849 0.8000 1.0000 2.0000 0.0000 Constraint 413 844 0.8000 1.0000 2.0000 0.0000 Constraint 413 833 0.8000 1.0000 2.0000 0.0000 Constraint 413 825 0.8000 1.0000 2.0000 0.0000 Constraint 413 801 0.8000 1.0000 2.0000 0.0000 Constraint 413 793 0.8000 1.0000 2.0000 0.0000 Constraint 413 782 0.8000 1.0000 2.0000 0.0000 Constraint 413 771 0.8000 1.0000 2.0000 0.0000 Constraint 413 758 0.8000 1.0000 2.0000 0.0000 Constraint 413 752 0.8000 1.0000 2.0000 0.0000 Constraint 413 746 0.8000 1.0000 2.0000 0.0000 Constraint 413 738 0.8000 1.0000 2.0000 0.0000 Constraint 413 732 0.8000 1.0000 2.0000 0.0000 Constraint 413 725 0.8000 1.0000 2.0000 0.0000 Constraint 413 714 0.8000 1.0000 2.0000 0.0000 Constraint 413 685 0.8000 1.0000 2.0000 0.0000 Constraint 413 673 0.8000 1.0000 2.0000 0.0000 Constraint 413 657 0.8000 1.0000 2.0000 0.0000 Constraint 413 649 0.8000 1.0000 2.0000 0.0000 Constraint 413 644 0.8000 1.0000 2.0000 0.0000 Constraint 413 634 0.8000 1.0000 2.0000 0.0000 Constraint 413 623 0.8000 1.0000 2.0000 0.0000 Constraint 413 616 0.8000 1.0000 2.0000 0.0000 Constraint 413 608 0.8000 1.0000 2.0000 0.0000 Constraint 413 600 0.8000 1.0000 2.0000 0.0000 Constraint 413 581 0.8000 1.0000 2.0000 0.0000 Constraint 413 572 0.8000 1.0000 2.0000 0.0000 Constraint 413 564 0.8000 1.0000 2.0000 0.0000 Constraint 413 555 0.8000 1.0000 2.0000 0.0000 Constraint 413 544 0.8000 1.0000 2.0000 0.0000 Constraint 413 536 0.8000 1.0000 2.0000 0.0000 Constraint 413 528 0.8000 1.0000 2.0000 0.0000 Constraint 413 523 0.8000 1.0000 2.0000 0.0000 Constraint 413 518 0.8000 1.0000 2.0000 0.0000 Constraint 413 502 0.8000 1.0000 2.0000 0.0000 Constraint 413 496 0.8000 1.0000 2.0000 0.0000 Constraint 413 479 0.8000 1.0000 2.0000 0.0000 Constraint 413 471 0.8000 1.0000 2.0000 0.0000 Constraint 413 460 0.8000 1.0000 2.0000 0.0000 Constraint 413 451 0.8000 1.0000 2.0000 0.0000 Constraint 413 446 0.8000 1.0000 2.0000 0.0000 Constraint 413 441 0.8000 1.0000 2.0000 0.0000 Constraint 413 436 0.8000 1.0000 2.0000 0.0000 Constraint 413 428 0.8000 1.0000 2.0000 0.0000 Constraint 413 419 0.8000 1.0000 2.0000 0.0000 Constraint 406 1144 0.8000 1.0000 2.0000 0.0000 Constraint 406 1135 0.8000 1.0000 2.0000 0.0000 Constraint 406 1126 0.8000 1.0000 2.0000 0.0000 Constraint 406 1115 0.8000 1.0000 2.0000 0.0000 Constraint 406 1106 0.8000 1.0000 2.0000 0.0000 Constraint 406 1101 0.8000 1.0000 2.0000 0.0000 Constraint 406 1093 0.8000 1.0000 2.0000 0.0000 Constraint 406 1082 0.8000 1.0000 2.0000 0.0000 Constraint 406 1075 0.8000 1.0000 2.0000 0.0000 Constraint 406 1067 0.8000 1.0000 2.0000 0.0000 Constraint 406 1059 0.8000 1.0000 2.0000 0.0000 Constraint 406 1052 0.8000 1.0000 2.0000 0.0000 Constraint 406 1043 0.8000 1.0000 2.0000 0.0000 Constraint 406 1038 0.8000 1.0000 2.0000 0.0000 Constraint 406 1033 0.8000 1.0000 2.0000 0.0000 Constraint 406 1025 0.8000 1.0000 2.0000 0.0000 Constraint 406 1017 0.8000 1.0000 2.0000 0.0000 Constraint 406 1012 0.8000 1.0000 2.0000 0.0000 Constraint 406 1001 0.8000 1.0000 2.0000 0.0000 Constraint 406 992 0.8000 1.0000 2.0000 0.0000 Constraint 406 986 0.8000 1.0000 2.0000 0.0000 Constraint 406 977 0.8000 1.0000 2.0000 0.0000 Constraint 406 969 0.8000 1.0000 2.0000 0.0000 Constraint 406 961 0.8000 1.0000 2.0000 0.0000 Constraint 406 955 0.8000 1.0000 2.0000 0.0000 Constraint 406 950 0.8000 1.0000 2.0000 0.0000 Constraint 406 940 0.8000 1.0000 2.0000 0.0000 Constraint 406 932 0.8000 1.0000 2.0000 0.0000 Constraint 406 927 0.8000 1.0000 2.0000 0.0000 Constraint 406 916 0.8000 1.0000 2.0000 0.0000 Constraint 406 909 0.8000 1.0000 2.0000 0.0000 Constraint 406 901 0.8000 1.0000 2.0000 0.0000 Constraint 406 887 0.8000 1.0000 2.0000 0.0000 Constraint 406 878 0.8000 1.0000 2.0000 0.0000 Constraint 406 869 0.8000 1.0000 2.0000 0.0000 Constraint 406 858 0.8000 1.0000 2.0000 0.0000 Constraint 406 849 0.8000 1.0000 2.0000 0.0000 Constraint 406 844 0.8000 1.0000 2.0000 0.0000 Constraint 406 825 0.8000 1.0000 2.0000 0.0000 Constraint 406 801 0.8000 1.0000 2.0000 0.0000 Constraint 406 782 0.8000 1.0000 2.0000 0.0000 Constraint 406 771 0.8000 1.0000 2.0000 0.0000 Constraint 406 758 0.8000 1.0000 2.0000 0.0000 Constraint 406 752 0.8000 1.0000 2.0000 0.0000 Constraint 406 746 0.8000 1.0000 2.0000 0.0000 Constraint 406 644 0.8000 1.0000 2.0000 0.0000 Constraint 406 634 0.8000 1.0000 2.0000 0.0000 Constraint 406 616 0.8000 1.0000 2.0000 0.0000 Constraint 406 608 0.8000 1.0000 2.0000 0.0000 Constraint 406 600 0.8000 1.0000 2.0000 0.0000 Constraint 406 581 0.8000 1.0000 2.0000 0.0000 Constraint 406 572 0.8000 1.0000 2.0000 0.0000 Constraint 406 564 0.8000 1.0000 2.0000 0.0000 Constraint 406 555 0.8000 1.0000 2.0000 0.0000 Constraint 406 544 0.8000 1.0000 2.0000 0.0000 Constraint 406 528 0.8000 1.0000 2.0000 0.0000 Constraint 406 523 0.8000 1.0000 2.0000 0.0000 Constraint 406 502 0.8000 1.0000 2.0000 0.0000 Constraint 406 479 0.8000 1.0000 2.0000 0.0000 Constraint 406 460 0.8000 1.0000 2.0000 0.0000 Constraint 406 451 0.8000 1.0000 2.0000 0.0000 Constraint 406 446 0.8000 1.0000 2.0000 0.0000 Constraint 406 441 0.8000 1.0000 2.0000 0.0000 Constraint 406 436 0.8000 1.0000 2.0000 0.0000 Constraint 406 428 0.8000 1.0000 2.0000 0.0000 Constraint 406 419 0.8000 1.0000 2.0000 0.0000 Constraint 406 413 0.8000 1.0000 2.0000 0.0000 Constraint 399 1144 0.8000 1.0000 2.0000 0.0000 Constraint 399 1135 0.8000 1.0000 2.0000 0.0000 Constraint 399 1126 0.8000 1.0000 2.0000 0.0000 Constraint 399 1115 0.8000 1.0000 2.0000 0.0000 Constraint 399 1106 0.8000 1.0000 2.0000 0.0000 Constraint 399 1101 0.8000 1.0000 2.0000 0.0000 Constraint 399 1093 0.8000 1.0000 2.0000 0.0000 Constraint 399 1082 0.8000 1.0000 2.0000 0.0000 Constraint 399 1075 0.8000 1.0000 2.0000 0.0000 Constraint 399 1067 0.8000 1.0000 2.0000 0.0000 Constraint 399 1059 0.8000 1.0000 2.0000 0.0000 Constraint 399 1052 0.8000 1.0000 2.0000 0.0000 Constraint 399 1043 0.8000 1.0000 2.0000 0.0000 Constraint 399 1038 0.8000 1.0000 2.0000 0.0000 Constraint 399 1033 0.8000 1.0000 2.0000 0.0000 Constraint 399 1025 0.8000 1.0000 2.0000 0.0000 Constraint 399 1017 0.8000 1.0000 2.0000 0.0000 Constraint 399 1012 0.8000 1.0000 2.0000 0.0000 Constraint 399 1001 0.8000 1.0000 2.0000 0.0000 Constraint 399 992 0.8000 1.0000 2.0000 0.0000 Constraint 399 986 0.8000 1.0000 2.0000 0.0000 Constraint 399 977 0.8000 1.0000 2.0000 0.0000 Constraint 399 969 0.8000 1.0000 2.0000 0.0000 Constraint 399 961 0.8000 1.0000 2.0000 0.0000 Constraint 399 955 0.8000 1.0000 2.0000 0.0000 Constraint 399 950 0.8000 1.0000 2.0000 0.0000 Constraint 399 940 0.8000 1.0000 2.0000 0.0000 Constraint 399 932 0.8000 1.0000 2.0000 0.0000 Constraint 399 927 0.8000 1.0000 2.0000 0.0000 Constraint 399 916 0.8000 1.0000 2.0000 0.0000 Constraint 399 909 0.8000 1.0000 2.0000 0.0000 Constraint 399 901 0.8000 1.0000 2.0000 0.0000 Constraint 399 887 0.8000 1.0000 2.0000 0.0000 Constraint 399 878 0.8000 1.0000 2.0000 0.0000 Constraint 399 869 0.8000 1.0000 2.0000 0.0000 Constraint 399 858 0.8000 1.0000 2.0000 0.0000 Constraint 399 849 0.8000 1.0000 2.0000 0.0000 Constraint 399 844 0.8000 1.0000 2.0000 0.0000 Constraint 399 771 0.8000 1.0000 2.0000 0.0000 Constraint 399 758 0.8000 1.0000 2.0000 0.0000 Constraint 399 752 0.8000 1.0000 2.0000 0.0000 Constraint 399 746 0.8000 1.0000 2.0000 0.0000 Constraint 399 634 0.8000 1.0000 2.0000 0.0000 Constraint 399 616 0.8000 1.0000 2.0000 0.0000 Constraint 399 608 0.8000 1.0000 2.0000 0.0000 Constraint 399 600 0.8000 1.0000 2.0000 0.0000 Constraint 399 581 0.8000 1.0000 2.0000 0.0000 Constraint 399 572 0.8000 1.0000 2.0000 0.0000 Constraint 399 564 0.8000 1.0000 2.0000 0.0000 Constraint 399 555 0.8000 1.0000 2.0000 0.0000 Constraint 399 544 0.8000 1.0000 2.0000 0.0000 Constraint 399 528 0.8000 1.0000 2.0000 0.0000 Constraint 399 523 0.8000 1.0000 2.0000 0.0000 Constraint 399 518 0.8000 1.0000 2.0000 0.0000 Constraint 399 502 0.8000 1.0000 2.0000 0.0000 Constraint 399 496 0.8000 1.0000 2.0000 0.0000 Constraint 399 490 0.8000 1.0000 2.0000 0.0000 Constraint 399 479 0.8000 1.0000 2.0000 0.0000 Constraint 399 471 0.8000 1.0000 2.0000 0.0000 Constraint 399 460 0.8000 1.0000 2.0000 0.0000 Constraint 399 451 0.8000 1.0000 2.0000 0.0000 Constraint 399 446 0.8000 1.0000 2.0000 0.0000 Constraint 399 441 0.8000 1.0000 2.0000 0.0000 Constraint 399 436 0.8000 1.0000 2.0000 0.0000 Constraint 399 428 0.8000 1.0000 2.0000 0.0000 Constraint 399 419 0.8000 1.0000 2.0000 0.0000 Constraint 399 413 0.8000 1.0000 2.0000 0.0000 Constraint 399 406 0.8000 1.0000 2.0000 0.0000 Constraint 392 1144 0.8000 1.0000 2.0000 0.0000 Constraint 392 1135 0.8000 1.0000 2.0000 0.0000 Constraint 392 1126 0.8000 1.0000 2.0000 0.0000 Constraint 392 1115 0.8000 1.0000 2.0000 0.0000 Constraint 392 1106 0.8000 1.0000 2.0000 0.0000 Constraint 392 1101 0.8000 1.0000 2.0000 0.0000 Constraint 392 1093 0.8000 1.0000 2.0000 0.0000 Constraint 392 1082 0.8000 1.0000 2.0000 0.0000 Constraint 392 1075 0.8000 1.0000 2.0000 0.0000 Constraint 392 1067 0.8000 1.0000 2.0000 0.0000 Constraint 392 1059 0.8000 1.0000 2.0000 0.0000 Constraint 392 1052 0.8000 1.0000 2.0000 0.0000 Constraint 392 1043 0.8000 1.0000 2.0000 0.0000 Constraint 392 1038 0.8000 1.0000 2.0000 0.0000 Constraint 392 1033 0.8000 1.0000 2.0000 0.0000 Constraint 392 1025 0.8000 1.0000 2.0000 0.0000 Constraint 392 1017 0.8000 1.0000 2.0000 0.0000 Constraint 392 1012 0.8000 1.0000 2.0000 0.0000 Constraint 392 1001 0.8000 1.0000 2.0000 0.0000 Constraint 392 992 0.8000 1.0000 2.0000 0.0000 Constraint 392 986 0.8000 1.0000 2.0000 0.0000 Constraint 392 977 0.8000 1.0000 2.0000 0.0000 Constraint 392 969 0.8000 1.0000 2.0000 0.0000 Constraint 392 961 0.8000 1.0000 2.0000 0.0000 Constraint 392 955 0.8000 1.0000 2.0000 0.0000 Constraint 392 950 0.8000 1.0000 2.0000 0.0000 Constraint 392 940 0.8000 1.0000 2.0000 0.0000 Constraint 392 932 0.8000 1.0000 2.0000 0.0000 Constraint 392 927 0.8000 1.0000 2.0000 0.0000 Constraint 392 916 0.8000 1.0000 2.0000 0.0000 Constraint 392 909 0.8000 1.0000 2.0000 0.0000 Constraint 392 901 0.8000 1.0000 2.0000 0.0000 Constraint 392 887 0.8000 1.0000 2.0000 0.0000 Constraint 392 878 0.8000 1.0000 2.0000 0.0000 Constraint 392 869 0.8000 1.0000 2.0000 0.0000 Constraint 392 858 0.8000 1.0000 2.0000 0.0000 Constraint 392 849 0.8000 1.0000 2.0000 0.0000 Constraint 392 844 0.8000 1.0000 2.0000 0.0000 Constraint 392 793 0.8000 1.0000 2.0000 0.0000 Constraint 392 782 0.8000 1.0000 2.0000 0.0000 Constraint 392 771 0.8000 1.0000 2.0000 0.0000 Constraint 392 758 0.8000 1.0000 2.0000 0.0000 Constraint 392 752 0.8000 1.0000 2.0000 0.0000 Constraint 392 746 0.8000 1.0000 2.0000 0.0000 Constraint 392 673 0.8000 1.0000 2.0000 0.0000 Constraint 392 644 0.8000 1.0000 2.0000 0.0000 Constraint 392 634 0.8000 1.0000 2.0000 0.0000 Constraint 392 616 0.8000 1.0000 2.0000 0.0000 Constraint 392 608 0.8000 1.0000 2.0000 0.0000 Constraint 392 600 0.8000 1.0000 2.0000 0.0000 Constraint 392 581 0.8000 1.0000 2.0000 0.0000 Constraint 392 572 0.8000 1.0000 2.0000 0.0000 Constraint 392 564 0.8000 1.0000 2.0000 0.0000 Constraint 392 555 0.8000 1.0000 2.0000 0.0000 Constraint 392 544 0.8000 1.0000 2.0000 0.0000 Constraint 392 536 0.8000 1.0000 2.0000 0.0000 Constraint 392 528 0.8000 1.0000 2.0000 0.0000 Constraint 392 523 0.8000 1.0000 2.0000 0.0000 Constraint 392 518 0.8000 1.0000 2.0000 0.0000 Constraint 392 502 0.8000 1.0000 2.0000 0.0000 Constraint 392 496 0.8000 1.0000 2.0000 0.0000 Constraint 392 490 0.8000 1.0000 2.0000 0.0000 Constraint 392 479 0.8000 1.0000 2.0000 0.0000 Constraint 392 471 0.8000 1.0000 2.0000 0.0000 Constraint 392 460 0.8000 1.0000 2.0000 0.0000 Constraint 392 451 0.8000 1.0000 2.0000 0.0000 Constraint 392 446 0.8000 1.0000 2.0000 0.0000 Constraint 392 441 0.8000 1.0000 2.0000 0.0000 Constraint 392 436 0.8000 1.0000 2.0000 0.0000 Constraint 392 428 0.8000 1.0000 2.0000 0.0000 Constraint 392 419 0.8000 1.0000 2.0000 0.0000 Constraint 392 413 0.8000 1.0000 2.0000 0.0000 Constraint 392 406 0.8000 1.0000 2.0000 0.0000 Constraint 392 399 0.8000 1.0000 2.0000 0.0000 Constraint 384 1144 0.8000 1.0000 2.0000 0.0000 Constraint 384 1135 0.8000 1.0000 2.0000 0.0000 Constraint 384 1126 0.8000 1.0000 2.0000 0.0000 Constraint 384 1115 0.8000 1.0000 2.0000 0.0000 Constraint 384 1106 0.8000 1.0000 2.0000 0.0000 Constraint 384 1101 0.8000 1.0000 2.0000 0.0000 Constraint 384 1093 0.8000 1.0000 2.0000 0.0000 Constraint 384 1082 0.8000 1.0000 2.0000 0.0000 Constraint 384 1075 0.8000 1.0000 2.0000 0.0000 Constraint 384 1067 0.8000 1.0000 2.0000 0.0000 Constraint 384 1059 0.8000 1.0000 2.0000 0.0000 Constraint 384 1052 0.8000 1.0000 2.0000 0.0000 Constraint 384 1043 0.8000 1.0000 2.0000 0.0000 Constraint 384 1038 0.8000 1.0000 2.0000 0.0000 Constraint 384 1033 0.8000 1.0000 2.0000 0.0000 Constraint 384 1025 0.8000 1.0000 2.0000 0.0000 Constraint 384 1017 0.8000 1.0000 2.0000 0.0000 Constraint 384 1012 0.8000 1.0000 2.0000 0.0000 Constraint 384 1001 0.8000 1.0000 2.0000 0.0000 Constraint 384 992 0.8000 1.0000 2.0000 0.0000 Constraint 384 986 0.8000 1.0000 2.0000 0.0000 Constraint 384 977 0.8000 1.0000 2.0000 0.0000 Constraint 384 969 0.8000 1.0000 2.0000 0.0000 Constraint 384 961 0.8000 1.0000 2.0000 0.0000 Constraint 384 955 0.8000 1.0000 2.0000 0.0000 Constraint 384 950 0.8000 1.0000 2.0000 0.0000 Constraint 384 940 0.8000 1.0000 2.0000 0.0000 Constraint 384 932 0.8000 1.0000 2.0000 0.0000 Constraint 384 927 0.8000 1.0000 2.0000 0.0000 Constraint 384 916 0.8000 1.0000 2.0000 0.0000 Constraint 384 909 0.8000 1.0000 2.0000 0.0000 Constraint 384 901 0.8000 1.0000 2.0000 0.0000 Constraint 384 887 0.8000 1.0000 2.0000 0.0000 Constraint 384 878 0.8000 1.0000 2.0000 0.0000 Constraint 384 869 0.8000 1.0000 2.0000 0.0000 Constraint 384 858 0.8000 1.0000 2.0000 0.0000 Constraint 384 849 0.8000 1.0000 2.0000 0.0000 Constraint 384 793 0.8000 1.0000 2.0000 0.0000 Constraint 384 782 0.8000 1.0000 2.0000 0.0000 Constraint 384 758 0.8000 1.0000 2.0000 0.0000 Constraint 384 616 0.8000 1.0000 2.0000 0.0000 Constraint 384 608 0.8000 1.0000 2.0000 0.0000 Constraint 384 600 0.8000 1.0000 2.0000 0.0000 Constraint 384 581 0.8000 1.0000 2.0000 0.0000 Constraint 384 572 0.8000 1.0000 2.0000 0.0000 Constraint 384 564 0.8000 1.0000 2.0000 0.0000 Constraint 384 555 0.8000 1.0000 2.0000 0.0000 Constraint 384 544 0.8000 1.0000 2.0000 0.0000 Constraint 384 536 0.8000 1.0000 2.0000 0.0000 Constraint 384 528 0.8000 1.0000 2.0000 0.0000 Constraint 384 523 0.8000 1.0000 2.0000 0.0000 Constraint 384 518 0.8000 1.0000 2.0000 0.0000 Constraint 384 510 0.8000 1.0000 2.0000 0.0000 Constraint 384 502 0.8000 1.0000 2.0000 0.0000 Constraint 384 496 0.8000 1.0000 2.0000 0.0000 Constraint 384 490 0.8000 1.0000 2.0000 0.0000 Constraint 384 479 0.8000 1.0000 2.0000 0.0000 Constraint 384 471 0.8000 1.0000 2.0000 0.0000 Constraint 384 460 0.8000 1.0000 2.0000 0.0000 Constraint 384 451 0.8000 1.0000 2.0000 0.0000 Constraint 384 441 0.8000 1.0000 2.0000 0.0000 Constraint 384 436 0.8000 1.0000 2.0000 0.0000 Constraint 384 428 0.8000 1.0000 2.0000 0.0000 Constraint 384 419 0.8000 1.0000 2.0000 0.0000 Constraint 384 413 0.8000 1.0000 2.0000 0.0000 Constraint 384 406 0.8000 1.0000 2.0000 0.0000 Constraint 384 399 0.8000 1.0000 2.0000 0.0000 Constraint 384 392 0.8000 1.0000 2.0000 0.0000 Constraint 368 1144 0.8000 1.0000 2.0000 0.0000 Constraint 368 1135 0.8000 1.0000 2.0000 0.0000 Constraint 368 1126 0.8000 1.0000 2.0000 0.0000 Constraint 368 1115 0.8000 1.0000 2.0000 0.0000 Constraint 368 1106 0.8000 1.0000 2.0000 0.0000 Constraint 368 1101 0.8000 1.0000 2.0000 0.0000 Constraint 368 1093 0.8000 1.0000 2.0000 0.0000 Constraint 368 1082 0.8000 1.0000 2.0000 0.0000 Constraint 368 1075 0.8000 1.0000 2.0000 0.0000 Constraint 368 1067 0.8000 1.0000 2.0000 0.0000 Constraint 368 1059 0.8000 1.0000 2.0000 0.0000 Constraint 368 1052 0.8000 1.0000 2.0000 0.0000 Constraint 368 1043 0.8000 1.0000 2.0000 0.0000 Constraint 368 1038 0.8000 1.0000 2.0000 0.0000 Constraint 368 1033 0.8000 1.0000 2.0000 0.0000 Constraint 368 1025 0.8000 1.0000 2.0000 0.0000 Constraint 368 1017 0.8000 1.0000 2.0000 0.0000 Constraint 368 1012 0.8000 1.0000 2.0000 0.0000 Constraint 368 1001 0.8000 1.0000 2.0000 0.0000 Constraint 368 992 0.8000 1.0000 2.0000 0.0000 Constraint 368 986 0.8000 1.0000 2.0000 0.0000 Constraint 368 977 0.8000 1.0000 2.0000 0.0000 Constraint 368 969 0.8000 1.0000 2.0000 0.0000 Constraint 368 961 0.8000 1.0000 2.0000 0.0000 Constraint 368 955 0.8000 1.0000 2.0000 0.0000 Constraint 368 950 0.8000 1.0000 2.0000 0.0000 Constraint 368 940 0.8000 1.0000 2.0000 0.0000 Constraint 368 932 0.8000 1.0000 2.0000 0.0000 Constraint 368 927 0.8000 1.0000 2.0000 0.0000 Constraint 368 916 0.8000 1.0000 2.0000 0.0000 Constraint 368 909 0.8000 1.0000 2.0000 0.0000 Constraint 368 901 0.8000 1.0000 2.0000 0.0000 Constraint 368 887 0.8000 1.0000 2.0000 0.0000 Constraint 368 878 0.8000 1.0000 2.0000 0.0000 Constraint 368 869 0.8000 1.0000 2.0000 0.0000 Constraint 368 858 0.8000 1.0000 2.0000 0.0000 Constraint 368 849 0.8000 1.0000 2.0000 0.0000 Constraint 368 844 0.8000 1.0000 2.0000 0.0000 Constraint 368 793 0.8000 1.0000 2.0000 0.0000 Constraint 368 752 0.8000 1.0000 2.0000 0.0000 Constraint 368 746 0.8000 1.0000 2.0000 0.0000 Constraint 368 696 0.8000 1.0000 2.0000 0.0000 Constraint 368 685 0.8000 1.0000 2.0000 0.0000 Constraint 368 673 0.8000 1.0000 2.0000 0.0000 Constraint 368 664 0.8000 1.0000 2.0000 0.0000 Constraint 368 657 0.8000 1.0000 2.0000 0.0000 Constraint 368 649 0.8000 1.0000 2.0000 0.0000 Constraint 368 644 0.8000 1.0000 2.0000 0.0000 Constraint 368 634 0.8000 1.0000 2.0000 0.0000 Constraint 368 623 0.8000 1.0000 2.0000 0.0000 Constraint 368 616 0.8000 1.0000 2.0000 0.0000 Constraint 368 600 0.8000 1.0000 2.0000 0.0000 Constraint 368 581 0.8000 1.0000 2.0000 0.0000 Constraint 368 572 0.8000 1.0000 2.0000 0.0000 Constraint 368 555 0.8000 1.0000 2.0000 0.0000 Constraint 368 544 0.8000 1.0000 2.0000 0.0000 Constraint 368 523 0.8000 1.0000 2.0000 0.0000 Constraint 368 518 0.8000 1.0000 2.0000 0.0000 Constraint 368 502 0.8000 1.0000 2.0000 0.0000 Constraint 368 496 0.8000 1.0000 2.0000 0.0000 Constraint 368 490 0.8000 1.0000 2.0000 0.0000 Constraint 368 479 0.8000 1.0000 2.0000 0.0000 Constraint 368 471 0.8000 1.0000 2.0000 0.0000 Constraint 368 460 0.8000 1.0000 2.0000 0.0000 Constraint 368 441 0.8000 1.0000 2.0000 0.0000 Constraint 368 436 0.8000 1.0000 2.0000 0.0000 Constraint 368 419 0.8000 1.0000 2.0000 0.0000 Constraint 368 413 0.8000 1.0000 2.0000 0.0000 Constraint 368 406 0.8000 1.0000 2.0000 0.0000 Constraint 368 399 0.8000 1.0000 2.0000 0.0000 Constraint 368 392 0.8000 1.0000 2.0000 0.0000 Constraint 368 384 0.8000 1.0000 2.0000 0.0000 Constraint 357 1135 0.8000 1.0000 2.0000 0.0000 Constraint 357 1126 0.8000 1.0000 2.0000 0.0000 Constraint 357 1106 0.8000 1.0000 2.0000 0.0000 Constraint 357 1101 0.8000 1.0000 2.0000 0.0000 Constraint 357 1093 0.8000 1.0000 2.0000 0.0000 Constraint 357 1082 0.8000 1.0000 2.0000 0.0000 Constraint 357 1075 0.8000 1.0000 2.0000 0.0000 Constraint 357 1067 0.8000 1.0000 2.0000 0.0000 Constraint 357 1059 0.8000 1.0000 2.0000 0.0000 Constraint 357 1052 0.8000 1.0000 2.0000 0.0000 Constraint 357 1043 0.8000 1.0000 2.0000 0.0000 Constraint 357 1038 0.8000 1.0000 2.0000 0.0000 Constraint 357 1025 0.8000 1.0000 2.0000 0.0000 Constraint 357 1017 0.8000 1.0000 2.0000 0.0000 Constraint 357 992 0.8000 1.0000 2.0000 0.0000 Constraint 357 977 0.8000 1.0000 2.0000 0.0000 Constraint 357 969 0.8000 1.0000 2.0000 0.0000 Constraint 357 961 0.8000 1.0000 2.0000 0.0000 Constraint 357 955 0.8000 1.0000 2.0000 0.0000 Constraint 357 950 0.8000 1.0000 2.0000 0.0000 Constraint 357 940 0.8000 1.0000 2.0000 0.0000 Constraint 357 932 0.8000 1.0000 2.0000 0.0000 Constraint 357 927 0.8000 1.0000 2.0000 0.0000 Constraint 357 916 0.8000 1.0000 2.0000 0.0000 Constraint 357 909 0.8000 1.0000 2.0000 0.0000 Constraint 357 901 0.8000 1.0000 2.0000 0.0000 Constraint 357 887 0.8000 1.0000 2.0000 0.0000 Constraint 357 878 0.8000 1.0000 2.0000 0.0000 Constraint 357 869 0.8000 1.0000 2.0000 0.0000 Constraint 357 858 0.8000 1.0000 2.0000 0.0000 Constraint 357 849 0.8000 1.0000 2.0000 0.0000 Constraint 357 844 0.8000 1.0000 2.0000 0.0000 Constraint 357 825 0.8000 1.0000 2.0000 0.0000 Constraint 357 809 0.8000 1.0000 2.0000 0.0000 Constraint 357 793 0.8000 1.0000 2.0000 0.0000 Constraint 357 782 0.8000 1.0000 2.0000 0.0000 Constraint 357 758 0.8000 1.0000 2.0000 0.0000 Constraint 357 752 0.8000 1.0000 2.0000 0.0000 Constraint 357 746 0.8000 1.0000 2.0000 0.0000 Constraint 357 714 0.8000 1.0000 2.0000 0.0000 Constraint 357 707 0.8000 1.0000 2.0000 0.0000 Constraint 357 696 0.8000 1.0000 2.0000 0.0000 Constraint 357 685 0.8000 1.0000 2.0000 0.0000 Constraint 357 673 0.8000 1.0000 2.0000 0.0000 Constraint 357 664 0.8000 1.0000 2.0000 0.0000 Constraint 357 657 0.8000 1.0000 2.0000 0.0000 Constraint 357 649 0.8000 1.0000 2.0000 0.0000 Constraint 357 644 0.8000 1.0000 2.0000 0.0000 Constraint 357 634 0.8000 1.0000 2.0000 0.0000 Constraint 357 623 0.8000 1.0000 2.0000 0.0000 Constraint 357 616 0.8000 1.0000 2.0000 0.0000 Constraint 357 600 0.8000 1.0000 2.0000 0.0000 Constraint 357 581 0.8000 1.0000 2.0000 0.0000 Constraint 357 572 0.8000 1.0000 2.0000 0.0000 Constraint 357 564 0.8000 1.0000 2.0000 0.0000 Constraint 357 555 0.8000 1.0000 2.0000 0.0000 Constraint 357 544 0.8000 1.0000 2.0000 0.0000 Constraint 357 536 0.8000 1.0000 2.0000 0.0000 Constraint 357 528 0.8000 1.0000 2.0000 0.0000 Constraint 357 523 0.8000 1.0000 2.0000 0.0000 Constraint 357 518 0.8000 1.0000 2.0000 0.0000 Constraint 357 510 0.8000 1.0000 2.0000 0.0000 Constraint 357 502 0.8000 1.0000 2.0000 0.0000 Constraint 357 496 0.8000 1.0000 2.0000 0.0000 Constraint 357 490 0.8000 1.0000 2.0000 0.0000 Constraint 357 479 0.8000 1.0000 2.0000 0.0000 Constraint 357 471 0.8000 1.0000 2.0000 0.0000 Constraint 357 441 0.8000 1.0000 2.0000 0.0000 Constraint 357 436 0.8000 1.0000 2.0000 0.0000 Constraint 357 413 0.8000 1.0000 2.0000 0.0000 Constraint 357 406 0.8000 1.0000 2.0000 0.0000 Constraint 357 399 0.8000 1.0000 2.0000 0.0000 Constraint 357 392 0.8000 1.0000 2.0000 0.0000 Constraint 357 384 0.8000 1.0000 2.0000 0.0000 Constraint 357 368 0.8000 1.0000 2.0000 0.0000 Constraint 349 1144 0.8000 1.0000 2.0000 0.0000 Constraint 349 1135 0.8000 1.0000 2.0000 0.0000 Constraint 349 1126 0.8000 1.0000 2.0000 0.0000 Constraint 349 1115 0.8000 1.0000 2.0000 0.0000 Constraint 349 1106 0.8000 1.0000 2.0000 0.0000 Constraint 349 1101 0.8000 1.0000 2.0000 0.0000 Constraint 349 1093 0.8000 1.0000 2.0000 0.0000 Constraint 349 1082 0.8000 1.0000 2.0000 0.0000 Constraint 349 1075 0.8000 1.0000 2.0000 0.0000 Constraint 349 1067 0.8000 1.0000 2.0000 0.0000 Constraint 349 1059 0.8000 1.0000 2.0000 0.0000 Constraint 349 1052 0.8000 1.0000 2.0000 0.0000 Constraint 349 1043 0.8000 1.0000 2.0000 0.0000 Constraint 349 1038 0.8000 1.0000 2.0000 0.0000 Constraint 349 1033 0.8000 1.0000 2.0000 0.0000 Constraint 349 1025 0.8000 1.0000 2.0000 0.0000 Constraint 349 1017 0.8000 1.0000 2.0000 0.0000 Constraint 349 1012 0.8000 1.0000 2.0000 0.0000 Constraint 349 992 0.8000 1.0000 2.0000 0.0000 Constraint 349 986 0.8000 1.0000 2.0000 0.0000 Constraint 349 977 0.8000 1.0000 2.0000 0.0000 Constraint 349 969 0.8000 1.0000 2.0000 0.0000 Constraint 349 961 0.8000 1.0000 2.0000 0.0000 Constraint 349 955 0.8000 1.0000 2.0000 0.0000 Constraint 349 950 0.8000 1.0000 2.0000 0.0000 Constraint 349 940 0.8000 1.0000 2.0000 0.0000 Constraint 349 932 0.8000 1.0000 2.0000 0.0000 Constraint 349 927 0.8000 1.0000 2.0000 0.0000 Constraint 349 916 0.8000 1.0000 2.0000 0.0000 Constraint 349 887 0.8000 1.0000 2.0000 0.0000 Constraint 349 707 0.8000 1.0000 2.0000 0.0000 Constraint 349 696 0.8000 1.0000 2.0000 0.0000 Constraint 349 685 0.8000 1.0000 2.0000 0.0000 Constraint 349 673 0.8000 1.0000 2.0000 0.0000 Constraint 349 664 0.8000 1.0000 2.0000 0.0000 Constraint 349 657 0.8000 1.0000 2.0000 0.0000 Constraint 349 649 0.8000 1.0000 2.0000 0.0000 Constraint 349 644 0.8000 1.0000 2.0000 0.0000 Constraint 349 634 0.8000 1.0000 2.0000 0.0000 Constraint 349 623 0.8000 1.0000 2.0000 0.0000 Constraint 349 616 0.8000 1.0000 2.0000 0.0000 Constraint 349 581 0.8000 1.0000 2.0000 0.0000 Constraint 349 572 0.8000 1.0000 2.0000 0.0000 Constraint 349 555 0.8000 1.0000 2.0000 0.0000 Constraint 349 544 0.8000 1.0000 2.0000 0.0000 Constraint 349 536 0.8000 1.0000 2.0000 0.0000 Constraint 349 528 0.8000 1.0000 2.0000 0.0000 Constraint 349 523 0.8000 1.0000 2.0000 0.0000 Constraint 349 518 0.8000 1.0000 2.0000 0.0000 Constraint 349 510 0.8000 1.0000 2.0000 0.0000 Constraint 349 502 0.8000 1.0000 2.0000 0.0000 Constraint 349 496 0.8000 1.0000 2.0000 0.0000 Constraint 349 490 0.8000 1.0000 2.0000 0.0000 Constraint 349 479 0.8000 1.0000 2.0000 0.0000 Constraint 349 471 0.8000 1.0000 2.0000 0.0000 Constraint 349 460 0.8000 1.0000 2.0000 0.0000 Constraint 349 441 0.8000 1.0000 2.0000 0.0000 Constraint 349 436 0.8000 1.0000 2.0000 0.0000 Constraint 349 413 0.8000 1.0000 2.0000 0.0000 Constraint 349 406 0.8000 1.0000 2.0000 0.0000 Constraint 349 399 0.8000 1.0000 2.0000 0.0000 Constraint 349 392 0.8000 1.0000 2.0000 0.0000 Constraint 349 384 0.8000 1.0000 2.0000 0.0000 Constraint 349 368 0.8000 1.0000 2.0000 0.0000 Constraint 349 357 0.8000 1.0000 2.0000 0.0000 Constraint 341 1144 0.8000 1.0000 2.0000 0.0000 Constraint 341 1135 0.8000 1.0000 2.0000 0.0000 Constraint 341 1126 0.8000 1.0000 2.0000 0.0000 Constraint 341 1115 0.8000 1.0000 2.0000 0.0000 Constraint 341 1106 0.8000 1.0000 2.0000 0.0000 Constraint 341 1101 0.8000 1.0000 2.0000 0.0000 Constraint 341 1093 0.8000 1.0000 2.0000 0.0000 Constraint 341 1082 0.8000 1.0000 2.0000 0.0000 Constraint 341 1075 0.8000 1.0000 2.0000 0.0000 Constraint 341 1067 0.8000 1.0000 2.0000 0.0000 Constraint 341 1059 0.8000 1.0000 2.0000 0.0000 Constraint 341 1052 0.8000 1.0000 2.0000 0.0000 Constraint 341 1043 0.8000 1.0000 2.0000 0.0000 Constraint 341 1038 0.8000 1.0000 2.0000 0.0000 Constraint 341 1033 0.8000 1.0000 2.0000 0.0000 Constraint 341 1025 0.8000 1.0000 2.0000 0.0000 Constraint 341 1017 0.8000 1.0000 2.0000 0.0000 Constraint 341 1012 0.8000 1.0000 2.0000 0.0000 Constraint 341 1001 0.8000 1.0000 2.0000 0.0000 Constraint 341 992 0.8000 1.0000 2.0000 0.0000 Constraint 341 986 0.8000 1.0000 2.0000 0.0000 Constraint 341 977 0.8000 1.0000 2.0000 0.0000 Constraint 341 969 0.8000 1.0000 2.0000 0.0000 Constraint 341 961 0.8000 1.0000 2.0000 0.0000 Constraint 341 955 0.8000 1.0000 2.0000 0.0000 Constraint 341 950 0.8000 1.0000 2.0000 0.0000 Constraint 341 940 0.8000 1.0000 2.0000 0.0000 Constraint 341 932 0.8000 1.0000 2.0000 0.0000 Constraint 341 927 0.8000 1.0000 2.0000 0.0000 Constraint 341 916 0.8000 1.0000 2.0000 0.0000 Constraint 341 909 0.8000 1.0000 2.0000 0.0000 Constraint 341 901 0.8000 1.0000 2.0000 0.0000 Constraint 341 887 0.8000 1.0000 2.0000 0.0000 Constraint 341 878 0.8000 1.0000 2.0000 0.0000 Constraint 341 869 0.8000 1.0000 2.0000 0.0000 Constraint 341 782 0.8000 1.0000 2.0000 0.0000 Constraint 341 758 0.8000 1.0000 2.0000 0.0000 Constraint 341 685 0.8000 1.0000 2.0000 0.0000 Constraint 341 673 0.8000 1.0000 2.0000 0.0000 Constraint 341 664 0.8000 1.0000 2.0000 0.0000 Constraint 341 657 0.8000 1.0000 2.0000 0.0000 Constraint 341 649 0.8000 1.0000 2.0000 0.0000 Constraint 341 644 0.8000 1.0000 2.0000 0.0000 Constraint 341 623 0.8000 1.0000 2.0000 0.0000 Constraint 341 616 0.8000 1.0000 2.0000 0.0000 Constraint 341 581 0.8000 1.0000 2.0000 0.0000 Constraint 341 572 0.8000 1.0000 2.0000 0.0000 Constraint 341 544 0.8000 1.0000 2.0000 0.0000 Constraint 341 523 0.8000 1.0000 2.0000 0.0000 Constraint 341 518 0.8000 1.0000 2.0000 0.0000 Constraint 341 502 0.8000 1.0000 2.0000 0.0000 Constraint 341 496 0.8000 1.0000 2.0000 0.0000 Constraint 341 490 0.8000 1.0000 2.0000 0.0000 Constraint 341 479 0.8000 1.0000 2.0000 0.0000 Constraint 341 471 0.8000 1.0000 2.0000 0.0000 Constraint 341 460 0.8000 1.0000 2.0000 0.0000 Constraint 341 441 0.8000 1.0000 2.0000 0.0000 Constraint 341 436 0.8000 1.0000 2.0000 0.0000 Constraint 341 413 0.8000 1.0000 2.0000 0.0000 Constraint 341 406 0.8000 1.0000 2.0000 0.0000 Constraint 341 399 0.8000 1.0000 2.0000 0.0000 Constraint 341 392 0.8000 1.0000 2.0000 0.0000 Constraint 341 384 0.8000 1.0000 2.0000 0.0000 Constraint 341 368 0.8000 1.0000 2.0000 0.0000 Constraint 341 357 0.8000 1.0000 2.0000 0.0000 Constraint 341 349 0.8000 1.0000 2.0000 0.0000 Constraint 336 1144 0.8000 1.0000 2.0000 0.0000 Constraint 336 1135 0.8000 1.0000 2.0000 0.0000 Constraint 336 1126 0.8000 1.0000 2.0000 0.0000 Constraint 336 1106 0.8000 1.0000 2.0000 0.0000 Constraint 336 1101 0.8000 1.0000 2.0000 0.0000 Constraint 336 1093 0.8000 1.0000 2.0000 0.0000 Constraint 336 1082 0.8000 1.0000 2.0000 0.0000 Constraint 336 1075 0.8000 1.0000 2.0000 0.0000 Constraint 336 1067 0.8000 1.0000 2.0000 0.0000 Constraint 336 1059 0.8000 1.0000 2.0000 0.0000 Constraint 336 1052 0.8000 1.0000 2.0000 0.0000 Constraint 336 1043 0.8000 1.0000 2.0000 0.0000 Constraint 336 1038 0.8000 1.0000 2.0000 0.0000 Constraint 336 1025 0.8000 1.0000 2.0000 0.0000 Constraint 336 1017 0.8000 1.0000 2.0000 0.0000 Constraint 336 1001 0.8000 1.0000 2.0000 0.0000 Constraint 336 992 0.8000 1.0000 2.0000 0.0000 Constraint 336 986 0.8000 1.0000 2.0000 0.0000 Constraint 336 977 0.8000 1.0000 2.0000 0.0000 Constraint 336 969 0.8000 1.0000 2.0000 0.0000 Constraint 336 961 0.8000 1.0000 2.0000 0.0000 Constraint 336 955 0.8000 1.0000 2.0000 0.0000 Constraint 336 950 0.8000 1.0000 2.0000 0.0000 Constraint 336 940 0.8000 1.0000 2.0000 0.0000 Constraint 336 932 0.8000 1.0000 2.0000 0.0000 Constraint 336 927 0.8000 1.0000 2.0000 0.0000 Constraint 336 916 0.8000 1.0000 2.0000 0.0000 Constraint 336 909 0.8000 1.0000 2.0000 0.0000 Constraint 336 901 0.8000 1.0000 2.0000 0.0000 Constraint 336 887 0.8000 1.0000 2.0000 0.0000 Constraint 336 878 0.8000 1.0000 2.0000 0.0000 Constraint 336 869 0.8000 1.0000 2.0000 0.0000 Constraint 336 858 0.8000 1.0000 2.0000 0.0000 Constraint 336 849 0.8000 1.0000 2.0000 0.0000 Constraint 336 844 0.8000 1.0000 2.0000 0.0000 Constraint 336 782 0.8000 1.0000 2.0000 0.0000 Constraint 336 771 0.8000 1.0000 2.0000 0.0000 Constraint 336 758 0.8000 1.0000 2.0000 0.0000 Constraint 336 746 0.8000 1.0000 2.0000 0.0000 Constraint 336 732 0.8000 1.0000 2.0000 0.0000 Constraint 336 714 0.8000 1.0000 2.0000 0.0000 Constraint 336 707 0.8000 1.0000 2.0000 0.0000 Constraint 336 696 0.8000 1.0000 2.0000 0.0000 Constraint 336 685 0.8000 1.0000 2.0000 0.0000 Constraint 336 673 0.8000 1.0000 2.0000 0.0000 Constraint 336 664 0.8000 1.0000 2.0000 0.0000 Constraint 336 657 0.8000 1.0000 2.0000 0.0000 Constraint 336 649 0.8000 1.0000 2.0000 0.0000 Constraint 336 644 0.8000 1.0000 2.0000 0.0000 Constraint 336 634 0.8000 1.0000 2.0000 0.0000 Constraint 336 623 0.8000 1.0000 2.0000 0.0000 Constraint 336 616 0.8000 1.0000 2.0000 0.0000 Constraint 336 581 0.8000 1.0000 2.0000 0.0000 Constraint 336 572 0.8000 1.0000 2.0000 0.0000 Constraint 336 555 0.8000 1.0000 2.0000 0.0000 Constraint 336 544 0.8000 1.0000 2.0000 0.0000 Constraint 336 523 0.8000 1.0000 2.0000 0.0000 Constraint 336 518 0.8000 1.0000 2.0000 0.0000 Constraint 336 496 0.8000 1.0000 2.0000 0.0000 Constraint 336 441 0.8000 1.0000 2.0000 0.0000 Constraint 336 436 0.8000 1.0000 2.0000 0.0000 Constraint 336 413 0.8000 1.0000 2.0000 0.0000 Constraint 336 406 0.8000 1.0000 2.0000 0.0000 Constraint 336 392 0.8000 1.0000 2.0000 0.0000 Constraint 336 384 0.8000 1.0000 2.0000 0.0000 Constraint 336 368 0.8000 1.0000 2.0000 0.0000 Constraint 336 357 0.8000 1.0000 2.0000 0.0000 Constraint 336 349 0.8000 1.0000 2.0000 0.0000 Constraint 336 341 0.8000 1.0000 2.0000 0.0000 Constraint 324 1144 0.8000 1.0000 2.0000 0.0000 Constraint 324 1135 0.8000 1.0000 2.0000 0.0000 Constraint 324 1126 0.8000 1.0000 2.0000 0.0000 Constraint 324 1115 0.8000 1.0000 2.0000 0.0000 Constraint 324 1106 0.8000 1.0000 2.0000 0.0000 Constraint 324 1101 0.8000 1.0000 2.0000 0.0000 Constraint 324 1093 0.8000 1.0000 2.0000 0.0000 Constraint 324 1082 0.8000 1.0000 2.0000 0.0000 Constraint 324 1075 0.8000 1.0000 2.0000 0.0000 Constraint 324 1067 0.8000 1.0000 2.0000 0.0000 Constraint 324 1059 0.8000 1.0000 2.0000 0.0000 Constraint 324 1052 0.8000 1.0000 2.0000 0.0000 Constraint 324 1043 0.8000 1.0000 2.0000 0.0000 Constraint 324 1038 0.8000 1.0000 2.0000 0.0000 Constraint 324 1033 0.8000 1.0000 2.0000 0.0000 Constraint 324 1025 0.8000 1.0000 2.0000 0.0000 Constraint 324 1017 0.8000 1.0000 2.0000 0.0000 Constraint 324 1012 0.8000 1.0000 2.0000 0.0000 Constraint 324 1001 0.8000 1.0000 2.0000 0.0000 Constraint 324 992 0.8000 1.0000 2.0000 0.0000 Constraint 324 986 0.8000 1.0000 2.0000 0.0000 Constraint 324 977 0.8000 1.0000 2.0000 0.0000 Constraint 324 969 0.8000 1.0000 2.0000 0.0000 Constraint 324 961 0.8000 1.0000 2.0000 0.0000 Constraint 324 955 0.8000 1.0000 2.0000 0.0000 Constraint 324 950 0.8000 1.0000 2.0000 0.0000 Constraint 324 940 0.8000 1.0000 2.0000 0.0000 Constraint 324 932 0.8000 1.0000 2.0000 0.0000 Constraint 324 927 0.8000 1.0000 2.0000 0.0000 Constraint 324 916 0.8000 1.0000 2.0000 0.0000 Constraint 324 909 0.8000 1.0000 2.0000 0.0000 Constraint 324 878 0.8000 1.0000 2.0000 0.0000 Constraint 324 869 0.8000 1.0000 2.0000 0.0000 Constraint 324 714 0.8000 1.0000 2.0000 0.0000 Constraint 324 707 0.8000 1.0000 2.0000 0.0000 Constraint 324 673 0.8000 1.0000 2.0000 0.0000 Constraint 324 664 0.8000 1.0000 2.0000 0.0000 Constraint 324 657 0.8000 1.0000 2.0000 0.0000 Constraint 324 649 0.8000 1.0000 2.0000 0.0000 Constraint 324 644 0.8000 1.0000 2.0000 0.0000 Constraint 324 634 0.8000 1.0000 2.0000 0.0000 Constraint 324 623 0.8000 1.0000 2.0000 0.0000 Constraint 324 616 0.8000 1.0000 2.0000 0.0000 Constraint 324 581 0.8000 1.0000 2.0000 0.0000 Constraint 324 572 0.8000 1.0000 2.0000 0.0000 Constraint 324 555 0.8000 1.0000 2.0000 0.0000 Constraint 324 544 0.8000 1.0000 2.0000 0.0000 Constraint 324 523 0.8000 1.0000 2.0000 0.0000 Constraint 324 518 0.8000 1.0000 2.0000 0.0000 Constraint 324 502 0.8000 1.0000 2.0000 0.0000 Constraint 324 496 0.8000 1.0000 2.0000 0.0000 Constraint 324 490 0.8000 1.0000 2.0000 0.0000 Constraint 324 479 0.8000 1.0000 2.0000 0.0000 Constraint 324 460 0.8000 1.0000 2.0000 0.0000 Constraint 324 446 0.8000 1.0000 2.0000 0.0000 Constraint 324 441 0.8000 1.0000 2.0000 0.0000 Constraint 324 436 0.8000 1.0000 2.0000 0.0000 Constraint 324 419 0.8000 1.0000 2.0000 0.0000 Constraint 324 413 0.8000 1.0000 2.0000 0.0000 Constraint 324 406 0.8000 1.0000 2.0000 0.0000 Constraint 324 399 0.8000 1.0000 2.0000 0.0000 Constraint 324 368 0.8000 1.0000 2.0000 0.0000 Constraint 324 357 0.8000 1.0000 2.0000 0.0000 Constraint 324 349 0.8000 1.0000 2.0000 0.0000 Constraint 324 341 0.8000 1.0000 2.0000 0.0000 Constraint 324 336 0.8000 1.0000 2.0000 0.0000 Constraint 317 1144 0.8000 1.0000 2.0000 0.0000 Constraint 317 1135 0.8000 1.0000 2.0000 0.0000 Constraint 317 1126 0.8000 1.0000 2.0000 0.0000 Constraint 317 1115 0.8000 1.0000 2.0000 0.0000 Constraint 317 1106 0.8000 1.0000 2.0000 0.0000 Constraint 317 1101 0.8000 1.0000 2.0000 0.0000 Constraint 317 1093 0.8000 1.0000 2.0000 0.0000 Constraint 317 1082 0.8000 1.0000 2.0000 0.0000 Constraint 317 1075 0.8000 1.0000 2.0000 0.0000 Constraint 317 1067 0.8000 1.0000 2.0000 0.0000 Constraint 317 1059 0.8000 1.0000 2.0000 0.0000 Constraint 317 1052 0.8000 1.0000 2.0000 0.0000 Constraint 317 1043 0.8000 1.0000 2.0000 0.0000 Constraint 317 1038 0.8000 1.0000 2.0000 0.0000 Constraint 317 1033 0.8000 1.0000 2.0000 0.0000 Constraint 317 1025 0.8000 1.0000 2.0000 0.0000 Constraint 317 1017 0.8000 1.0000 2.0000 0.0000 Constraint 317 1012 0.8000 1.0000 2.0000 0.0000 Constraint 317 1001 0.8000 1.0000 2.0000 0.0000 Constraint 317 992 0.8000 1.0000 2.0000 0.0000 Constraint 317 986 0.8000 1.0000 2.0000 0.0000 Constraint 317 977 0.8000 1.0000 2.0000 0.0000 Constraint 317 969 0.8000 1.0000 2.0000 0.0000 Constraint 317 961 0.8000 1.0000 2.0000 0.0000 Constraint 317 955 0.8000 1.0000 2.0000 0.0000 Constraint 317 950 0.8000 1.0000 2.0000 0.0000 Constraint 317 940 0.8000 1.0000 2.0000 0.0000 Constraint 317 932 0.8000 1.0000 2.0000 0.0000 Constraint 317 927 0.8000 1.0000 2.0000 0.0000 Constraint 317 916 0.8000 1.0000 2.0000 0.0000 Constraint 317 909 0.8000 1.0000 2.0000 0.0000 Constraint 317 901 0.8000 1.0000 2.0000 0.0000 Constraint 317 887 0.8000 1.0000 2.0000 0.0000 Constraint 317 878 0.8000 1.0000 2.0000 0.0000 Constraint 317 869 0.8000 1.0000 2.0000 0.0000 Constraint 317 844 0.8000 1.0000 2.0000 0.0000 Constraint 317 833 0.8000 1.0000 2.0000 0.0000 Constraint 317 809 0.8000 1.0000 2.0000 0.0000 Constraint 317 782 0.8000 1.0000 2.0000 0.0000 Constraint 317 771 0.8000 1.0000 2.0000 0.0000 Constraint 317 758 0.8000 1.0000 2.0000 0.0000 Constraint 317 752 0.8000 1.0000 2.0000 0.0000 Constraint 317 746 0.8000 1.0000 2.0000 0.0000 Constraint 317 714 0.8000 1.0000 2.0000 0.0000 Constraint 317 707 0.8000 1.0000 2.0000 0.0000 Constraint 317 696 0.8000 1.0000 2.0000 0.0000 Constraint 317 685 0.8000 1.0000 2.0000 0.0000 Constraint 317 673 0.8000 1.0000 2.0000 0.0000 Constraint 317 664 0.8000 1.0000 2.0000 0.0000 Constraint 317 657 0.8000 1.0000 2.0000 0.0000 Constraint 317 649 0.8000 1.0000 2.0000 0.0000 Constraint 317 644 0.8000 1.0000 2.0000 0.0000 Constraint 317 634 0.8000 1.0000 2.0000 0.0000 Constraint 317 623 0.8000 1.0000 2.0000 0.0000 Constraint 317 616 0.8000 1.0000 2.0000 0.0000 Constraint 317 600 0.8000 1.0000 2.0000 0.0000 Constraint 317 581 0.8000 1.0000 2.0000 0.0000 Constraint 317 572 0.8000 1.0000 2.0000 0.0000 Constraint 317 544 0.8000 1.0000 2.0000 0.0000 Constraint 317 523 0.8000 1.0000 2.0000 0.0000 Constraint 317 518 0.8000 1.0000 2.0000 0.0000 Constraint 317 490 0.8000 1.0000 2.0000 0.0000 Constraint 317 479 0.8000 1.0000 2.0000 0.0000 Constraint 317 460 0.8000 1.0000 2.0000 0.0000 Constraint 317 441 0.8000 1.0000 2.0000 0.0000 Constraint 317 436 0.8000 1.0000 2.0000 0.0000 Constraint 317 413 0.8000 1.0000 2.0000 0.0000 Constraint 317 406 0.8000 1.0000 2.0000 0.0000 Constraint 317 384 0.8000 1.0000 2.0000 0.0000 Constraint 317 368 0.8000 1.0000 2.0000 0.0000 Constraint 317 357 0.8000 1.0000 2.0000 0.0000 Constraint 317 349 0.8000 1.0000 2.0000 0.0000 Constraint 317 341 0.8000 1.0000 2.0000 0.0000 Constraint 317 336 0.8000 1.0000 2.0000 0.0000 Constraint 317 324 0.8000 1.0000 2.0000 0.0000 Constraint 310 1144 0.8000 1.0000 2.0000 0.0000 Constraint 310 1135 0.8000 1.0000 2.0000 0.0000 Constraint 310 1126 0.8000 1.0000 2.0000 0.0000 Constraint 310 1115 0.8000 1.0000 2.0000 0.0000 Constraint 310 1106 0.8000 1.0000 2.0000 0.0000 Constraint 310 1093 0.8000 1.0000 2.0000 0.0000 Constraint 310 1082 0.8000 1.0000 2.0000 0.0000 Constraint 310 1075 0.8000 1.0000 2.0000 0.0000 Constraint 310 1067 0.8000 1.0000 2.0000 0.0000 Constraint 310 1059 0.8000 1.0000 2.0000 0.0000 Constraint 310 1052 0.8000 1.0000 2.0000 0.0000 Constraint 310 1043 0.8000 1.0000 2.0000 0.0000 Constraint 310 1038 0.8000 1.0000 2.0000 0.0000 Constraint 310 1017 0.8000 1.0000 2.0000 0.0000 Constraint 310 992 0.8000 1.0000 2.0000 0.0000 Constraint 310 986 0.8000 1.0000 2.0000 0.0000 Constraint 310 977 0.8000 1.0000 2.0000 0.0000 Constraint 310 969 0.8000 1.0000 2.0000 0.0000 Constraint 310 961 0.8000 1.0000 2.0000 0.0000 Constraint 310 955 0.8000 1.0000 2.0000 0.0000 Constraint 310 932 0.8000 1.0000 2.0000 0.0000 Constraint 310 927 0.8000 1.0000 2.0000 0.0000 Constraint 310 916 0.8000 1.0000 2.0000 0.0000 Constraint 310 909 0.8000 1.0000 2.0000 0.0000 Constraint 310 901 0.8000 1.0000 2.0000 0.0000 Constraint 310 887 0.8000 1.0000 2.0000 0.0000 Constraint 310 878 0.8000 1.0000 2.0000 0.0000 Constraint 310 869 0.8000 1.0000 2.0000 0.0000 Constraint 310 849 0.8000 1.0000 2.0000 0.0000 Constraint 310 844 0.8000 1.0000 2.0000 0.0000 Constraint 310 793 0.8000 1.0000 2.0000 0.0000 Constraint 310 782 0.8000 1.0000 2.0000 0.0000 Constraint 310 771 0.8000 1.0000 2.0000 0.0000 Constraint 310 758 0.8000 1.0000 2.0000 0.0000 Constraint 310 738 0.8000 1.0000 2.0000 0.0000 Constraint 310 732 0.8000 1.0000 2.0000 0.0000 Constraint 310 714 0.8000 1.0000 2.0000 0.0000 Constraint 310 707 0.8000 1.0000 2.0000 0.0000 Constraint 310 696 0.8000 1.0000 2.0000 0.0000 Constraint 310 685 0.8000 1.0000 2.0000 0.0000 Constraint 310 673 0.8000 1.0000 2.0000 0.0000 Constraint 310 664 0.8000 1.0000 2.0000 0.0000 Constraint 310 657 0.8000 1.0000 2.0000 0.0000 Constraint 310 649 0.8000 1.0000 2.0000 0.0000 Constraint 310 644 0.8000 1.0000 2.0000 0.0000 Constraint 310 634 0.8000 1.0000 2.0000 0.0000 Constraint 310 623 0.8000 1.0000 2.0000 0.0000 Constraint 310 616 0.8000 1.0000 2.0000 0.0000 Constraint 310 608 0.8000 1.0000 2.0000 0.0000 Constraint 310 581 0.8000 1.0000 2.0000 0.0000 Constraint 310 572 0.8000 1.0000 2.0000 0.0000 Constraint 310 544 0.8000 1.0000 2.0000 0.0000 Constraint 310 523 0.8000 1.0000 2.0000 0.0000 Constraint 310 518 0.8000 1.0000 2.0000 0.0000 Constraint 310 502 0.8000 1.0000 2.0000 0.0000 Constraint 310 441 0.8000 1.0000 2.0000 0.0000 Constraint 310 436 0.8000 1.0000 2.0000 0.0000 Constraint 310 419 0.8000 1.0000 2.0000 0.0000 Constraint 310 413 0.8000 1.0000 2.0000 0.0000 Constraint 310 406 0.8000 1.0000 2.0000 0.0000 Constraint 310 399 0.8000 1.0000 2.0000 0.0000 Constraint 310 384 0.8000 1.0000 2.0000 0.0000 Constraint 310 368 0.8000 1.0000 2.0000 0.0000 Constraint 310 357 0.8000 1.0000 2.0000 0.0000 Constraint 310 349 0.8000 1.0000 2.0000 0.0000 Constraint 310 341 0.8000 1.0000 2.0000 0.0000 Constraint 310 336 0.8000 1.0000 2.0000 0.0000 Constraint 310 324 0.8000 1.0000 2.0000 0.0000 Constraint 310 317 0.8000 1.0000 2.0000 0.0000 Constraint 302 1144 0.8000 1.0000 2.0000 0.0000 Constraint 302 1135 0.8000 1.0000 2.0000 0.0000 Constraint 302 1126 0.8000 1.0000 2.0000 0.0000 Constraint 302 1115 0.8000 1.0000 2.0000 0.0000 Constraint 302 1106 0.8000 1.0000 2.0000 0.0000 Constraint 302 1101 0.8000 1.0000 2.0000 0.0000 Constraint 302 1093 0.8000 1.0000 2.0000 0.0000 Constraint 302 1082 0.8000 1.0000 2.0000 0.0000 Constraint 302 1075 0.8000 1.0000 2.0000 0.0000 Constraint 302 1067 0.8000 1.0000 2.0000 0.0000 Constraint 302 1059 0.8000 1.0000 2.0000 0.0000 Constraint 302 1052 0.8000 1.0000 2.0000 0.0000 Constraint 302 1043 0.8000 1.0000 2.0000 0.0000 Constraint 302 1038 0.8000 1.0000 2.0000 0.0000 Constraint 302 1033 0.8000 1.0000 2.0000 0.0000 Constraint 302 1017 0.8000 1.0000 2.0000 0.0000 Constraint 302 1012 0.8000 1.0000 2.0000 0.0000 Constraint 302 992 0.8000 1.0000 2.0000 0.0000 Constraint 302 986 0.8000 1.0000 2.0000 0.0000 Constraint 302 977 0.8000 1.0000 2.0000 0.0000 Constraint 302 969 0.8000 1.0000 2.0000 0.0000 Constraint 302 961 0.8000 1.0000 2.0000 0.0000 Constraint 302 955 0.8000 1.0000 2.0000 0.0000 Constraint 302 932 0.8000 1.0000 2.0000 0.0000 Constraint 302 927 0.8000 1.0000 2.0000 0.0000 Constraint 302 916 0.8000 1.0000 2.0000 0.0000 Constraint 302 909 0.8000 1.0000 2.0000 0.0000 Constraint 302 878 0.8000 1.0000 2.0000 0.0000 Constraint 302 782 0.8000 1.0000 2.0000 0.0000 Constraint 302 758 0.8000 1.0000 2.0000 0.0000 Constraint 302 752 0.8000 1.0000 2.0000 0.0000 Constraint 302 732 0.8000 1.0000 2.0000 0.0000 Constraint 302 707 0.8000 1.0000 2.0000 0.0000 Constraint 302 696 0.8000 1.0000 2.0000 0.0000 Constraint 302 673 0.8000 1.0000 2.0000 0.0000 Constraint 302 664 0.8000 1.0000 2.0000 0.0000 Constraint 302 657 0.8000 1.0000 2.0000 0.0000 Constraint 302 649 0.8000 1.0000 2.0000 0.0000 Constraint 302 644 0.8000 1.0000 2.0000 0.0000 Constraint 302 634 0.8000 1.0000 2.0000 0.0000 Constraint 302 623 0.8000 1.0000 2.0000 0.0000 Constraint 302 616 0.8000 1.0000 2.0000 0.0000 Constraint 302 581 0.8000 1.0000 2.0000 0.0000 Constraint 302 572 0.8000 1.0000 2.0000 0.0000 Constraint 302 544 0.8000 1.0000 2.0000 0.0000 Constraint 302 536 0.8000 1.0000 2.0000 0.0000 Constraint 302 523 0.8000 1.0000 2.0000 0.0000 Constraint 302 518 0.8000 1.0000 2.0000 0.0000 Constraint 302 496 0.8000 1.0000 2.0000 0.0000 Constraint 302 490 0.8000 1.0000 2.0000 0.0000 Constraint 302 479 0.8000 1.0000 2.0000 0.0000 Constraint 302 446 0.8000 1.0000 2.0000 0.0000 Constraint 302 441 0.8000 1.0000 2.0000 0.0000 Constraint 302 436 0.8000 1.0000 2.0000 0.0000 Constraint 302 428 0.8000 1.0000 2.0000 0.0000 Constraint 302 419 0.8000 1.0000 2.0000 0.0000 Constraint 302 413 0.8000 1.0000 2.0000 0.0000 Constraint 302 406 0.8000 1.0000 2.0000 0.0000 Constraint 302 399 0.8000 1.0000 2.0000 0.0000 Constraint 302 392 0.8000 1.0000 2.0000 0.0000 Constraint 302 384 0.8000 1.0000 2.0000 0.0000 Constraint 302 368 0.8000 1.0000 2.0000 0.0000 Constraint 302 357 0.8000 1.0000 2.0000 0.0000 Constraint 302 349 0.8000 1.0000 2.0000 0.0000 Constraint 302 341 0.8000 1.0000 2.0000 0.0000 Constraint 302 336 0.8000 1.0000 2.0000 0.0000 Constraint 302 324 0.8000 1.0000 2.0000 0.0000 Constraint 302 317 0.8000 1.0000 2.0000 0.0000 Constraint 302 310 0.8000 1.0000 2.0000 0.0000 Constraint 293 1144 0.8000 1.0000 2.0000 0.0000 Constraint 293 1135 0.8000 1.0000 2.0000 0.0000 Constraint 293 1126 0.8000 1.0000 2.0000 0.0000 Constraint 293 1115 0.8000 1.0000 2.0000 0.0000 Constraint 293 1106 0.8000 1.0000 2.0000 0.0000 Constraint 293 1101 0.8000 1.0000 2.0000 0.0000 Constraint 293 1093 0.8000 1.0000 2.0000 0.0000 Constraint 293 1082 0.8000 1.0000 2.0000 0.0000 Constraint 293 1075 0.8000 1.0000 2.0000 0.0000 Constraint 293 1067 0.8000 1.0000 2.0000 0.0000 Constraint 293 1059 0.8000 1.0000 2.0000 0.0000 Constraint 293 1052 0.8000 1.0000 2.0000 0.0000 Constraint 293 1043 0.8000 1.0000 2.0000 0.0000 Constraint 293 1038 0.8000 1.0000 2.0000 0.0000 Constraint 293 1033 0.8000 1.0000 2.0000 0.0000 Constraint 293 1025 0.8000 1.0000 2.0000 0.0000 Constraint 293 1017 0.8000 1.0000 2.0000 0.0000 Constraint 293 1012 0.8000 1.0000 2.0000 0.0000 Constraint 293 1001 0.8000 1.0000 2.0000 0.0000 Constraint 293 992 0.8000 1.0000 2.0000 0.0000 Constraint 293 986 0.8000 1.0000 2.0000 0.0000 Constraint 293 977 0.8000 1.0000 2.0000 0.0000 Constraint 293 969 0.8000 1.0000 2.0000 0.0000 Constraint 293 961 0.8000 1.0000 2.0000 0.0000 Constraint 293 955 0.8000 1.0000 2.0000 0.0000 Constraint 293 950 0.8000 1.0000 2.0000 0.0000 Constraint 293 940 0.8000 1.0000 2.0000 0.0000 Constraint 293 932 0.8000 1.0000 2.0000 0.0000 Constraint 293 927 0.8000 1.0000 2.0000 0.0000 Constraint 293 916 0.8000 1.0000 2.0000 0.0000 Constraint 293 909 0.8000 1.0000 2.0000 0.0000 Constraint 293 901 0.8000 1.0000 2.0000 0.0000 Constraint 293 887 0.8000 1.0000 2.0000 0.0000 Constraint 293 878 0.8000 1.0000 2.0000 0.0000 Constraint 293 869 0.8000 1.0000 2.0000 0.0000 Constraint 293 858 0.8000 1.0000 2.0000 0.0000 Constraint 293 849 0.8000 1.0000 2.0000 0.0000 Constraint 293 844 0.8000 1.0000 2.0000 0.0000 Constraint 293 809 0.8000 1.0000 2.0000 0.0000 Constraint 293 782 0.8000 1.0000 2.0000 0.0000 Constraint 293 771 0.8000 1.0000 2.0000 0.0000 Constraint 293 758 0.8000 1.0000 2.0000 0.0000 Constraint 293 752 0.8000 1.0000 2.0000 0.0000 Constraint 293 746 0.8000 1.0000 2.0000 0.0000 Constraint 293 732 0.8000 1.0000 2.0000 0.0000 Constraint 293 714 0.8000 1.0000 2.0000 0.0000 Constraint 293 707 0.8000 1.0000 2.0000 0.0000 Constraint 293 696 0.8000 1.0000 2.0000 0.0000 Constraint 293 685 0.8000 1.0000 2.0000 0.0000 Constraint 293 673 0.8000 1.0000 2.0000 0.0000 Constraint 293 664 0.8000 1.0000 2.0000 0.0000 Constraint 293 657 0.8000 1.0000 2.0000 0.0000 Constraint 293 649 0.8000 1.0000 2.0000 0.0000 Constraint 293 644 0.8000 1.0000 2.0000 0.0000 Constraint 293 634 0.8000 1.0000 2.0000 0.0000 Constraint 293 623 0.8000 1.0000 2.0000 0.0000 Constraint 293 616 0.8000 1.0000 2.0000 0.0000 Constraint 293 581 0.8000 1.0000 2.0000 0.0000 Constraint 293 572 0.8000 1.0000 2.0000 0.0000 Constraint 293 544 0.8000 1.0000 2.0000 0.0000 Constraint 293 523 0.8000 1.0000 2.0000 0.0000 Constraint 293 518 0.8000 1.0000 2.0000 0.0000 Constraint 293 496 0.8000 1.0000 2.0000 0.0000 Constraint 293 490 0.8000 1.0000 2.0000 0.0000 Constraint 293 479 0.8000 1.0000 2.0000 0.0000 Constraint 293 471 0.8000 1.0000 2.0000 0.0000 Constraint 293 460 0.8000 1.0000 2.0000 0.0000 Constraint 293 446 0.8000 1.0000 2.0000 0.0000 Constraint 293 441 0.8000 1.0000 2.0000 0.0000 Constraint 293 436 0.8000 1.0000 2.0000 0.0000 Constraint 293 419 0.8000 1.0000 2.0000 0.0000 Constraint 293 413 0.8000 1.0000 2.0000 0.0000 Constraint 293 406 0.8000 1.0000 2.0000 0.0000 Constraint 293 399 0.8000 1.0000 2.0000 0.0000 Constraint 293 392 0.8000 1.0000 2.0000 0.0000 Constraint 293 384 0.8000 1.0000 2.0000 0.0000 Constraint 293 368 0.8000 1.0000 2.0000 0.0000 Constraint 293 349 0.8000 1.0000 2.0000 0.0000 Constraint 293 341 0.8000 1.0000 2.0000 0.0000 Constraint 293 336 0.8000 1.0000 2.0000 0.0000 Constraint 293 324 0.8000 1.0000 2.0000 0.0000 Constraint 293 317 0.8000 1.0000 2.0000 0.0000 Constraint 293 310 0.8000 1.0000 2.0000 0.0000 Constraint 293 302 0.8000 1.0000 2.0000 0.0000 Constraint 287 1144 0.8000 1.0000 2.0000 0.0000 Constraint 287 1135 0.8000 1.0000 2.0000 0.0000 Constraint 287 1126 0.8000 1.0000 2.0000 0.0000 Constraint 287 1115 0.8000 1.0000 2.0000 0.0000 Constraint 287 1101 0.8000 1.0000 2.0000 0.0000 Constraint 287 1093 0.8000 1.0000 2.0000 0.0000 Constraint 287 1082 0.8000 1.0000 2.0000 0.0000 Constraint 287 1075 0.8000 1.0000 2.0000 0.0000 Constraint 287 1067 0.8000 1.0000 2.0000 0.0000 Constraint 287 1059 0.8000 1.0000 2.0000 0.0000 Constraint 287 1052 0.8000 1.0000 2.0000 0.0000 Constraint 287 1043 0.8000 1.0000 2.0000 0.0000 Constraint 287 1025 0.8000 1.0000 2.0000 0.0000 Constraint 287 1017 0.8000 1.0000 2.0000 0.0000 Constraint 287 1001 0.8000 1.0000 2.0000 0.0000 Constraint 287 992 0.8000 1.0000 2.0000 0.0000 Constraint 287 986 0.8000 1.0000 2.0000 0.0000 Constraint 287 977 0.8000 1.0000 2.0000 0.0000 Constraint 287 969 0.8000 1.0000 2.0000 0.0000 Constraint 287 961 0.8000 1.0000 2.0000 0.0000 Constraint 287 955 0.8000 1.0000 2.0000 0.0000 Constraint 287 940 0.8000 1.0000 2.0000 0.0000 Constraint 287 932 0.8000 1.0000 2.0000 0.0000 Constraint 287 927 0.8000 1.0000 2.0000 0.0000 Constraint 287 916 0.8000 1.0000 2.0000 0.0000 Constraint 287 909 0.8000 1.0000 2.0000 0.0000 Constraint 287 901 0.8000 1.0000 2.0000 0.0000 Constraint 287 887 0.8000 1.0000 2.0000 0.0000 Constraint 287 878 0.8000 1.0000 2.0000 0.0000 Constraint 287 869 0.8000 1.0000 2.0000 0.0000 Constraint 287 858 0.8000 1.0000 2.0000 0.0000 Constraint 287 849 0.8000 1.0000 2.0000 0.0000 Constraint 287 844 0.8000 1.0000 2.0000 0.0000 Constraint 287 833 0.8000 1.0000 2.0000 0.0000 Constraint 287 809 0.8000 1.0000 2.0000 0.0000 Constraint 287 801 0.8000 1.0000 2.0000 0.0000 Constraint 287 793 0.8000 1.0000 2.0000 0.0000 Constraint 287 782 0.8000 1.0000 2.0000 0.0000 Constraint 287 771 0.8000 1.0000 2.0000 0.0000 Constraint 287 758 0.8000 1.0000 2.0000 0.0000 Constraint 287 752 0.8000 1.0000 2.0000 0.0000 Constraint 287 746 0.8000 1.0000 2.0000 0.0000 Constraint 287 738 0.8000 1.0000 2.0000 0.0000 Constraint 287 732 0.8000 1.0000 2.0000 0.0000 Constraint 287 725 0.8000 1.0000 2.0000 0.0000 Constraint 287 714 0.8000 1.0000 2.0000 0.0000 Constraint 287 707 0.8000 1.0000 2.0000 0.0000 Constraint 287 696 0.8000 1.0000 2.0000 0.0000 Constraint 287 685 0.8000 1.0000 2.0000 0.0000 Constraint 287 673 0.8000 1.0000 2.0000 0.0000 Constraint 287 664 0.8000 1.0000 2.0000 0.0000 Constraint 287 657 0.8000 1.0000 2.0000 0.0000 Constraint 287 649 0.8000 1.0000 2.0000 0.0000 Constraint 287 644 0.8000 1.0000 2.0000 0.0000 Constraint 287 634 0.8000 1.0000 2.0000 0.0000 Constraint 287 623 0.8000 1.0000 2.0000 0.0000 Constraint 287 616 0.8000 1.0000 2.0000 0.0000 Constraint 287 608 0.8000 1.0000 2.0000 0.0000 Constraint 287 600 0.8000 1.0000 2.0000 0.0000 Constraint 287 581 0.8000 1.0000 2.0000 0.0000 Constraint 287 572 0.8000 1.0000 2.0000 0.0000 Constraint 287 544 0.8000 1.0000 2.0000 0.0000 Constraint 287 518 0.8000 1.0000 2.0000 0.0000 Constraint 287 496 0.8000 1.0000 2.0000 0.0000 Constraint 287 490 0.8000 1.0000 2.0000 0.0000 Constraint 287 479 0.8000 1.0000 2.0000 0.0000 Constraint 287 441 0.8000 1.0000 2.0000 0.0000 Constraint 287 436 0.8000 1.0000 2.0000 0.0000 Constraint 287 419 0.8000 1.0000 2.0000 0.0000 Constraint 287 413 0.8000 1.0000 2.0000 0.0000 Constraint 287 406 0.8000 1.0000 2.0000 0.0000 Constraint 287 399 0.8000 1.0000 2.0000 0.0000 Constraint 287 392 0.8000 1.0000 2.0000 0.0000 Constraint 287 384 0.8000 1.0000 2.0000 0.0000 Constraint 287 368 0.8000 1.0000 2.0000 0.0000 Constraint 287 357 0.8000 1.0000 2.0000 0.0000 Constraint 287 349 0.8000 1.0000 2.0000 0.0000 Constraint 287 341 0.8000 1.0000 2.0000 0.0000 Constraint 287 336 0.8000 1.0000 2.0000 0.0000 Constraint 287 324 0.8000 1.0000 2.0000 0.0000 Constraint 287 317 0.8000 1.0000 2.0000 0.0000 Constraint 287 310 0.8000 1.0000 2.0000 0.0000 Constraint 287 302 0.8000 1.0000 2.0000 0.0000 Constraint 287 293 0.8000 1.0000 2.0000 0.0000 Constraint 276 1144 0.8000 1.0000 2.0000 0.0000 Constraint 276 1135 0.8000 1.0000 2.0000 0.0000 Constraint 276 1126 0.8000 1.0000 2.0000 0.0000 Constraint 276 1115 0.8000 1.0000 2.0000 0.0000 Constraint 276 1093 0.8000 1.0000 2.0000 0.0000 Constraint 276 1082 0.8000 1.0000 2.0000 0.0000 Constraint 276 1075 0.8000 1.0000 2.0000 0.0000 Constraint 276 1067 0.8000 1.0000 2.0000 0.0000 Constraint 276 1059 0.8000 1.0000 2.0000 0.0000 Constraint 276 1052 0.8000 1.0000 2.0000 0.0000 Constraint 276 1043 0.8000 1.0000 2.0000 0.0000 Constraint 276 1025 0.8000 1.0000 2.0000 0.0000 Constraint 276 1017 0.8000 1.0000 2.0000 0.0000 Constraint 276 1012 0.8000 1.0000 2.0000 0.0000 Constraint 276 1001 0.8000 1.0000 2.0000 0.0000 Constraint 276 992 0.8000 1.0000 2.0000 0.0000 Constraint 276 986 0.8000 1.0000 2.0000 0.0000 Constraint 276 977 0.8000 1.0000 2.0000 0.0000 Constraint 276 969 0.8000 1.0000 2.0000 0.0000 Constraint 276 961 0.8000 1.0000 2.0000 0.0000 Constraint 276 940 0.8000 1.0000 2.0000 0.0000 Constraint 276 932 0.8000 1.0000 2.0000 0.0000 Constraint 276 927 0.8000 1.0000 2.0000 0.0000 Constraint 276 916 0.8000 1.0000 2.0000 0.0000 Constraint 276 909 0.8000 1.0000 2.0000 0.0000 Constraint 276 901 0.8000 1.0000 2.0000 0.0000 Constraint 276 887 0.8000 1.0000 2.0000 0.0000 Constraint 276 878 0.8000 1.0000 2.0000 0.0000 Constraint 276 869 0.8000 1.0000 2.0000 0.0000 Constraint 276 849 0.8000 1.0000 2.0000 0.0000 Constraint 276 844 0.8000 1.0000 2.0000 0.0000 Constraint 276 833 0.8000 1.0000 2.0000 0.0000 Constraint 276 809 0.8000 1.0000 2.0000 0.0000 Constraint 276 782 0.8000 1.0000 2.0000 0.0000 Constraint 276 771 0.8000 1.0000 2.0000 0.0000 Constraint 276 758 0.8000 1.0000 2.0000 0.0000 Constraint 276 752 0.8000 1.0000 2.0000 0.0000 Constraint 276 746 0.8000 1.0000 2.0000 0.0000 Constraint 276 738 0.8000 1.0000 2.0000 0.0000 Constraint 276 732 0.8000 1.0000 2.0000 0.0000 Constraint 276 725 0.8000 1.0000 2.0000 0.0000 Constraint 276 714 0.8000 1.0000 2.0000 0.0000 Constraint 276 707 0.8000 1.0000 2.0000 0.0000 Constraint 276 696 0.8000 1.0000 2.0000 0.0000 Constraint 276 685 0.8000 1.0000 2.0000 0.0000 Constraint 276 673 0.8000 1.0000 2.0000 0.0000 Constraint 276 664 0.8000 1.0000 2.0000 0.0000 Constraint 276 657 0.8000 1.0000 2.0000 0.0000 Constraint 276 649 0.8000 1.0000 2.0000 0.0000 Constraint 276 644 0.8000 1.0000 2.0000 0.0000 Constraint 276 634 0.8000 1.0000 2.0000 0.0000 Constraint 276 623 0.8000 1.0000 2.0000 0.0000 Constraint 276 616 0.8000 1.0000 2.0000 0.0000 Constraint 276 608 0.8000 1.0000 2.0000 0.0000 Constraint 276 600 0.8000 1.0000 2.0000 0.0000 Constraint 276 581 0.8000 1.0000 2.0000 0.0000 Constraint 276 572 0.8000 1.0000 2.0000 0.0000 Constraint 276 564 0.8000 1.0000 2.0000 0.0000 Constraint 276 544 0.8000 1.0000 2.0000 0.0000 Constraint 276 536 0.8000 1.0000 2.0000 0.0000 Constraint 276 518 0.8000 1.0000 2.0000 0.0000 Constraint 276 496 0.8000 1.0000 2.0000 0.0000 Constraint 276 490 0.8000 1.0000 2.0000 0.0000 Constraint 276 479 0.8000 1.0000 2.0000 0.0000 Constraint 276 446 0.8000 1.0000 2.0000 0.0000 Constraint 276 441 0.8000 1.0000 2.0000 0.0000 Constraint 276 436 0.8000 1.0000 2.0000 0.0000 Constraint 276 428 0.8000 1.0000 2.0000 0.0000 Constraint 276 419 0.8000 1.0000 2.0000 0.0000 Constraint 276 413 0.8000 1.0000 2.0000 0.0000 Constraint 276 406 0.8000 1.0000 2.0000 0.0000 Constraint 276 399 0.8000 1.0000 2.0000 0.0000 Constraint 276 392 0.8000 1.0000 2.0000 0.0000 Constraint 276 384 0.8000 1.0000 2.0000 0.0000 Constraint 276 368 0.8000 1.0000 2.0000 0.0000 Constraint 276 357 0.8000 1.0000 2.0000 0.0000 Constraint 276 349 0.8000 1.0000 2.0000 0.0000 Constraint 276 341 0.8000 1.0000 2.0000 0.0000 Constraint 276 336 0.8000 1.0000 2.0000 0.0000 Constraint 276 324 0.8000 1.0000 2.0000 0.0000 Constraint 276 317 0.8000 1.0000 2.0000 0.0000 Constraint 276 310 0.8000 1.0000 2.0000 0.0000 Constraint 276 302 0.8000 1.0000 2.0000 0.0000 Constraint 276 293 0.8000 1.0000 2.0000 0.0000 Constraint 276 287 0.8000 1.0000 2.0000 0.0000 Constraint 267 1144 0.8000 1.0000 2.0000 0.0000 Constraint 267 1135 0.8000 1.0000 2.0000 0.0000 Constraint 267 1126 0.8000 1.0000 2.0000 0.0000 Constraint 267 1115 0.8000 1.0000 2.0000 0.0000 Constraint 267 1106 0.8000 1.0000 2.0000 0.0000 Constraint 267 1101 0.8000 1.0000 2.0000 0.0000 Constraint 267 1093 0.8000 1.0000 2.0000 0.0000 Constraint 267 1082 0.8000 1.0000 2.0000 0.0000 Constraint 267 1075 0.8000 1.0000 2.0000 0.0000 Constraint 267 1067 0.8000 1.0000 2.0000 0.0000 Constraint 267 1059 0.8000 1.0000 2.0000 0.0000 Constraint 267 1052 0.8000 1.0000 2.0000 0.0000 Constraint 267 1043 0.8000 1.0000 2.0000 0.0000 Constraint 267 1033 0.8000 1.0000 2.0000 0.0000 Constraint 267 1025 0.8000 1.0000 2.0000 0.0000 Constraint 267 1017 0.8000 1.0000 2.0000 0.0000 Constraint 267 1012 0.8000 1.0000 2.0000 0.0000 Constraint 267 1001 0.8000 1.0000 2.0000 0.0000 Constraint 267 992 0.8000 1.0000 2.0000 0.0000 Constraint 267 986 0.8000 1.0000 2.0000 0.0000 Constraint 267 977 0.8000 1.0000 2.0000 0.0000 Constraint 267 969 0.8000 1.0000 2.0000 0.0000 Constraint 267 961 0.8000 1.0000 2.0000 0.0000 Constraint 267 955 0.8000 1.0000 2.0000 0.0000 Constraint 267 950 0.8000 1.0000 2.0000 0.0000 Constraint 267 940 0.8000 1.0000 2.0000 0.0000 Constraint 267 932 0.8000 1.0000 2.0000 0.0000 Constraint 267 927 0.8000 1.0000 2.0000 0.0000 Constraint 267 916 0.8000 1.0000 2.0000 0.0000 Constraint 267 909 0.8000 1.0000 2.0000 0.0000 Constraint 267 878 0.8000 1.0000 2.0000 0.0000 Constraint 267 869 0.8000 1.0000 2.0000 0.0000 Constraint 267 844 0.8000 1.0000 2.0000 0.0000 Constraint 267 833 0.8000 1.0000 2.0000 0.0000 Constraint 267 809 0.8000 1.0000 2.0000 0.0000 Constraint 267 801 0.8000 1.0000 2.0000 0.0000 Constraint 267 782 0.8000 1.0000 2.0000 0.0000 Constraint 267 771 0.8000 1.0000 2.0000 0.0000 Constraint 267 758 0.8000 1.0000 2.0000 0.0000 Constraint 267 752 0.8000 1.0000 2.0000 0.0000 Constraint 267 746 0.8000 1.0000 2.0000 0.0000 Constraint 267 738 0.8000 1.0000 2.0000 0.0000 Constraint 267 732 0.8000 1.0000 2.0000 0.0000 Constraint 267 725 0.8000 1.0000 2.0000 0.0000 Constraint 267 714 0.8000 1.0000 2.0000 0.0000 Constraint 267 707 0.8000 1.0000 2.0000 0.0000 Constraint 267 696 0.8000 1.0000 2.0000 0.0000 Constraint 267 685 0.8000 1.0000 2.0000 0.0000 Constraint 267 673 0.8000 1.0000 2.0000 0.0000 Constraint 267 664 0.8000 1.0000 2.0000 0.0000 Constraint 267 657 0.8000 1.0000 2.0000 0.0000 Constraint 267 649 0.8000 1.0000 2.0000 0.0000 Constraint 267 644 0.8000 1.0000 2.0000 0.0000 Constraint 267 634 0.8000 1.0000 2.0000 0.0000 Constraint 267 623 0.8000 1.0000 2.0000 0.0000 Constraint 267 616 0.8000 1.0000 2.0000 0.0000 Constraint 267 608 0.8000 1.0000 2.0000 0.0000 Constraint 267 581 0.8000 1.0000 2.0000 0.0000 Constraint 267 572 0.8000 1.0000 2.0000 0.0000 Constraint 267 544 0.8000 1.0000 2.0000 0.0000 Constraint 267 536 0.8000 1.0000 2.0000 0.0000 Constraint 267 523 0.8000 1.0000 2.0000 0.0000 Constraint 267 518 0.8000 1.0000 2.0000 0.0000 Constraint 267 510 0.8000 1.0000 2.0000 0.0000 Constraint 267 496 0.8000 1.0000 2.0000 0.0000 Constraint 267 490 0.8000 1.0000 2.0000 0.0000 Constraint 267 479 0.8000 1.0000 2.0000 0.0000 Constraint 267 471 0.8000 1.0000 2.0000 0.0000 Constraint 267 460 0.8000 1.0000 2.0000 0.0000 Constraint 267 451 0.8000 1.0000 2.0000 0.0000 Constraint 267 446 0.8000 1.0000 2.0000 0.0000 Constraint 267 441 0.8000 1.0000 2.0000 0.0000 Constraint 267 436 0.8000 1.0000 2.0000 0.0000 Constraint 267 428 0.8000 1.0000 2.0000 0.0000 Constraint 267 419 0.8000 1.0000 2.0000 0.0000 Constraint 267 413 0.8000 1.0000 2.0000 0.0000 Constraint 267 406 0.8000 1.0000 2.0000 0.0000 Constraint 267 399 0.8000 1.0000 2.0000 0.0000 Constraint 267 392 0.8000 1.0000 2.0000 0.0000 Constraint 267 384 0.8000 1.0000 2.0000 0.0000 Constraint 267 368 0.8000 1.0000 2.0000 0.0000 Constraint 267 357 0.8000 1.0000 2.0000 0.0000 Constraint 267 349 0.8000 1.0000 2.0000 0.0000 Constraint 267 341 0.8000 1.0000 2.0000 0.0000 Constraint 267 324 0.8000 1.0000 2.0000 0.0000 Constraint 267 317 0.8000 1.0000 2.0000 0.0000 Constraint 267 310 0.8000 1.0000 2.0000 0.0000 Constraint 267 302 0.8000 1.0000 2.0000 0.0000 Constraint 267 293 0.8000 1.0000 2.0000 0.0000 Constraint 267 287 0.8000 1.0000 2.0000 0.0000 Constraint 267 276 0.8000 1.0000 2.0000 0.0000 Constraint 260 1144 0.8000 1.0000 2.0000 0.0000 Constraint 260 1135 0.8000 1.0000 2.0000 0.0000 Constraint 260 1126 0.8000 1.0000 2.0000 0.0000 Constraint 260 1115 0.8000 1.0000 2.0000 0.0000 Constraint 260 1106 0.8000 1.0000 2.0000 0.0000 Constraint 260 1101 0.8000 1.0000 2.0000 0.0000 Constraint 260 1093 0.8000 1.0000 2.0000 0.0000 Constraint 260 1082 0.8000 1.0000 2.0000 0.0000 Constraint 260 1075 0.8000 1.0000 2.0000 0.0000 Constraint 260 1067 0.8000 1.0000 2.0000 0.0000 Constraint 260 1059 0.8000 1.0000 2.0000 0.0000 Constraint 260 1052 0.8000 1.0000 2.0000 0.0000 Constraint 260 1043 0.8000 1.0000 2.0000 0.0000 Constraint 260 1038 0.8000 1.0000 2.0000 0.0000 Constraint 260 1033 0.8000 1.0000 2.0000 0.0000 Constraint 260 1017 0.8000 1.0000 2.0000 0.0000 Constraint 260 1012 0.8000 1.0000 2.0000 0.0000 Constraint 260 1001 0.8000 1.0000 2.0000 0.0000 Constraint 260 992 0.8000 1.0000 2.0000 0.0000 Constraint 260 986 0.8000 1.0000 2.0000 0.0000 Constraint 260 977 0.8000 1.0000 2.0000 0.0000 Constraint 260 969 0.8000 1.0000 2.0000 0.0000 Constraint 260 961 0.8000 1.0000 2.0000 0.0000 Constraint 260 955 0.8000 1.0000 2.0000 0.0000 Constraint 260 950 0.8000 1.0000 2.0000 0.0000 Constraint 260 940 0.8000 1.0000 2.0000 0.0000 Constraint 260 932 0.8000 1.0000 2.0000 0.0000 Constraint 260 927 0.8000 1.0000 2.0000 0.0000 Constraint 260 916 0.8000 1.0000 2.0000 0.0000 Constraint 260 909 0.8000 1.0000 2.0000 0.0000 Constraint 260 901 0.8000 1.0000 2.0000 0.0000 Constraint 260 887 0.8000 1.0000 2.0000 0.0000 Constraint 260 878 0.8000 1.0000 2.0000 0.0000 Constraint 260 869 0.8000 1.0000 2.0000 0.0000 Constraint 260 858 0.8000 1.0000 2.0000 0.0000 Constraint 260 849 0.8000 1.0000 2.0000 0.0000 Constraint 260 844 0.8000 1.0000 2.0000 0.0000 Constraint 260 809 0.8000 1.0000 2.0000 0.0000 Constraint 260 771 0.8000 1.0000 2.0000 0.0000 Constraint 260 752 0.8000 1.0000 2.0000 0.0000 Constraint 260 746 0.8000 1.0000 2.0000 0.0000 Constraint 260 738 0.8000 1.0000 2.0000 0.0000 Constraint 260 732 0.8000 1.0000 2.0000 0.0000 Constraint 260 725 0.8000 1.0000 2.0000 0.0000 Constraint 260 714 0.8000 1.0000 2.0000 0.0000 Constraint 260 707 0.8000 1.0000 2.0000 0.0000 Constraint 260 696 0.8000 1.0000 2.0000 0.0000 Constraint 260 685 0.8000 1.0000 2.0000 0.0000 Constraint 260 673 0.8000 1.0000 2.0000 0.0000 Constraint 260 664 0.8000 1.0000 2.0000 0.0000 Constraint 260 657 0.8000 1.0000 2.0000 0.0000 Constraint 260 649 0.8000 1.0000 2.0000 0.0000 Constraint 260 644 0.8000 1.0000 2.0000 0.0000 Constraint 260 634 0.8000 1.0000 2.0000 0.0000 Constraint 260 623 0.8000 1.0000 2.0000 0.0000 Constraint 260 616 0.8000 1.0000 2.0000 0.0000 Constraint 260 608 0.8000 1.0000 2.0000 0.0000 Constraint 260 581 0.8000 1.0000 2.0000 0.0000 Constraint 260 572 0.8000 1.0000 2.0000 0.0000 Constraint 260 544 0.8000 1.0000 2.0000 0.0000 Constraint 260 536 0.8000 1.0000 2.0000 0.0000 Constraint 260 523 0.8000 1.0000 2.0000 0.0000 Constraint 260 518 0.8000 1.0000 2.0000 0.0000 Constraint 260 510 0.8000 1.0000 2.0000 0.0000 Constraint 260 496 0.8000 1.0000 2.0000 0.0000 Constraint 260 490 0.8000 1.0000 2.0000 0.0000 Constraint 260 479 0.8000 1.0000 2.0000 0.0000 Constraint 260 446 0.8000 1.0000 2.0000 0.0000 Constraint 260 441 0.8000 1.0000 2.0000 0.0000 Constraint 260 436 0.8000 1.0000 2.0000 0.0000 Constraint 260 428 0.8000 1.0000 2.0000 0.0000 Constraint 260 419 0.8000 1.0000 2.0000 0.0000 Constraint 260 413 0.8000 1.0000 2.0000 0.0000 Constraint 260 406 0.8000 1.0000 2.0000 0.0000 Constraint 260 399 0.8000 1.0000 2.0000 0.0000 Constraint 260 384 0.8000 1.0000 2.0000 0.0000 Constraint 260 368 0.8000 1.0000 2.0000 0.0000 Constraint 260 357 0.8000 1.0000 2.0000 0.0000 Constraint 260 349 0.8000 1.0000 2.0000 0.0000 Constraint 260 341 0.8000 1.0000 2.0000 0.0000 Constraint 260 336 0.8000 1.0000 2.0000 0.0000 Constraint 260 324 0.8000 1.0000 2.0000 0.0000 Constraint 260 317 0.8000 1.0000 2.0000 0.0000 Constraint 260 310 0.8000 1.0000 2.0000 0.0000 Constraint 260 302 0.8000 1.0000 2.0000 0.0000 Constraint 260 293 0.8000 1.0000 2.0000 0.0000 Constraint 260 287 0.8000 1.0000 2.0000 0.0000 Constraint 260 276 0.8000 1.0000 2.0000 0.0000 Constraint 260 267 0.8000 1.0000 2.0000 0.0000 Constraint 253 1144 0.8000 1.0000 2.0000 0.0000 Constraint 253 1135 0.8000 1.0000 2.0000 0.0000 Constraint 253 1126 0.8000 1.0000 2.0000 0.0000 Constraint 253 1115 0.8000 1.0000 2.0000 0.0000 Constraint 253 1101 0.8000 1.0000 2.0000 0.0000 Constraint 253 1093 0.8000 1.0000 2.0000 0.0000 Constraint 253 1082 0.8000 1.0000 2.0000 0.0000 Constraint 253 1075 0.8000 1.0000 2.0000 0.0000 Constraint 253 1067 0.8000 1.0000 2.0000 0.0000 Constraint 253 1059 0.8000 1.0000 2.0000 0.0000 Constraint 253 1052 0.8000 1.0000 2.0000 0.0000 Constraint 253 1043 0.8000 1.0000 2.0000 0.0000 Constraint 253 1038 0.8000 1.0000 2.0000 0.0000 Constraint 253 1033 0.8000 1.0000 2.0000 0.0000 Constraint 253 1025 0.8000 1.0000 2.0000 0.0000 Constraint 253 1017 0.8000 1.0000 2.0000 0.0000 Constraint 253 1012 0.8000 1.0000 2.0000 0.0000 Constraint 253 1001 0.8000 1.0000 2.0000 0.0000 Constraint 253 992 0.8000 1.0000 2.0000 0.0000 Constraint 253 986 0.8000 1.0000 2.0000 0.0000 Constraint 253 977 0.8000 1.0000 2.0000 0.0000 Constraint 253 969 0.8000 1.0000 2.0000 0.0000 Constraint 253 961 0.8000 1.0000 2.0000 0.0000 Constraint 253 955 0.8000 1.0000 2.0000 0.0000 Constraint 253 950 0.8000 1.0000 2.0000 0.0000 Constraint 253 940 0.8000 1.0000 2.0000 0.0000 Constraint 253 932 0.8000 1.0000 2.0000 0.0000 Constraint 253 927 0.8000 1.0000 2.0000 0.0000 Constraint 253 916 0.8000 1.0000 2.0000 0.0000 Constraint 253 909 0.8000 1.0000 2.0000 0.0000 Constraint 253 869 0.8000 1.0000 2.0000 0.0000 Constraint 253 858 0.8000 1.0000 2.0000 0.0000 Constraint 253 833 0.8000 1.0000 2.0000 0.0000 Constraint 253 809 0.8000 1.0000 2.0000 0.0000 Constraint 253 782 0.8000 1.0000 2.0000 0.0000 Constraint 253 771 0.8000 1.0000 2.0000 0.0000 Constraint 253 752 0.8000 1.0000 2.0000 0.0000 Constraint 253 746 0.8000 1.0000 2.0000 0.0000 Constraint 253 738 0.8000 1.0000 2.0000 0.0000 Constraint 253 732 0.8000 1.0000 2.0000 0.0000 Constraint 253 725 0.8000 1.0000 2.0000 0.0000 Constraint 253 714 0.8000 1.0000 2.0000 0.0000 Constraint 253 707 0.8000 1.0000 2.0000 0.0000 Constraint 253 696 0.8000 1.0000 2.0000 0.0000 Constraint 253 685 0.8000 1.0000 2.0000 0.0000 Constraint 253 673 0.8000 1.0000 2.0000 0.0000 Constraint 253 664 0.8000 1.0000 2.0000 0.0000 Constraint 253 657 0.8000 1.0000 2.0000 0.0000 Constraint 253 649 0.8000 1.0000 2.0000 0.0000 Constraint 253 644 0.8000 1.0000 2.0000 0.0000 Constraint 253 634 0.8000 1.0000 2.0000 0.0000 Constraint 253 623 0.8000 1.0000 2.0000 0.0000 Constraint 253 616 0.8000 1.0000 2.0000 0.0000 Constraint 253 608 0.8000 1.0000 2.0000 0.0000 Constraint 253 581 0.8000 1.0000 2.0000 0.0000 Constraint 253 572 0.8000 1.0000 2.0000 0.0000 Constraint 253 564 0.8000 1.0000 2.0000 0.0000 Constraint 253 544 0.8000 1.0000 2.0000 0.0000 Constraint 253 536 0.8000 1.0000 2.0000 0.0000 Constraint 253 528 0.8000 1.0000 2.0000 0.0000 Constraint 253 523 0.8000 1.0000 2.0000 0.0000 Constraint 253 518 0.8000 1.0000 2.0000 0.0000 Constraint 253 510 0.8000 1.0000 2.0000 0.0000 Constraint 253 496 0.8000 1.0000 2.0000 0.0000 Constraint 253 490 0.8000 1.0000 2.0000 0.0000 Constraint 253 479 0.8000 1.0000 2.0000 0.0000 Constraint 253 471 0.8000 1.0000 2.0000 0.0000 Constraint 253 460 0.8000 1.0000 2.0000 0.0000 Constraint 253 451 0.8000 1.0000 2.0000 0.0000 Constraint 253 441 0.8000 1.0000 2.0000 0.0000 Constraint 253 436 0.8000 1.0000 2.0000 0.0000 Constraint 253 413 0.8000 1.0000 2.0000 0.0000 Constraint 253 406 0.8000 1.0000 2.0000 0.0000 Constraint 253 399 0.8000 1.0000 2.0000 0.0000 Constraint 253 384 0.8000 1.0000 2.0000 0.0000 Constraint 253 368 0.8000 1.0000 2.0000 0.0000 Constraint 253 357 0.8000 1.0000 2.0000 0.0000 Constraint 253 349 0.8000 1.0000 2.0000 0.0000 Constraint 253 341 0.8000 1.0000 2.0000 0.0000 Constraint 253 336 0.8000 1.0000 2.0000 0.0000 Constraint 253 317 0.8000 1.0000 2.0000 0.0000 Constraint 253 310 0.8000 1.0000 2.0000 0.0000 Constraint 253 302 0.8000 1.0000 2.0000 0.0000 Constraint 253 293 0.8000 1.0000 2.0000 0.0000 Constraint 253 287 0.8000 1.0000 2.0000 0.0000 Constraint 253 276 0.8000 1.0000 2.0000 0.0000 Constraint 253 267 0.8000 1.0000 2.0000 0.0000 Constraint 253 260 0.8000 1.0000 2.0000 0.0000 Constraint 245 1144 0.8000 1.0000 2.0000 0.0000 Constraint 245 1135 0.8000 1.0000 2.0000 0.0000 Constraint 245 1126 0.8000 1.0000 2.0000 0.0000 Constraint 245 1101 0.8000 1.0000 2.0000 0.0000 Constraint 245 1093 0.8000 1.0000 2.0000 0.0000 Constraint 245 1075 0.8000 1.0000 2.0000 0.0000 Constraint 245 1067 0.8000 1.0000 2.0000 0.0000 Constraint 245 1059 0.8000 1.0000 2.0000 0.0000 Constraint 245 1043 0.8000 1.0000 2.0000 0.0000 Constraint 245 1038 0.8000 1.0000 2.0000 0.0000 Constraint 245 1033 0.8000 1.0000 2.0000 0.0000 Constraint 245 1025 0.8000 1.0000 2.0000 0.0000 Constraint 245 1017 0.8000 1.0000 2.0000 0.0000 Constraint 245 1012 0.8000 1.0000 2.0000 0.0000 Constraint 245 1001 0.8000 1.0000 2.0000 0.0000 Constraint 245 992 0.8000 1.0000 2.0000 0.0000 Constraint 245 986 0.8000 1.0000 2.0000 0.0000 Constraint 245 977 0.8000 1.0000 2.0000 0.0000 Constraint 245 969 0.8000 1.0000 2.0000 0.0000 Constraint 245 961 0.8000 1.0000 2.0000 0.0000 Constraint 245 955 0.8000 1.0000 2.0000 0.0000 Constraint 245 950 0.8000 1.0000 2.0000 0.0000 Constraint 245 940 0.8000 1.0000 2.0000 0.0000 Constraint 245 932 0.8000 1.0000 2.0000 0.0000 Constraint 245 927 0.8000 1.0000 2.0000 0.0000 Constraint 245 916 0.8000 1.0000 2.0000 0.0000 Constraint 245 909 0.8000 1.0000 2.0000 0.0000 Constraint 245 844 0.8000 1.0000 2.0000 0.0000 Constraint 245 809 0.8000 1.0000 2.0000 0.0000 Constraint 245 782 0.8000 1.0000 2.0000 0.0000 Constraint 245 771 0.8000 1.0000 2.0000 0.0000 Constraint 245 758 0.8000 1.0000 2.0000 0.0000 Constraint 245 746 0.8000 1.0000 2.0000 0.0000 Constraint 245 738 0.8000 1.0000 2.0000 0.0000 Constraint 245 732 0.8000 1.0000 2.0000 0.0000 Constraint 245 725 0.8000 1.0000 2.0000 0.0000 Constraint 245 714 0.8000 1.0000 2.0000 0.0000 Constraint 245 707 0.8000 1.0000 2.0000 0.0000 Constraint 245 696 0.8000 1.0000 2.0000 0.0000 Constraint 245 685 0.8000 1.0000 2.0000 0.0000 Constraint 245 673 0.8000 1.0000 2.0000 0.0000 Constraint 245 664 0.8000 1.0000 2.0000 0.0000 Constraint 245 657 0.8000 1.0000 2.0000 0.0000 Constraint 245 649 0.8000 1.0000 2.0000 0.0000 Constraint 245 644 0.8000 1.0000 2.0000 0.0000 Constraint 245 634 0.8000 1.0000 2.0000 0.0000 Constraint 245 623 0.8000 1.0000 2.0000 0.0000 Constraint 245 616 0.8000 1.0000 2.0000 0.0000 Constraint 245 608 0.8000 1.0000 2.0000 0.0000 Constraint 245 581 0.8000 1.0000 2.0000 0.0000 Constraint 245 572 0.8000 1.0000 2.0000 0.0000 Constraint 245 544 0.8000 1.0000 2.0000 0.0000 Constraint 245 536 0.8000 1.0000 2.0000 0.0000 Constraint 245 523 0.8000 1.0000 2.0000 0.0000 Constraint 245 518 0.8000 1.0000 2.0000 0.0000 Constraint 245 510 0.8000 1.0000 2.0000 0.0000 Constraint 245 502 0.8000 1.0000 2.0000 0.0000 Constraint 245 496 0.8000 1.0000 2.0000 0.0000 Constraint 245 490 0.8000 1.0000 2.0000 0.0000 Constraint 245 479 0.8000 1.0000 2.0000 0.0000 Constraint 245 460 0.8000 1.0000 2.0000 0.0000 Constraint 245 451 0.8000 1.0000 2.0000 0.0000 Constraint 245 446 0.8000 1.0000 2.0000 0.0000 Constraint 245 441 0.8000 1.0000 2.0000 0.0000 Constraint 245 436 0.8000 1.0000 2.0000 0.0000 Constraint 245 428 0.8000 1.0000 2.0000 0.0000 Constraint 245 419 0.8000 1.0000 2.0000 0.0000 Constraint 245 413 0.8000 1.0000 2.0000 0.0000 Constraint 245 406 0.8000 1.0000 2.0000 0.0000 Constraint 245 399 0.8000 1.0000 2.0000 0.0000 Constraint 245 392 0.8000 1.0000 2.0000 0.0000 Constraint 245 384 0.8000 1.0000 2.0000 0.0000 Constraint 245 368 0.8000 1.0000 2.0000 0.0000 Constraint 245 349 0.8000 1.0000 2.0000 0.0000 Constraint 245 341 0.8000 1.0000 2.0000 0.0000 Constraint 245 336 0.8000 1.0000 2.0000 0.0000 Constraint 245 310 0.8000 1.0000 2.0000 0.0000 Constraint 245 302 0.8000 1.0000 2.0000 0.0000 Constraint 245 293 0.8000 1.0000 2.0000 0.0000 Constraint 245 287 0.8000 1.0000 2.0000 0.0000 Constraint 245 276 0.8000 1.0000 2.0000 0.0000 Constraint 245 267 0.8000 1.0000 2.0000 0.0000 Constraint 245 260 0.8000 1.0000 2.0000 0.0000 Constraint 245 253 0.8000 1.0000 2.0000 0.0000 Constraint 240 1144 0.8000 1.0000 2.0000 0.0000 Constraint 240 1135 0.8000 1.0000 2.0000 0.0000 Constraint 240 1126 0.8000 1.0000 2.0000 0.0000 Constraint 240 1115 0.8000 1.0000 2.0000 0.0000 Constraint 240 1106 0.8000 1.0000 2.0000 0.0000 Constraint 240 1101 0.8000 1.0000 2.0000 0.0000 Constraint 240 1093 0.8000 1.0000 2.0000 0.0000 Constraint 240 1082 0.8000 1.0000 2.0000 0.0000 Constraint 240 1075 0.8000 1.0000 2.0000 0.0000 Constraint 240 1067 0.8000 1.0000 2.0000 0.0000 Constraint 240 1059 0.8000 1.0000 2.0000 0.0000 Constraint 240 1052 0.8000 1.0000 2.0000 0.0000 Constraint 240 1043 0.8000 1.0000 2.0000 0.0000 Constraint 240 1038 0.8000 1.0000 2.0000 0.0000 Constraint 240 1033 0.8000 1.0000 2.0000 0.0000 Constraint 240 1025 0.8000 1.0000 2.0000 0.0000 Constraint 240 1017 0.8000 1.0000 2.0000 0.0000 Constraint 240 1012 0.8000 1.0000 2.0000 0.0000 Constraint 240 1001 0.8000 1.0000 2.0000 0.0000 Constraint 240 992 0.8000 1.0000 2.0000 0.0000 Constraint 240 986 0.8000 1.0000 2.0000 0.0000 Constraint 240 977 0.8000 1.0000 2.0000 0.0000 Constraint 240 969 0.8000 1.0000 2.0000 0.0000 Constraint 240 961 0.8000 1.0000 2.0000 0.0000 Constraint 240 950 0.8000 1.0000 2.0000 0.0000 Constraint 240 940 0.8000 1.0000 2.0000 0.0000 Constraint 240 909 0.8000 1.0000 2.0000 0.0000 Constraint 240 869 0.8000 1.0000 2.0000 0.0000 Constraint 240 844 0.8000 1.0000 2.0000 0.0000 Constraint 240 809 0.8000 1.0000 2.0000 0.0000 Constraint 240 782 0.8000 1.0000 2.0000 0.0000 Constraint 240 771 0.8000 1.0000 2.0000 0.0000 Constraint 240 758 0.8000 1.0000 2.0000 0.0000 Constraint 240 752 0.8000 1.0000 2.0000 0.0000 Constraint 240 746 0.8000 1.0000 2.0000 0.0000 Constraint 240 738 0.8000 1.0000 2.0000 0.0000 Constraint 240 732 0.8000 1.0000 2.0000 0.0000 Constraint 240 725 0.8000 1.0000 2.0000 0.0000 Constraint 240 714 0.8000 1.0000 2.0000 0.0000 Constraint 240 707 0.8000 1.0000 2.0000 0.0000 Constraint 240 696 0.8000 1.0000 2.0000 0.0000 Constraint 240 685 0.8000 1.0000 2.0000 0.0000 Constraint 240 673 0.8000 1.0000 2.0000 0.0000 Constraint 240 664 0.8000 1.0000 2.0000 0.0000 Constraint 240 657 0.8000 1.0000 2.0000 0.0000 Constraint 240 649 0.8000 1.0000 2.0000 0.0000 Constraint 240 644 0.8000 1.0000 2.0000 0.0000 Constraint 240 634 0.8000 1.0000 2.0000 0.0000 Constraint 240 623 0.8000 1.0000 2.0000 0.0000 Constraint 240 616 0.8000 1.0000 2.0000 0.0000 Constraint 240 608 0.8000 1.0000 2.0000 0.0000 Constraint 240 581 0.8000 1.0000 2.0000 0.0000 Constraint 240 572 0.8000 1.0000 2.0000 0.0000 Constraint 240 544 0.8000 1.0000 2.0000 0.0000 Constraint 240 536 0.8000 1.0000 2.0000 0.0000 Constraint 240 523 0.8000 1.0000 2.0000 0.0000 Constraint 240 518 0.8000 1.0000 2.0000 0.0000 Constraint 240 510 0.8000 1.0000 2.0000 0.0000 Constraint 240 502 0.8000 1.0000 2.0000 0.0000 Constraint 240 496 0.8000 1.0000 2.0000 0.0000 Constraint 240 490 0.8000 1.0000 2.0000 0.0000 Constraint 240 479 0.8000 1.0000 2.0000 0.0000 Constraint 240 471 0.8000 1.0000 2.0000 0.0000 Constraint 240 460 0.8000 1.0000 2.0000 0.0000 Constraint 240 451 0.8000 1.0000 2.0000 0.0000 Constraint 240 446 0.8000 1.0000 2.0000 0.0000 Constraint 240 441 0.8000 1.0000 2.0000 0.0000 Constraint 240 436 0.8000 1.0000 2.0000 0.0000 Constraint 240 428 0.8000 1.0000 2.0000 0.0000 Constraint 240 419 0.8000 1.0000 2.0000 0.0000 Constraint 240 413 0.8000 1.0000 2.0000 0.0000 Constraint 240 406 0.8000 1.0000 2.0000 0.0000 Constraint 240 399 0.8000 1.0000 2.0000 0.0000 Constraint 240 392 0.8000 1.0000 2.0000 0.0000 Constraint 240 384 0.8000 1.0000 2.0000 0.0000 Constraint 240 368 0.8000 1.0000 2.0000 0.0000 Constraint 240 357 0.8000 1.0000 2.0000 0.0000 Constraint 240 349 0.8000 1.0000 2.0000 0.0000 Constraint 240 341 0.8000 1.0000 2.0000 0.0000 Constraint 240 336 0.8000 1.0000 2.0000 0.0000 Constraint 240 324 0.8000 1.0000 2.0000 0.0000 Constraint 240 317 0.8000 1.0000 2.0000 0.0000 Constraint 240 310 0.8000 1.0000 2.0000 0.0000 Constraint 240 302 0.8000 1.0000 2.0000 0.0000 Constraint 240 293 0.8000 1.0000 2.0000 0.0000 Constraint 240 287 0.8000 1.0000 2.0000 0.0000 Constraint 240 276 0.8000 1.0000 2.0000 0.0000 Constraint 240 267 0.8000 1.0000 2.0000 0.0000 Constraint 240 260 0.8000 1.0000 2.0000 0.0000 Constraint 240 253 0.8000 1.0000 2.0000 0.0000 Constraint 240 245 0.8000 1.0000 2.0000 0.0000 Constraint 231 1144 0.8000 1.0000 2.0000 0.0000 Constraint 231 1135 0.8000 1.0000 2.0000 0.0000 Constraint 231 1126 0.8000 1.0000 2.0000 0.0000 Constraint 231 1115 0.8000 1.0000 2.0000 0.0000 Constraint 231 1106 0.8000 1.0000 2.0000 0.0000 Constraint 231 1101 0.8000 1.0000 2.0000 0.0000 Constraint 231 1093 0.8000 1.0000 2.0000 0.0000 Constraint 231 1082 0.8000 1.0000 2.0000 0.0000 Constraint 231 1075 0.8000 1.0000 2.0000 0.0000 Constraint 231 1067 0.8000 1.0000 2.0000 0.0000 Constraint 231 1059 0.8000 1.0000 2.0000 0.0000 Constraint 231 1052 0.8000 1.0000 2.0000 0.0000 Constraint 231 1043 0.8000 1.0000 2.0000 0.0000 Constraint 231 1038 0.8000 1.0000 2.0000 0.0000 Constraint 231 1033 0.8000 1.0000 2.0000 0.0000 Constraint 231 1025 0.8000 1.0000 2.0000 0.0000 Constraint 231 1017 0.8000 1.0000 2.0000 0.0000 Constraint 231 1012 0.8000 1.0000 2.0000 0.0000 Constraint 231 1001 0.8000 1.0000 2.0000 0.0000 Constraint 231 992 0.8000 1.0000 2.0000 0.0000 Constraint 231 986 0.8000 1.0000 2.0000 0.0000 Constraint 231 977 0.8000 1.0000 2.0000 0.0000 Constraint 231 969 0.8000 1.0000 2.0000 0.0000 Constraint 231 961 0.8000 1.0000 2.0000 0.0000 Constraint 231 955 0.8000 1.0000 2.0000 0.0000 Constraint 231 950 0.8000 1.0000 2.0000 0.0000 Constraint 231 940 0.8000 1.0000 2.0000 0.0000 Constraint 231 932 0.8000 1.0000 2.0000 0.0000 Constraint 231 927 0.8000 1.0000 2.0000 0.0000 Constraint 231 916 0.8000 1.0000 2.0000 0.0000 Constraint 231 909 0.8000 1.0000 2.0000 0.0000 Constraint 231 901 0.8000 1.0000 2.0000 0.0000 Constraint 231 887 0.8000 1.0000 2.0000 0.0000 Constraint 231 869 0.8000 1.0000 2.0000 0.0000 Constraint 231 858 0.8000 1.0000 2.0000 0.0000 Constraint 231 833 0.8000 1.0000 2.0000 0.0000 Constraint 231 825 0.8000 1.0000 2.0000 0.0000 Constraint 231 809 0.8000 1.0000 2.0000 0.0000 Constraint 231 782 0.8000 1.0000 2.0000 0.0000 Constraint 231 771 0.8000 1.0000 2.0000 0.0000 Constraint 231 758 0.8000 1.0000 2.0000 0.0000 Constraint 231 752 0.8000 1.0000 2.0000 0.0000 Constraint 231 746 0.8000 1.0000 2.0000 0.0000 Constraint 231 738 0.8000 1.0000 2.0000 0.0000 Constraint 231 732 0.8000 1.0000 2.0000 0.0000 Constraint 231 725 0.8000 1.0000 2.0000 0.0000 Constraint 231 714 0.8000 1.0000 2.0000 0.0000 Constraint 231 707 0.8000 1.0000 2.0000 0.0000 Constraint 231 696 0.8000 1.0000 2.0000 0.0000 Constraint 231 685 0.8000 1.0000 2.0000 0.0000 Constraint 231 673 0.8000 1.0000 2.0000 0.0000 Constraint 231 664 0.8000 1.0000 2.0000 0.0000 Constraint 231 657 0.8000 1.0000 2.0000 0.0000 Constraint 231 649 0.8000 1.0000 2.0000 0.0000 Constraint 231 644 0.8000 1.0000 2.0000 0.0000 Constraint 231 634 0.8000 1.0000 2.0000 0.0000 Constraint 231 623 0.8000 1.0000 2.0000 0.0000 Constraint 231 616 0.8000 1.0000 2.0000 0.0000 Constraint 231 608 0.8000 1.0000 2.0000 0.0000 Constraint 231 581 0.8000 1.0000 2.0000 0.0000 Constraint 231 572 0.8000 1.0000 2.0000 0.0000 Constraint 231 544 0.8000 1.0000 2.0000 0.0000 Constraint 231 536 0.8000 1.0000 2.0000 0.0000 Constraint 231 528 0.8000 1.0000 2.0000 0.0000 Constraint 231 523 0.8000 1.0000 2.0000 0.0000 Constraint 231 518 0.8000 1.0000 2.0000 0.0000 Constraint 231 510 0.8000 1.0000 2.0000 0.0000 Constraint 231 502 0.8000 1.0000 2.0000 0.0000 Constraint 231 496 0.8000 1.0000 2.0000 0.0000 Constraint 231 490 0.8000 1.0000 2.0000 0.0000 Constraint 231 479 0.8000 1.0000 2.0000 0.0000 Constraint 231 471 0.8000 1.0000 2.0000 0.0000 Constraint 231 460 0.8000 1.0000 2.0000 0.0000 Constraint 231 451 0.8000 1.0000 2.0000 0.0000 Constraint 231 446 0.8000 1.0000 2.0000 0.0000 Constraint 231 441 0.8000 1.0000 2.0000 0.0000 Constraint 231 436 0.8000 1.0000 2.0000 0.0000 Constraint 231 428 0.8000 1.0000 2.0000 0.0000 Constraint 231 419 0.8000 1.0000 2.0000 0.0000 Constraint 231 413 0.8000 1.0000 2.0000 0.0000 Constraint 231 406 0.8000 1.0000 2.0000 0.0000 Constraint 231 399 0.8000 1.0000 2.0000 0.0000 Constraint 231 392 0.8000 1.0000 2.0000 0.0000 Constraint 231 384 0.8000 1.0000 2.0000 0.0000 Constraint 231 368 0.8000 1.0000 2.0000 0.0000 Constraint 231 357 0.8000 1.0000 2.0000 0.0000 Constraint 231 349 0.8000 1.0000 2.0000 0.0000 Constraint 231 341 0.8000 1.0000 2.0000 0.0000 Constraint 231 336 0.8000 1.0000 2.0000 0.0000 Constraint 231 324 0.8000 1.0000 2.0000 0.0000 Constraint 231 317 0.8000 1.0000 2.0000 0.0000 Constraint 231 310 0.8000 1.0000 2.0000 0.0000 Constraint 231 293 0.8000 1.0000 2.0000 0.0000 Constraint 231 287 0.8000 1.0000 2.0000 0.0000 Constraint 231 276 0.8000 1.0000 2.0000 0.0000 Constraint 231 267 0.8000 1.0000 2.0000 0.0000 Constraint 231 260 0.8000 1.0000 2.0000 0.0000 Constraint 231 253 0.8000 1.0000 2.0000 0.0000 Constraint 231 245 0.8000 1.0000 2.0000 0.0000 Constraint 231 240 0.8000 1.0000 2.0000 0.0000 Constraint 226 1144 0.8000 1.0000 2.0000 0.0000 Constraint 226 1135 0.8000 1.0000 2.0000 0.0000 Constraint 226 1126 0.8000 1.0000 2.0000 0.0000 Constraint 226 1115 0.8000 1.0000 2.0000 0.0000 Constraint 226 1106 0.8000 1.0000 2.0000 0.0000 Constraint 226 1101 0.8000 1.0000 2.0000 0.0000 Constraint 226 1093 0.8000 1.0000 2.0000 0.0000 Constraint 226 1082 0.8000 1.0000 2.0000 0.0000 Constraint 226 1075 0.8000 1.0000 2.0000 0.0000 Constraint 226 1067 0.8000 1.0000 2.0000 0.0000 Constraint 226 1059 0.8000 1.0000 2.0000 0.0000 Constraint 226 1052 0.8000 1.0000 2.0000 0.0000 Constraint 226 1043 0.8000 1.0000 2.0000 0.0000 Constraint 226 1038 0.8000 1.0000 2.0000 0.0000 Constraint 226 1033 0.8000 1.0000 2.0000 0.0000 Constraint 226 1025 0.8000 1.0000 2.0000 0.0000 Constraint 226 1017 0.8000 1.0000 2.0000 0.0000 Constraint 226 1012 0.8000 1.0000 2.0000 0.0000 Constraint 226 1001 0.8000 1.0000 2.0000 0.0000 Constraint 226 992 0.8000 1.0000 2.0000 0.0000 Constraint 226 986 0.8000 1.0000 2.0000 0.0000 Constraint 226 977 0.8000 1.0000 2.0000 0.0000 Constraint 226 969 0.8000 1.0000 2.0000 0.0000 Constraint 226 961 0.8000 1.0000 2.0000 0.0000 Constraint 226 955 0.8000 1.0000 2.0000 0.0000 Constraint 226 950 0.8000 1.0000 2.0000 0.0000 Constraint 226 940 0.8000 1.0000 2.0000 0.0000 Constraint 226 932 0.8000 1.0000 2.0000 0.0000 Constraint 226 916 0.8000 1.0000 2.0000 0.0000 Constraint 226 909 0.8000 1.0000 2.0000 0.0000 Constraint 226 901 0.8000 1.0000 2.0000 0.0000 Constraint 226 869 0.8000 1.0000 2.0000 0.0000 Constraint 226 844 0.8000 1.0000 2.0000 0.0000 Constraint 226 771 0.8000 1.0000 2.0000 0.0000 Constraint 226 758 0.8000 1.0000 2.0000 0.0000 Constraint 226 752 0.8000 1.0000 2.0000 0.0000 Constraint 226 746 0.8000 1.0000 2.0000 0.0000 Constraint 226 714 0.8000 1.0000 2.0000 0.0000 Constraint 226 707 0.8000 1.0000 2.0000 0.0000 Constraint 226 696 0.8000 1.0000 2.0000 0.0000 Constraint 226 685 0.8000 1.0000 2.0000 0.0000 Constraint 226 673 0.8000 1.0000 2.0000 0.0000 Constraint 226 664 0.8000 1.0000 2.0000 0.0000 Constraint 226 657 0.8000 1.0000 2.0000 0.0000 Constraint 226 649 0.8000 1.0000 2.0000 0.0000 Constraint 226 644 0.8000 1.0000 2.0000 0.0000 Constraint 226 623 0.8000 1.0000 2.0000 0.0000 Constraint 226 616 0.8000 1.0000 2.0000 0.0000 Constraint 226 581 0.8000 1.0000 2.0000 0.0000 Constraint 226 572 0.8000 1.0000 2.0000 0.0000 Constraint 226 555 0.8000 1.0000 2.0000 0.0000 Constraint 226 544 0.8000 1.0000 2.0000 0.0000 Constraint 226 528 0.8000 1.0000 2.0000 0.0000 Constraint 226 523 0.8000 1.0000 2.0000 0.0000 Constraint 226 518 0.8000 1.0000 2.0000 0.0000 Constraint 226 502 0.8000 1.0000 2.0000 0.0000 Constraint 226 496 0.8000 1.0000 2.0000 0.0000 Constraint 226 490 0.8000 1.0000 2.0000 0.0000 Constraint 226 479 0.8000 1.0000 2.0000 0.0000 Constraint 226 471 0.8000 1.0000 2.0000 0.0000 Constraint 226 446 0.8000 1.0000 2.0000 0.0000 Constraint 226 441 0.8000 1.0000 2.0000 0.0000 Constraint 226 436 0.8000 1.0000 2.0000 0.0000 Constraint 226 419 0.8000 1.0000 2.0000 0.0000 Constraint 226 413 0.8000 1.0000 2.0000 0.0000 Constraint 226 406 0.8000 1.0000 2.0000 0.0000 Constraint 226 399 0.8000 1.0000 2.0000 0.0000 Constraint 226 384 0.8000 1.0000 2.0000 0.0000 Constraint 226 368 0.8000 1.0000 2.0000 0.0000 Constraint 226 357 0.8000 1.0000 2.0000 0.0000 Constraint 226 349 0.8000 1.0000 2.0000 0.0000 Constraint 226 341 0.8000 1.0000 2.0000 0.0000 Constraint 226 336 0.8000 1.0000 2.0000 0.0000 Constraint 226 317 0.8000 1.0000 2.0000 0.0000 Constraint 226 310 0.8000 1.0000 2.0000 0.0000 Constraint 226 287 0.8000 1.0000 2.0000 0.0000 Constraint 226 276 0.8000 1.0000 2.0000 0.0000 Constraint 226 267 0.8000 1.0000 2.0000 0.0000 Constraint 226 260 0.8000 1.0000 2.0000 0.0000 Constraint 226 253 0.8000 1.0000 2.0000 0.0000 Constraint 226 245 0.8000 1.0000 2.0000 0.0000 Constraint 226 240 0.8000 1.0000 2.0000 0.0000 Constraint 226 231 0.8000 1.0000 2.0000 0.0000 Constraint 217 1144 0.8000 1.0000 2.0000 0.0000 Constraint 217 1135 0.8000 1.0000 2.0000 0.0000 Constraint 217 1126 0.8000 1.0000 2.0000 0.0000 Constraint 217 1115 0.8000 1.0000 2.0000 0.0000 Constraint 217 1106 0.8000 1.0000 2.0000 0.0000 Constraint 217 1101 0.8000 1.0000 2.0000 0.0000 Constraint 217 1093 0.8000 1.0000 2.0000 0.0000 Constraint 217 1082 0.8000 1.0000 2.0000 0.0000 Constraint 217 1075 0.8000 1.0000 2.0000 0.0000 Constraint 217 1067 0.8000 1.0000 2.0000 0.0000 Constraint 217 1059 0.8000 1.0000 2.0000 0.0000 Constraint 217 1052 0.8000 1.0000 2.0000 0.0000 Constraint 217 1043 0.8000 1.0000 2.0000 0.0000 Constraint 217 1038 0.8000 1.0000 2.0000 0.0000 Constraint 217 1033 0.8000 1.0000 2.0000 0.0000 Constraint 217 1025 0.8000 1.0000 2.0000 0.0000 Constraint 217 1017 0.8000 1.0000 2.0000 0.0000 Constraint 217 1012 0.8000 1.0000 2.0000 0.0000 Constraint 217 1001 0.8000 1.0000 2.0000 0.0000 Constraint 217 992 0.8000 1.0000 2.0000 0.0000 Constraint 217 986 0.8000 1.0000 2.0000 0.0000 Constraint 217 977 0.8000 1.0000 2.0000 0.0000 Constraint 217 969 0.8000 1.0000 2.0000 0.0000 Constraint 217 940 0.8000 1.0000 2.0000 0.0000 Constraint 217 771 0.8000 1.0000 2.0000 0.0000 Constraint 217 758 0.8000 1.0000 2.0000 0.0000 Constraint 217 752 0.8000 1.0000 2.0000 0.0000 Constraint 217 746 0.8000 1.0000 2.0000 0.0000 Constraint 217 738 0.8000 1.0000 2.0000 0.0000 Constraint 217 732 0.8000 1.0000 2.0000 0.0000 Constraint 217 725 0.8000 1.0000 2.0000 0.0000 Constraint 217 714 0.8000 1.0000 2.0000 0.0000 Constraint 217 707 0.8000 1.0000 2.0000 0.0000 Constraint 217 696 0.8000 1.0000 2.0000 0.0000 Constraint 217 685 0.8000 1.0000 2.0000 0.0000 Constraint 217 673 0.8000 1.0000 2.0000 0.0000 Constraint 217 664 0.8000 1.0000 2.0000 0.0000 Constraint 217 657 0.8000 1.0000 2.0000 0.0000 Constraint 217 649 0.8000 1.0000 2.0000 0.0000 Constraint 217 644 0.8000 1.0000 2.0000 0.0000 Constraint 217 634 0.8000 1.0000 2.0000 0.0000 Constraint 217 623 0.8000 1.0000 2.0000 0.0000 Constraint 217 616 0.8000 1.0000 2.0000 0.0000 Constraint 217 608 0.8000 1.0000 2.0000 0.0000 Constraint 217 572 0.8000 1.0000 2.0000 0.0000 Constraint 217 544 0.8000 1.0000 2.0000 0.0000 Constraint 217 536 0.8000 1.0000 2.0000 0.0000 Constraint 217 523 0.8000 1.0000 2.0000 0.0000 Constraint 217 518 0.8000 1.0000 2.0000 0.0000 Constraint 217 510 0.8000 1.0000 2.0000 0.0000 Constraint 217 502 0.8000 1.0000 2.0000 0.0000 Constraint 217 496 0.8000 1.0000 2.0000 0.0000 Constraint 217 490 0.8000 1.0000 2.0000 0.0000 Constraint 217 479 0.8000 1.0000 2.0000 0.0000 Constraint 217 471 0.8000 1.0000 2.0000 0.0000 Constraint 217 460 0.8000 1.0000 2.0000 0.0000 Constraint 217 441 0.8000 1.0000 2.0000 0.0000 Constraint 217 436 0.8000 1.0000 2.0000 0.0000 Constraint 217 413 0.8000 1.0000 2.0000 0.0000 Constraint 217 406 0.8000 1.0000 2.0000 0.0000 Constraint 217 399 0.8000 1.0000 2.0000 0.0000 Constraint 217 384 0.8000 1.0000 2.0000 0.0000 Constraint 217 368 0.8000 1.0000 2.0000 0.0000 Constraint 217 349 0.8000 1.0000 2.0000 0.0000 Constraint 217 341 0.8000 1.0000 2.0000 0.0000 Constraint 217 336 0.8000 1.0000 2.0000 0.0000 Constraint 217 276 0.8000 1.0000 2.0000 0.0000 Constraint 217 267 0.8000 1.0000 2.0000 0.0000 Constraint 217 260 0.8000 1.0000 2.0000 0.0000 Constraint 217 253 0.8000 1.0000 2.0000 0.0000 Constraint 217 245 0.8000 1.0000 2.0000 0.0000 Constraint 217 240 0.8000 1.0000 2.0000 0.0000 Constraint 217 231 0.8000 1.0000 2.0000 0.0000 Constraint 217 226 0.8000 1.0000 2.0000 0.0000 Constraint 206 1144 0.8000 1.0000 2.0000 0.0000 Constraint 206 1135 0.8000 1.0000 2.0000 0.0000 Constraint 206 1126 0.8000 1.0000 2.0000 0.0000 Constraint 206 1115 0.8000 1.0000 2.0000 0.0000 Constraint 206 1106 0.8000 1.0000 2.0000 0.0000 Constraint 206 1101 0.8000 1.0000 2.0000 0.0000 Constraint 206 1093 0.8000 1.0000 2.0000 0.0000 Constraint 206 1082 0.8000 1.0000 2.0000 0.0000 Constraint 206 1075 0.8000 1.0000 2.0000 0.0000 Constraint 206 1067 0.8000 1.0000 2.0000 0.0000 Constraint 206 1059 0.8000 1.0000 2.0000 0.0000 Constraint 206 1052 0.8000 1.0000 2.0000 0.0000 Constraint 206 1043 0.8000 1.0000 2.0000 0.0000 Constraint 206 1038 0.8000 1.0000 2.0000 0.0000 Constraint 206 1033 0.8000 1.0000 2.0000 0.0000 Constraint 206 1025 0.8000 1.0000 2.0000 0.0000 Constraint 206 1017 0.8000 1.0000 2.0000 0.0000 Constraint 206 1012 0.8000 1.0000 2.0000 0.0000 Constraint 206 1001 0.8000 1.0000 2.0000 0.0000 Constraint 206 992 0.8000 1.0000 2.0000 0.0000 Constraint 206 986 0.8000 1.0000 2.0000 0.0000 Constraint 206 977 0.8000 1.0000 2.0000 0.0000 Constraint 206 940 0.8000 1.0000 2.0000 0.0000 Constraint 206 916 0.8000 1.0000 2.0000 0.0000 Constraint 206 878 0.8000 1.0000 2.0000 0.0000 Constraint 206 869 0.8000 1.0000 2.0000 0.0000 Constraint 206 844 0.8000 1.0000 2.0000 0.0000 Constraint 206 833 0.8000 1.0000 2.0000 0.0000 Constraint 206 809 0.8000 1.0000 2.0000 0.0000 Constraint 206 801 0.8000 1.0000 2.0000 0.0000 Constraint 206 782 0.8000 1.0000 2.0000 0.0000 Constraint 206 771 0.8000 1.0000 2.0000 0.0000 Constraint 206 752 0.8000 1.0000 2.0000 0.0000 Constraint 206 738 0.8000 1.0000 2.0000 0.0000 Constraint 206 732 0.8000 1.0000 2.0000 0.0000 Constraint 206 725 0.8000 1.0000 2.0000 0.0000 Constraint 206 714 0.8000 1.0000 2.0000 0.0000 Constraint 206 707 0.8000 1.0000 2.0000 0.0000 Constraint 206 696 0.8000 1.0000 2.0000 0.0000 Constraint 206 685 0.8000 1.0000 2.0000 0.0000 Constraint 206 673 0.8000 1.0000 2.0000 0.0000 Constraint 206 664 0.8000 1.0000 2.0000 0.0000 Constraint 206 657 0.8000 1.0000 2.0000 0.0000 Constraint 206 649 0.8000 1.0000 2.0000 0.0000 Constraint 206 644 0.8000 1.0000 2.0000 0.0000 Constraint 206 634 0.8000 1.0000 2.0000 0.0000 Constraint 206 623 0.8000 1.0000 2.0000 0.0000 Constraint 206 616 0.8000 1.0000 2.0000 0.0000 Constraint 206 608 0.8000 1.0000 2.0000 0.0000 Constraint 206 581 0.8000 1.0000 2.0000 0.0000 Constraint 206 572 0.8000 1.0000 2.0000 0.0000 Constraint 206 564 0.8000 1.0000 2.0000 0.0000 Constraint 206 555 0.8000 1.0000 2.0000 0.0000 Constraint 206 544 0.8000 1.0000 2.0000 0.0000 Constraint 206 536 0.8000 1.0000 2.0000 0.0000 Constraint 206 528 0.8000 1.0000 2.0000 0.0000 Constraint 206 523 0.8000 1.0000 2.0000 0.0000 Constraint 206 518 0.8000 1.0000 2.0000 0.0000 Constraint 206 510 0.8000 1.0000 2.0000 0.0000 Constraint 206 502 0.8000 1.0000 2.0000 0.0000 Constraint 206 496 0.8000 1.0000 2.0000 0.0000 Constraint 206 490 0.8000 1.0000 2.0000 0.0000 Constraint 206 479 0.8000 1.0000 2.0000 0.0000 Constraint 206 471 0.8000 1.0000 2.0000 0.0000 Constraint 206 460 0.8000 1.0000 2.0000 0.0000 Constraint 206 451 0.8000 1.0000 2.0000 0.0000 Constraint 206 446 0.8000 1.0000 2.0000 0.0000 Constraint 206 441 0.8000 1.0000 2.0000 0.0000 Constraint 206 436 0.8000 1.0000 2.0000 0.0000 Constraint 206 428 0.8000 1.0000 2.0000 0.0000 Constraint 206 419 0.8000 1.0000 2.0000 0.0000 Constraint 206 413 0.8000 1.0000 2.0000 0.0000 Constraint 206 406 0.8000 1.0000 2.0000 0.0000 Constraint 206 399 0.8000 1.0000 2.0000 0.0000 Constraint 206 392 0.8000 1.0000 2.0000 0.0000 Constraint 206 384 0.8000 1.0000 2.0000 0.0000 Constraint 206 368 0.8000 1.0000 2.0000 0.0000 Constraint 206 341 0.8000 1.0000 2.0000 0.0000 Constraint 206 336 0.8000 1.0000 2.0000 0.0000 Constraint 206 324 0.8000 1.0000 2.0000 0.0000 Constraint 206 317 0.8000 1.0000 2.0000 0.0000 Constraint 206 310 0.8000 1.0000 2.0000 0.0000 Constraint 206 287 0.8000 1.0000 2.0000 0.0000 Constraint 206 267 0.8000 1.0000 2.0000 0.0000 Constraint 206 260 0.8000 1.0000 2.0000 0.0000 Constraint 206 253 0.8000 1.0000 2.0000 0.0000 Constraint 206 245 0.8000 1.0000 2.0000 0.0000 Constraint 206 240 0.8000 1.0000 2.0000 0.0000 Constraint 206 231 0.8000 1.0000 2.0000 0.0000 Constraint 206 226 0.8000 1.0000 2.0000 0.0000 Constraint 206 217 0.8000 1.0000 2.0000 0.0000 Constraint 195 1144 0.8000 1.0000 2.0000 0.0000 Constraint 195 1135 0.8000 1.0000 2.0000 0.0000 Constraint 195 1126 0.8000 1.0000 2.0000 0.0000 Constraint 195 1115 0.8000 1.0000 2.0000 0.0000 Constraint 195 1106 0.8000 1.0000 2.0000 0.0000 Constraint 195 1101 0.8000 1.0000 2.0000 0.0000 Constraint 195 1093 0.8000 1.0000 2.0000 0.0000 Constraint 195 1082 0.8000 1.0000 2.0000 0.0000 Constraint 195 1075 0.8000 1.0000 2.0000 0.0000 Constraint 195 1067 0.8000 1.0000 2.0000 0.0000 Constraint 195 1059 0.8000 1.0000 2.0000 0.0000 Constraint 195 1052 0.8000 1.0000 2.0000 0.0000 Constraint 195 1043 0.8000 1.0000 2.0000 0.0000 Constraint 195 1038 0.8000 1.0000 2.0000 0.0000 Constraint 195 1033 0.8000 1.0000 2.0000 0.0000 Constraint 195 1025 0.8000 1.0000 2.0000 0.0000 Constraint 195 1017 0.8000 1.0000 2.0000 0.0000 Constraint 195 1012 0.8000 1.0000 2.0000 0.0000 Constraint 195 1001 0.8000 1.0000 2.0000 0.0000 Constraint 195 992 0.8000 1.0000 2.0000 0.0000 Constraint 195 986 0.8000 1.0000 2.0000 0.0000 Constraint 195 977 0.8000 1.0000 2.0000 0.0000 Constraint 195 969 0.8000 1.0000 2.0000 0.0000 Constraint 195 961 0.8000 1.0000 2.0000 0.0000 Constraint 195 955 0.8000 1.0000 2.0000 0.0000 Constraint 195 950 0.8000 1.0000 2.0000 0.0000 Constraint 195 940 0.8000 1.0000 2.0000 0.0000 Constraint 195 932 0.8000 1.0000 2.0000 0.0000 Constraint 195 927 0.8000 1.0000 2.0000 0.0000 Constraint 195 916 0.8000 1.0000 2.0000 0.0000 Constraint 195 909 0.8000 1.0000 2.0000 0.0000 Constraint 195 901 0.8000 1.0000 2.0000 0.0000 Constraint 195 869 0.8000 1.0000 2.0000 0.0000 Constraint 195 809 0.8000 1.0000 2.0000 0.0000 Constraint 195 782 0.8000 1.0000 2.0000 0.0000 Constraint 195 771 0.8000 1.0000 2.0000 0.0000 Constraint 195 752 0.8000 1.0000 2.0000 0.0000 Constraint 195 738 0.8000 1.0000 2.0000 0.0000 Constraint 195 732 0.8000 1.0000 2.0000 0.0000 Constraint 195 725 0.8000 1.0000 2.0000 0.0000 Constraint 195 714 0.8000 1.0000 2.0000 0.0000 Constraint 195 707 0.8000 1.0000 2.0000 0.0000 Constraint 195 696 0.8000 1.0000 2.0000 0.0000 Constraint 195 685 0.8000 1.0000 2.0000 0.0000 Constraint 195 673 0.8000 1.0000 2.0000 0.0000 Constraint 195 664 0.8000 1.0000 2.0000 0.0000 Constraint 195 657 0.8000 1.0000 2.0000 0.0000 Constraint 195 649 0.8000 1.0000 2.0000 0.0000 Constraint 195 644 0.8000 1.0000 2.0000 0.0000 Constraint 195 634 0.8000 1.0000 2.0000 0.0000 Constraint 195 623 0.8000 1.0000 2.0000 0.0000 Constraint 195 616 0.8000 1.0000 2.0000 0.0000 Constraint 195 581 0.8000 1.0000 2.0000 0.0000 Constraint 195 572 0.8000 1.0000 2.0000 0.0000 Constraint 195 555 0.8000 1.0000 2.0000 0.0000 Constraint 195 544 0.8000 1.0000 2.0000 0.0000 Constraint 195 536 0.8000 1.0000 2.0000 0.0000 Constraint 195 528 0.8000 1.0000 2.0000 0.0000 Constraint 195 523 0.8000 1.0000 2.0000 0.0000 Constraint 195 518 0.8000 1.0000 2.0000 0.0000 Constraint 195 502 0.8000 1.0000 2.0000 0.0000 Constraint 195 496 0.8000 1.0000 2.0000 0.0000 Constraint 195 490 0.8000 1.0000 2.0000 0.0000 Constraint 195 479 0.8000 1.0000 2.0000 0.0000 Constraint 195 471 0.8000 1.0000 2.0000 0.0000 Constraint 195 460 0.8000 1.0000 2.0000 0.0000 Constraint 195 451 0.8000 1.0000 2.0000 0.0000 Constraint 195 446 0.8000 1.0000 2.0000 0.0000 Constraint 195 441 0.8000 1.0000 2.0000 0.0000 Constraint 195 436 0.8000 1.0000 2.0000 0.0000 Constraint 195 428 0.8000 1.0000 2.0000 0.0000 Constraint 195 419 0.8000 1.0000 2.0000 0.0000 Constraint 195 413 0.8000 1.0000 2.0000 0.0000 Constraint 195 406 0.8000 1.0000 2.0000 0.0000 Constraint 195 399 0.8000 1.0000 2.0000 0.0000 Constraint 195 392 0.8000 1.0000 2.0000 0.0000 Constraint 195 384 0.8000 1.0000 2.0000 0.0000 Constraint 195 368 0.8000 1.0000 2.0000 0.0000 Constraint 195 357 0.8000 1.0000 2.0000 0.0000 Constraint 195 349 0.8000 1.0000 2.0000 0.0000 Constraint 195 341 0.8000 1.0000 2.0000 0.0000 Constraint 195 336 0.8000 1.0000 2.0000 0.0000 Constraint 195 317 0.8000 1.0000 2.0000 0.0000 Constraint 195 310 0.8000 1.0000 2.0000 0.0000 Constraint 195 287 0.8000 1.0000 2.0000 0.0000 Constraint 195 260 0.8000 1.0000 2.0000 0.0000 Constraint 195 253 0.8000 1.0000 2.0000 0.0000 Constraint 195 245 0.8000 1.0000 2.0000 0.0000 Constraint 195 240 0.8000 1.0000 2.0000 0.0000 Constraint 195 231 0.8000 1.0000 2.0000 0.0000 Constraint 195 226 0.8000 1.0000 2.0000 0.0000 Constraint 195 217 0.8000 1.0000 2.0000 0.0000 Constraint 195 206 0.8000 1.0000 2.0000 0.0000 Constraint 187 1144 0.8000 1.0000 2.0000 0.0000 Constraint 187 1135 0.8000 1.0000 2.0000 0.0000 Constraint 187 1126 0.8000 1.0000 2.0000 0.0000 Constraint 187 1115 0.8000 1.0000 2.0000 0.0000 Constraint 187 1106 0.8000 1.0000 2.0000 0.0000 Constraint 187 1101 0.8000 1.0000 2.0000 0.0000 Constraint 187 1093 0.8000 1.0000 2.0000 0.0000 Constraint 187 1082 0.8000 1.0000 2.0000 0.0000 Constraint 187 1075 0.8000 1.0000 2.0000 0.0000 Constraint 187 1067 0.8000 1.0000 2.0000 0.0000 Constraint 187 1059 0.8000 1.0000 2.0000 0.0000 Constraint 187 1052 0.8000 1.0000 2.0000 0.0000 Constraint 187 1043 0.8000 1.0000 2.0000 0.0000 Constraint 187 1038 0.8000 1.0000 2.0000 0.0000 Constraint 187 1033 0.8000 1.0000 2.0000 0.0000 Constraint 187 1025 0.8000 1.0000 2.0000 0.0000 Constraint 187 1017 0.8000 1.0000 2.0000 0.0000 Constraint 187 1012 0.8000 1.0000 2.0000 0.0000 Constraint 187 1001 0.8000 1.0000 2.0000 0.0000 Constraint 187 992 0.8000 1.0000 2.0000 0.0000 Constraint 187 986 0.8000 1.0000 2.0000 0.0000 Constraint 187 977 0.8000 1.0000 2.0000 0.0000 Constraint 187 969 0.8000 1.0000 2.0000 0.0000 Constraint 187 961 0.8000 1.0000 2.0000 0.0000 Constraint 187 955 0.8000 1.0000 2.0000 0.0000 Constraint 187 950 0.8000 1.0000 2.0000 0.0000 Constraint 187 940 0.8000 1.0000 2.0000 0.0000 Constraint 187 916 0.8000 1.0000 2.0000 0.0000 Constraint 187 809 0.8000 1.0000 2.0000 0.0000 Constraint 187 782 0.8000 1.0000 2.0000 0.0000 Constraint 187 771 0.8000 1.0000 2.0000 0.0000 Constraint 187 752 0.8000 1.0000 2.0000 0.0000 Constraint 187 738 0.8000 1.0000 2.0000 0.0000 Constraint 187 732 0.8000 1.0000 2.0000 0.0000 Constraint 187 714 0.8000 1.0000 2.0000 0.0000 Constraint 187 707 0.8000 1.0000 2.0000 0.0000 Constraint 187 696 0.8000 1.0000 2.0000 0.0000 Constraint 187 685 0.8000 1.0000 2.0000 0.0000 Constraint 187 673 0.8000 1.0000 2.0000 0.0000 Constraint 187 664 0.8000 1.0000 2.0000 0.0000 Constraint 187 657 0.8000 1.0000 2.0000 0.0000 Constraint 187 649 0.8000 1.0000 2.0000 0.0000 Constraint 187 644 0.8000 1.0000 2.0000 0.0000 Constraint 187 634 0.8000 1.0000 2.0000 0.0000 Constraint 187 623 0.8000 1.0000 2.0000 0.0000 Constraint 187 616 0.8000 1.0000 2.0000 0.0000 Constraint 187 608 0.8000 1.0000 2.0000 0.0000 Constraint 187 581 0.8000 1.0000 2.0000 0.0000 Constraint 187 572 0.8000 1.0000 2.0000 0.0000 Constraint 187 555 0.8000 1.0000 2.0000 0.0000 Constraint 187 544 0.8000 1.0000 2.0000 0.0000 Constraint 187 523 0.8000 1.0000 2.0000 0.0000 Constraint 187 518 0.8000 1.0000 2.0000 0.0000 Constraint 187 502 0.8000 1.0000 2.0000 0.0000 Constraint 187 496 0.8000 1.0000 2.0000 0.0000 Constraint 187 490 0.8000 1.0000 2.0000 0.0000 Constraint 187 479 0.8000 1.0000 2.0000 0.0000 Constraint 187 471 0.8000 1.0000 2.0000 0.0000 Constraint 187 460 0.8000 1.0000 2.0000 0.0000 Constraint 187 446 0.8000 1.0000 2.0000 0.0000 Constraint 187 441 0.8000 1.0000 2.0000 0.0000 Constraint 187 436 0.8000 1.0000 2.0000 0.0000 Constraint 187 419 0.8000 1.0000 2.0000 0.0000 Constraint 187 413 0.8000 1.0000 2.0000 0.0000 Constraint 187 406 0.8000 1.0000 2.0000 0.0000 Constraint 187 399 0.8000 1.0000 2.0000 0.0000 Constraint 187 392 0.8000 1.0000 2.0000 0.0000 Constraint 187 384 0.8000 1.0000 2.0000 0.0000 Constraint 187 368 0.8000 1.0000 2.0000 0.0000 Constraint 187 357 0.8000 1.0000 2.0000 0.0000 Constraint 187 349 0.8000 1.0000 2.0000 0.0000 Constraint 187 341 0.8000 1.0000 2.0000 0.0000 Constraint 187 336 0.8000 1.0000 2.0000 0.0000 Constraint 187 317 0.8000 1.0000 2.0000 0.0000 Constraint 187 310 0.8000 1.0000 2.0000 0.0000 Constraint 187 253 0.8000 1.0000 2.0000 0.0000 Constraint 187 245 0.8000 1.0000 2.0000 0.0000 Constraint 187 240 0.8000 1.0000 2.0000 0.0000 Constraint 187 231 0.8000 1.0000 2.0000 0.0000 Constraint 187 226 0.8000 1.0000 2.0000 0.0000 Constraint 187 217 0.8000 1.0000 2.0000 0.0000 Constraint 187 206 0.8000 1.0000 2.0000 0.0000 Constraint 187 195 0.8000 1.0000 2.0000 0.0000 Constraint 176 1144 0.8000 1.0000 2.0000 0.0000 Constraint 176 1135 0.8000 1.0000 2.0000 0.0000 Constraint 176 1126 0.8000 1.0000 2.0000 0.0000 Constraint 176 1115 0.8000 1.0000 2.0000 0.0000 Constraint 176 1106 0.8000 1.0000 2.0000 0.0000 Constraint 176 1101 0.8000 1.0000 2.0000 0.0000 Constraint 176 1093 0.8000 1.0000 2.0000 0.0000 Constraint 176 1082 0.8000 1.0000 2.0000 0.0000 Constraint 176 1075 0.8000 1.0000 2.0000 0.0000 Constraint 176 1067 0.8000 1.0000 2.0000 0.0000 Constraint 176 1059 0.8000 1.0000 2.0000 0.0000 Constraint 176 1052 0.8000 1.0000 2.0000 0.0000 Constraint 176 1043 0.8000 1.0000 2.0000 0.0000 Constraint 176 1038 0.8000 1.0000 2.0000 0.0000 Constraint 176 1033 0.8000 1.0000 2.0000 0.0000 Constraint 176 1025 0.8000 1.0000 2.0000 0.0000 Constraint 176 1017 0.8000 1.0000 2.0000 0.0000 Constraint 176 1012 0.8000 1.0000 2.0000 0.0000 Constraint 176 1001 0.8000 1.0000 2.0000 0.0000 Constraint 176 992 0.8000 1.0000 2.0000 0.0000 Constraint 176 986 0.8000 1.0000 2.0000 0.0000 Constraint 176 977 0.8000 1.0000 2.0000 0.0000 Constraint 176 961 0.8000 1.0000 2.0000 0.0000 Constraint 176 844 0.8000 1.0000 2.0000 0.0000 Constraint 176 809 0.8000 1.0000 2.0000 0.0000 Constraint 176 801 0.8000 1.0000 2.0000 0.0000 Constraint 176 782 0.8000 1.0000 2.0000 0.0000 Constraint 176 771 0.8000 1.0000 2.0000 0.0000 Constraint 176 752 0.8000 1.0000 2.0000 0.0000 Constraint 176 738 0.8000 1.0000 2.0000 0.0000 Constraint 176 732 0.8000 1.0000 2.0000 0.0000 Constraint 176 725 0.8000 1.0000 2.0000 0.0000 Constraint 176 714 0.8000 1.0000 2.0000 0.0000 Constraint 176 707 0.8000 1.0000 2.0000 0.0000 Constraint 176 696 0.8000 1.0000 2.0000 0.0000 Constraint 176 685 0.8000 1.0000 2.0000 0.0000 Constraint 176 673 0.8000 1.0000 2.0000 0.0000 Constraint 176 664 0.8000 1.0000 2.0000 0.0000 Constraint 176 657 0.8000 1.0000 2.0000 0.0000 Constraint 176 649 0.8000 1.0000 2.0000 0.0000 Constraint 176 644 0.8000 1.0000 2.0000 0.0000 Constraint 176 634 0.8000 1.0000 2.0000 0.0000 Constraint 176 623 0.8000 1.0000 2.0000 0.0000 Constraint 176 616 0.8000 1.0000 2.0000 0.0000 Constraint 176 608 0.8000 1.0000 2.0000 0.0000 Constraint 176 581 0.8000 1.0000 2.0000 0.0000 Constraint 176 572 0.8000 1.0000 2.0000 0.0000 Constraint 176 544 0.8000 1.0000 2.0000 0.0000 Constraint 176 536 0.8000 1.0000 2.0000 0.0000 Constraint 176 523 0.8000 1.0000 2.0000 0.0000 Constraint 176 518 0.8000 1.0000 2.0000 0.0000 Constraint 176 510 0.8000 1.0000 2.0000 0.0000 Constraint 176 502 0.8000 1.0000 2.0000 0.0000 Constraint 176 496 0.8000 1.0000 2.0000 0.0000 Constraint 176 490 0.8000 1.0000 2.0000 0.0000 Constraint 176 479 0.8000 1.0000 2.0000 0.0000 Constraint 176 471 0.8000 1.0000 2.0000 0.0000 Constraint 176 460 0.8000 1.0000 2.0000 0.0000 Constraint 176 446 0.8000 1.0000 2.0000 0.0000 Constraint 176 441 0.8000 1.0000 2.0000 0.0000 Constraint 176 436 0.8000 1.0000 2.0000 0.0000 Constraint 176 428 0.8000 1.0000 2.0000 0.0000 Constraint 176 419 0.8000 1.0000 2.0000 0.0000 Constraint 176 413 0.8000 1.0000 2.0000 0.0000 Constraint 176 406 0.8000 1.0000 2.0000 0.0000 Constraint 176 399 0.8000 1.0000 2.0000 0.0000 Constraint 176 392 0.8000 1.0000 2.0000 0.0000 Constraint 176 384 0.8000 1.0000 2.0000 0.0000 Constraint 176 368 0.8000 1.0000 2.0000 0.0000 Constraint 176 357 0.8000 1.0000 2.0000 0.0000 Constraint 176 349 0.8000 1.0000 2.0000 0.0000 Constraint 176 341 0.8000 1.0000 2.0000 0.0000 Constraint 176 336 0.8000 1.0000 2.0000 0.0000 Constraint 176 324 0.8000 1.0000 2.0000 0.0000 Constraint 176 317 0.8000 1.0000 2.0000 0.0000 Constraint 176 310 0.8000 1.0000 2.0000 0.0000 Constraint 176 302 0.8000 1.0000 2.0000 0.0000 Constraint 176 287 0.8000 1.0000 2.0000 0.0000 Constraint 176 260 0.8000 1.0000 2.0000 0.0000 Constraint 176 253 0.8000 1.0000 2.0000 0.0000 Constraint 176 245 0.8000 1.0000 2.0000 0.0000 Constraint 176 240 0.8000 1.0000 2.0000 0.0000 Constraint 176 231 0.8000 1.0000 2.0000 0.0000 Constraint 176 226 0.8000 1.0000 2.0000 0.0000 Constraint 176 217 0.8000 1.0000 2.0000 0.0000 Constraint 176 206 0.8000 1.0000 2.0000 0.0000 Constraint 176 195 0.8000 1.0000 2.0000 0.0000 Constraint 176 187 0.8000 1.0000 2.0000 0.0000 Constraint 165 1144 0.8000 1.0000 2.0000 0.0000 Constraint 165 1135 0.8000 1.0000 2.0000 0.0000 Constraint 165 1126 0.8000 1.0000 2.0000 0.0000 Constraint 165 1115 0.8000 1.0000 2.0000 0.0000 Constraint 165 1106 0.8000 1.0000 2.0000 0.0000 Constraint 165 1101 0.8000 1.0000 2.0000 0.0000 Constraint 165 1093 0.8000 1.0000 2.0000 0.0000 Constraint 165 1082 0.8000 1.0000 2.0000 0.0000 Constraint 165 1075 0.8000 1.0000 2.0000 0.0000 Constraint 165 1067 0.8000 1.0000 2.0000 0.0000 Constraint 165 1059 0.8000 1.0000 2.0000 0.0000 Constraint 165 1052 0.8000 1.0000 2.0000 0.0000 Constraint 165 1043 0.8000 1.0000 2.0000 0.0000 Constraint 165 1038 0.8000 1.0000 2.0000 0.0000 Constraint 165 1033 0.8000 1.0000 2.0000 0.0000 Constraint 165 1025 0.8000 1.0000 2.0000 0.0000 Constraint 165 1017 0.8000 1.0000 2.0000 0.0000 Constraint 165 1012 0.8000 1.0000 2.0000 0.0000 Constraint 165 1001 0.8000 1.0000 2.0000 0.0000 Constraint 165 992 0.8000 1.0000 2.0000 0.0000 Constraint 165 986 0.8000 1.0000 2.0000 0.0000 Constraint 165 977 0.8000 1.0000 2.0000 0.0000 Constraint 165 961 0.8000 1.0000 2.0000 0.0000 Constraint 165 950 0.8000 1.0000 2.0000 0.0000 Constraint 165 940 0.8000 1.0000 2.0000 0.0000 Constraint 165 932 0.8000 1.0000 2.0000 0.0000 Constraint 165 909 0.8000 1.0000 2.0000 0.0000 Constraint 165 901 0.8000 1.0000 2.0000 0.0000 Constraint 165 878 0.8000 1.0000 2.0000 0.0000 Constraint 165 869 0.8000 1.0000 2.0000 0.0000 Constraint 165 849 0.8000 1.0000 2.0000 0.0000 Constraint 165 844 0.8000 1.0000 2.0000 0.0000 Constraint 165 833 0.8000 1.0000 2.0000 0.0000 Constraint 165 825 0.8000 1.0000 2.0000 0.0000 Constraint 165 809 0.8000 1.0000 2.0000 0.0000 Constraint 165 801 0.8000 1.0000 2.0000 0.0000 Constraint 165 793 0.8000 1.0000 2.0000 0.0000 Constraint 165 782 0.8000 1.0000 2.0000 0.0000 Constraint 165 771 0.8000 1.0000 2.0000 0.0000 Constraint 165 758 0.8000 1.0000 2.0000 0.0000 Constraint 165 752 0.8000 1.0000 2.0000 0.0000 Constraint 165 746 0.8000 1.0000 2.0000 0.0000 Constraint 165 738 0.8000 1.0000 2.0000 0.0000 Constraint 165 732 0.8000 1.0000 2.0000 0.0000 Constraint 165 725 0.8000 1.0000 2.0000 0.0000 Constraint 165 714 0.8000 1.0000 2.0000 0.0000 Constraint 165 707 0.8000 1.0000 2.0000 0.0000 Constraint 165 685 0.8000 1.0000 2.0000 0.0000 Constraint 165 673 0.8000 1.0000 2.0000 0.0000 Constraint 165 664 0.8000 1.0000 2.0000 0.0000 Constraint 165 657 0.8000 1.0000 2.0000 0.0000 Constraint 165 649 0.8000 1.0000 2.0000 0.0000 Constraint 165 644 0.8000 1.0000 2.0000 0.0000 Constraint 165 634 0.8000 1.0000 2.0000 0.0000 Constraint 165 623 0.8000 1.0000 2.0000 0.0000 Constraint 165 616 0.8000 1.0000 2.0000 0.0000 Constraint 165 608 0.8000 1.0000 2.0000 0.0000 Constraint 165 600 0.8000 1.0000 2.0000 0.0000 Constraint 165 581 0.8000 1.0000 2.0000 0.0000 Constraint 165 572 0.8000 1.0000 2.0000 0.0000 Constraint 165 564 0.8000 1.0000 2.0000 0.0000 Constraint 165 555 0.8000 1.0000 2.0000 0.0000 Constraint 165 544 0.8000 1.0000 2.0000 0.0000 Constraint 165 536 0.8000 1.0000 2.0000 0.0000 Constraint 165 528 0.8000 1.0000 2.0000 0.0000 Constraint 165 523 0.8000 1.0000 2.0000 0.0000 Constraint 165 518 0.8000 1.0000 2.0000 0.0000 Constraint 165 510 0.8000 1.0000 2.0000 0.0000 Constraint 165 502 0.8000 1.0000 2.0000 0.0000 Constraint 165 496 0.8000 1.0000 2.0000 0.0000 Constraint 165 490 0.8000 1.0000 2.0000 0.0000 Constraint 165 479 0.8000 1.0000 2.0000 0.0000 Constraint 165 471 0.8000 1.0000 2.0000 0.0000 Constraint 165 460 0.8000 1.0000 2.0000 0.0000 Constraint 165 451 0.8000 1.0000 2.0000 0.0000 Constraint 165 446 0.8000 1.0000 2.0000 0.0000 Constraint 165 441 0.8000 1.0000 2.0000 0.0000 Constraint 165 436 0.8000 1.0000 2.0000 0.0000 Constraint 165 428 0.8000 1.0000 2.0000 0.0000 Constraint 165 419 0.8000 1.0000 2.0000 0.0000 Constraint 165 413 0.8000 1.0000 2.0000 0.0000 Constraint 165 406 0.8000 1.0000 2.0000 0.0000 Constraint 165 399 0.8000 1.0000 2.0000 0.0000 Constraint 165 392 0.8000 1.0000 2.0000 0.0000 Constraint 165 384 0.8000 1.0000 2.0000 0.0000 Constraint 165 368 0.8000 1.0000 2.0000 0.0000 Constraint 165 357 0.8000 1.0000 2.0000 0.0000 Constraint 165 349 0.8000 1.0000 2.0000 0.0000 Constraint 165 341 0.8000 1.0000 2.0000 0.0000 Constraint 165 336 0.8000 1.0000 2.0000 0.0000 Constraint 165 324 0.8000 1.0000 2.0000 0.0000 Constraint 165 317 0.8000 1.0000 2.0000 0.0000 Constraint 165 310 0.8000 1.0000 2.0000 0.0000 Constraint 165 302 0.8000 1.0000 2.0000 0.0000 Constraint 165 287 0.8000 1.0000 2.0000 0.0000 Constraint 165 260 0.8000 1.0000 2.0000 0.0000 Constraint 165 253 0.8000 1.0000 2.0000 0.0000 Constraint 165 245 0.8000 1.0000 2.0000 0.0000 Constraint 165 240 0.8000 1.0000 2.0000 0.0000 Constraint 165 231 0.8000 1.0000 2.0000 0.0000 Constraint 165 226 0.8000 1.0000 2.0000 0.0000 Constraint 165 217 0.8000 1.0000 2.0000 0.0000 Constraint 165 206 0.8000 1.0000 2.0000 0.0000 Constraint 165 195 0.8000 1.0000 2.0000 0.0000 Constraint 165 187 0.8000 1.0000 2.0000 0.0000 Constraint 165 176 0.8000 1.0000 2.0000 0.0000 Constraint 158 1144 0.8000 1.0000 2.0000 0.0000 Constraint 158 1135 0.8000 1.0000 2.0000 0.0000 Constraint 158 1126 0.8000 1.0000 2.0000 0.0000 Constraint 158 1115 0.8000 1.0000 2.0000 0.0000 Constraint 158 1106 0.8000 1.0000 2.0000 0.0000 Constraint 158 1101 0.8000 1.0000 2.0000 0.0000 Constraint 158 1093 0.8000 1.0000 2.0000 0.0000 Constraint 158 1082 0.8000 1.0000 2.0000 0.0000 Constraint 158 1075 0.8000 1.0000 2.0000 0.0000 Constraint 158 1067 0.8000 1.0000 2.0000 0.0000 Constraint 158 1059 0.8000 1.0000 2.0000 0.0000 Constraint 158 1052 0.8000 1.0000 2.0000 0.0000 Constraint 158 1038 0.8000 1.0000 2.0000 0.0000 Constraint 158 1033 0.8000 1.0000 2.0000 0.0000 Constraint 158 1025 0.8000 1.0000 2.0000 0.0000 Constraint 158 1017 0.8000 1.0000 2.0000 0.0000 Constraint 158 1012 0.8000 1.0000 2.0000 0.0000 Constraint 158 1001 0.8000 1.0000 2.0000 0.0000 Constraint 158 992 0.8000 1.0000 2.0000 0.0000 Constraint 158 986 0.8000 1.0000 2.0000 0.0000 Constraint 158 977 0.8000 1.0000 2.0000 0.0000 Constraint 158 969 0.8000 1.0000 2.0000 0.0000 Constraint 158 961 0.8000 1.0000 2.0000 0.0000 Constraint 158 955 0.8000 1.0000 2.0000 0.0000 Constraint 158 950 0.8000 1.0000 2.0000 0.0000 Constraint 158 940 0.8000 1.0000 2.0000 0.0000 Constraint 158 927 0.8000 1.0000 2.0000 0.0000 Constraint 158 909 0.8000 1.0000 2.0000 0.0000 Constraint 158 901 0.8000 1.0000 2.0000 0.0000 Constraint 158 878 0.8000 1.0000 2.0000 0.0000 Constraint 158 869 0.8000 1.0000 2.0000 0.0000 Constraint 158 858 0.8000 1.0000 2.0000 0.0000 Constraint 158 849 0.8000 1.0000 2.0000 0.0000 Constraint 158 844 0.8000 1.0000 2.0000 0.0000 Constraint 158 833 0.8000 1.0000 2.0000 0.0000 Constraint 158 825 0.8000 1.0000 2.0000 0.0000 Constraint 158 809 0.8000 1.0000 2.0000 0.0000 Constraint 158 782 0.8000 1.0000 2.0000 0.0000 Constraint 158 752 0.8000 1.0000 2.0000 0.0000 Constraint 158 746 0.8000 1.0000 2.0000 0.0000 Constraint 158 732 0.8000 1.0000 2.0000 0.0000 Constraint 158 725 0.8000 1.0000 2.0000 0.0000 Constraint 158 714 0.8000 1.0000 2.0000 0.0000 Constraint 158 707 0.8000 1.0000 2.0000 0.0000 Constraint 158 696 0.8000 1.0000 2.0000 0.0000 Constraint 158 685 0.8000 1.0000 2.0000 0.0000 Constraint 158 673 0.8000 1.0000 2.0000 0.0000 Constraint 158 664 0.8000 1.0000 2.0000 0.0000 Constraint 158 657 0.8000 1.0000 2.0000 0.0000 Constraint 158 649 0.8000 1.0000 2.0000 0.0000 Constraint 158 644 0.8000 1.0000 2.0000 0.0000 Constraint 158 634 0.8000 1.0000 2.0000 0.0000 Constraint 158 623 0.8000 1.0000 2.0000 0.0000 Constraint 158 616 0.8000 1.0000 2.0000 0.0000 Constraint 158 608 0.8000 1.0000 2.0000 0.0000 Constraint 158 581 0.8000 1.0000 2.0000 0.0000 Constraint 158 572 0.8000 1.0000 2.0000 0.0000 Constraint 158 555 0.8000 1.0000 2.0000 0.0000 Constraint 158 544 0.8000 1.0000 2.0000 0.0000 Constraint 158 536 0.8000 1.0000 2.0000 0.0000 Constraint 158 523 0.8000 1.0000 2.0000 0.0000 Constraint 158 518 0.8000 1.0000 2.0000 0.0000 Constraint 158 510 0.8000 1.0000 2.0000 0.0000 Constraint 158 502 0.8000 1.0000 2.0000 0.0000 Constraint 158 496 0.8000 1.0000 2.0000 0.0000 Constraint 158 490 0.8000 1.0000 2.0000 0.0000 Constraint 158 479 0.8000 1.0000 2.0000 0.0000 Constraint 158 471 0.8000 1.0000 2.0000 0.0000 Constraint 158 460 0.8000 1.0000 2.0000 0.0000 Constraint 158 451 0.8000 1.0000 2.0000 0.0000 Constraint 158 446 0.8000 1.0000 2.0000 0.0000 Constraint 158 441 0.8000 1.0000 2.0000 0.0000 Constraint 158 436 0.8000 1.0000 2.0000 0.0000 Constraint 158 428 0.8000 1.0000 2.0000 0.0000 Constraint 158 419 0.8000 1.0000 2.0000 0.0000 Constraint 158 413 0.8000 1.0000 2.0000 0.0000 Constraint 158 406 0.8000 1.0000 2.0000 0.0000 Constraint 158 399 0.8000 1.0000 2.0000 0.0000 Constraint 158 392 0.8000 1.0000 2.0000 0.0000 Constraint 158 384 0.8000 1.0000 2.0000 0.0000 Constraint 158 368 0.8000 1.0000 2.0000 0.0000 Constraint 158 357 0.8000 1.0000 2.0000 0.0000 Constraint 158 349 0.8000 1.0000 2.0000 0.0000 Constraint 158 341 0.8000 1.0000 2.0000 0.0000 Constraint 158 336 0.8000 1.0000 2.0000 0.0000 Constraint 158 324 0.8000 1.0000 2.0000 0.0000 Constraint 158 317 0.8000 1.0000 2.0000 0.0000 Constraint 158 302 0.8000 1.0000 2.0000 0.0000 Constraint 158 293 0.8000 1.0000 2.0000 0.0000 Constraint 158 260 0.8000 1.0000 2.0000 0.0000 Constraint 158 253 0.8000 1.0000 2.0000 0.0000 Constraint 158 245 0.8000 1.0000 2.0000 0.0000 Constraint 158 240 0.8000 1.0000 2.0000 0.0000 Constraint 158 231 0.8000 1.0000 2.0000 0.0000 Constraint 158 226 0.8000 1.0000 2.0000 0.0000 Constraint 158 217 0.8000 1.0000 2.0000 0.0000 Constraint 158 206 0.8000 1.0000 2.0000 0.0000 Constraint 158 195 0.8000 1.0000 2.0000 0.0000 Constraint 158 187 0.8000 1.0000 2.0000 0.0000 Constraint 158 176 0.8000 1.0000 2.0000 0.0000 Constraint 158 165 0.8000 1.0000 2.0000 0.0000 Constraint 150 1144 0.8000 1.0000 2.0000 0.0000 Constraint 150 1135 0.8000 1.0000 2.0000 0.0000 Constraint 150 1126 0.8000 1.0000 2.0000 0.0000 Constraint 150 1115 0.8000 1.0000 2.0000 0.0000 Constraint 150 1106 0.8000 1.0000 2.0000 0.0000 Constraint 150 1101 0.8000 1.0000 2.0000 0.0000 Constraint 150 1093 0.8000 1.0000 2.0000 0.0000 Constraint 150 1082 0.8000 1.0000 2.0000 0.0000 Constraint 150 1075 0.8000 1.0000 2.0000 0.0000 Constraint 150 1067 0.8000 1.0000 2.0000 0.0000 Constraint 150 1059 0.8000 1.0000 2.0000 0.0000 Constraint 150 1052 0.8000 1.0000 2.0000 0.0000 Constraint 150 1038 0.8000 1.0000 2.0000 0.0000 Constraint 150 1017 0.8000 1.0000 2.0000 0.0000 Constraint 150 1012 0.8000 1.0000 2.0000 0.0000 Constraint 150 1001 0.8000 1.0000 2.0000 0.0000 Constraint 150 992 0.8000 1.0000 2.0000 0.0000 Constraint 150 986 0.8000 1.0000 2.0000 0.0000 Constraint 150 977 0.8000 1.0000 2.0000 0.0000 Constraint 150 969 0.8000 1.0000 2.0000 0.0000 Constraint 150 961 0.8000 1.0000 2.0000 0.0000 Constraint 150 940 0.8000 1.0000 2.0000 0.0000 Constraint 150 878 0.8000 1.0000 2.0000 0.0000 Constraint 150 844 0.8000 1.0000 2.0000 0.0000 Constraint 150 833 0.8000 1.0000 2.0000 0.0000 Constraint 150 825 0.8000 1.0000 2.0000 0.0000 Constraint 150 809 0.8000 1.0000 2.0000 0.0000 Constraint 150 801 0.8000 1.0000 2.0000 0.0000 Constraint 150 793 0.8000 1.0000 2.0000 0.0000 Constraint 150 782 0.8000 1.0000 2.0000 0.0000 Constraint 150 771 0.8000 1.0000 2.0000 0.0000 Constraint 150 758 0.8000 1.0000 2.0000 0.0000 Constraint 150 752 0.8000 1.0000 2.0000 0.0000 Constraint 150 746 0.8000 1.0000 2.0000 0.0000 Constraint 150 714 0.8000 1.0000 2.0000 0.0000 Constraint 150 707 0.8000 1.0000 2.0000 0.0000 Constraint 150 696 0.8000 1.0000 2.0000 0.0000 Constraint 150 685 0.8000 1.0000 2.0000 0.0000 Constraint 150 673 0.8000 1.0000 2.0000 0.0000 Constraint 150 664 0.8000 1.0000 2.0000 0.0000 Constraint 150 657 0.8000 1.0000 2.0000 0.0000 Constraint 150 649 0.8000 1.0000 2.0000 0.0000 Constraint 150 644 0.8000 1.0000 2.0000 0.0000 Constraint 150 634 0.8000 1.0000 2.0000 0.0000 Constraint 150 623 0.8000 1.0000 2.0000 0.0000 Constraint 150 616 0.8000 1.0000 2.0000 0.0000 Constraint 150 600 0.8000 1.0000 2.0000 0.0000 Constraint 150 581 0.8000 1.0000 2.0000 0.0000 Constraint 150 572 0.8000 1.0000 2.0000 0.0000 Constraint 150 555 0.8000 1.0000 2.0000 0.0000 Constraint 150 544 0.8000 1.0000 2.0000 0.0000 Constraint 150 536 0.8000 1.0000 2.0000 0.0000 Constraint 150 528 0.8000 1.0000 2.0000 0.0000 Constraint 150 523 0.8000 1.0000 2.0000 0.0000 Constraint 150 518 0.8000 1.0000 2.0000 0.0000 Constraint 150 510 0.8000 1.0000 2.0000 0.0000 Constraint 150 502 0.8000 1.0000 2.0000 0.0000 Constraint 150 496 0.8000 1.0000 2.0000 0.0000 Constraint 150 490 0.8000 1.0000 2.0000 0.0000 Constraint 150 479 0.8000 1.0000 2.0000 0.0000 Constraint 150 471 0.8000 1.0000 2.0000 0.0000 Constraint 150 460 0.8000 1.0000 2.0000 0.0000 Constraint 150 451 0.8000 1.0000 2.0000 0.0000 Constraint 150 446 0.8000 1.0000 2.0000 0.0000 Constraint 150 441 0.8000 1.0000 2.0000 0.0000 Constraint 150 436 0.8000 1.0000 2.0000 0.0000 Constraint 150 428 0.8000 1.0000 2.0000 0.0000 Constraint 150 419 0.8000 1.0000 2.0000 0.0000 Constraint 150 413 0.8000 1.0000 2.0000 0.0000 Constraint 150 406 0.8000 1.0000 2.0000 0.0000 Constraint 150 399 0.8000 1.0000 2.0000 0.0000 Constraint 150 392 0.8000 1.0000 2.0000 0.0000 Constraint 150 384 0.8000 1.0000 2.0000 0.0000 Constraint 150 368 0.8000 1.0000 2.0000 0.0000 Constraint 150 357 0.8000 1.0000 2.0000 0.0000 Constraint 150 349 0.8000 1.0000 2.0000 0.0000 Constraint 150 341 0.8000 1.0000 2.0000 0.0000 Constraint 150 336 0.8000 1.0000 2.0000 0.0000 Constraint 150 324 0.8000 1.0000 2.0000 0.0000 Constraint 150 317 0.8000 1.0000 2.0000 0.0000 Constraint 150 310 0.8000 1.0000 2.0000 0.0000 Constraint 150 302 0.8000 1.0000 2.0000 0.0000 Constraint 150 293 0.8000 1.0000 2.0000 0.0000 Constraint 150 287 0.8000 1.0000 2.0000 0.0000 Constraint 150 267 0.8000 1.0000 2.0000 0.0000 Constraint 150 260 0.8000 1.0000 2.0000 0.0000 Constraint 150 253 0.8000 1.0000 2.0000 0.0000 Constraint 150 245 0.8000 1.0000 2.0000 0.0000 Constraint 150 240 0.8000 1.0000 2.0000 0.0000 Constraint 150 231 0.8000 1.0000 2.0000 0.0000 Constraint 150 226 0.8000 1.0000 2.0000 0.0000 Constraint 150 217 0.8000 1.0000 2.0000 0.0000 Constraint 150 206 0.8000 1.0000 2.0000 0.0000 Constraint 150 195 0.8000 1.0000 2.0000 0.0000 Constraint 150 187 0.8000 1.0000 2.0000 0.0000 Constraint 150 176 0.8000 1.0000 2.0000 0.0000 Constraint 150 165 0.8000 1.0000 2.0000 0.0000 Constraint 150 158 0.8000 1.0000 2.0000 0.0000 Constraint 143 1144 0.8000 1.0000 2.0000 0.0000 Constraint 143 1135 0.8000 1.0000 2.0000 0.0000 Constraint 143 1126 0.8000 1.0000 2.0000 0.0000 Constraint 143 1115 0.8000 1.0000 2.0000 0.0000 Constraint 143 1106 0.8000 1.0000 2.0000 0.0000 Constraint 143 1101 0.8000 1.0000 2.0000 0.0000 Constraint 143 1093 0.8000 1.0000 2.0000 0.0000 Constraint 143 1082 0.8000 1.0000 2.0000 0.0000 Constraint 143 1075 0.8000 1.0000 2.0000 0.0000 Constraint 143 1067 0.8000 1.0000 2.0000 0.0000 Constraint 143 1059 0.8000 1.0000 2.0000 0.0000 Constraint 143 1052 0.8000 1.0000 2.0000 0.0000 Constraint 143 1043 0.8000 1.0000 2.0000 0.0000 Constraint 143 1038 0.8000 1.0000 2.0000 0.0000 Constraint 143 1033 0.8000 1.0000 2.0000 0.0000 Constraint 143 1017 0.8000 1.0000 2.0000 0.0000 Constraint 143 1012 0.8000 1.0000 2.0000 0.0000 Constraint 143 992 0.8000 1.0000 2.0000 0.0000 Constraint 143 977 0.8000 1.0000 2.0000 0.0000 Constraint 143 969 0.8000 1.0000 2.0000 0.0000 Constraint 143 961 0.8000 1.0000 2.0000 0.0000 Constraint 143 950 0.8000 1.0000 2.0000 0.0000 Constraint 143 940 0.8000 1.0000 2.0000 0.0000 Constraint 143 909 0.8000 1.0000 2.0000 0.0000 Constraint 143 878 0.8000 1.0000 2.0000 0.0000 Constraint 143 869 0.8000 1.0000 2.0000 0.0000 Constraint 143 849 0.8000 1.0000 2.0000 0.0000 Constraint 143 844 0.8000 1.0000 2.0000 0.0000 Constraint 143 833 0.8000 1.0000 2.0000 0.0000 Constraint 143 825 0.8000 1.0000 2.0000 0.0000 Constraint 143 809 0.8000 1.0000 2.0000 0.0000 Constraint 143 801 0.8000 1.0000 2.0000 0.0000 Constraint 143 793 0.8000 1.0000 2.0000 0.0000 Constraint 143 782 0.8000 1.0000 2.0000 0.0000 Constraint 143 771 0.8000 1.0000 2.0000 0.0000 Constraint 143 758 0.8000 1.0000 2.0000 0.0000 Constraint 143 752 0.8000 1.0000 2.0000 0.0000 Constraint 143 746 0.8000 1.0000 2.0000 0.0000 Constraint 143 738 0.8000 1.0000 2.0000 0.0000 Constraint 143 732 0.8000 1.0000 2.0000 0.0000 Constraint 143 725 0.8000 1.0000 2.0000 0.0000 Constraint 143 714 0.8000 1.0000 2.0000 0.0000 Constraint 143 707 0.8000 1.0000 2.0000 0.0000 Constraint 143 696 0.8000 1.0000 2.0000 0.0000 Constraint 143 685 0.8000 1.0000 2.0000 0.0000 Constraint 143 673 0.8000 1.0000 2.0000 0.0000 Constraint 143 664 0.8000 1.0000 2.0000 0.0000 Constraint 143 657 0.8000 1.0000 2.0000 0.0000 Constraint 143 649 0.8000 1.0000 2.0000 0.0000 Constraint 143 644 0.8000 1.0000 2.0000 0.0000 Constraint 143 634 0.8000 1.0000 2.0000 0.0000 Constraint 143 623 0.8000 1.0000 2.0000 0.0000 Constraint 143 616 0.8000 1.0000 2.0000 0.0000 Constraint 143 608 0.8000 1.0000 2.0000 0.0000 Constraint 143 600 0.8000 1.0000 2.0000 0.0000 Constraint 143 581 0.8000 1.0000 2.0000 0.0000 Constraint 143 572 0.8000 1.0000 2.0000 0.0000 Constraint 143 564 0.8000 1.0000 2.0000 0.0000 Constraint 143 555 0.8000 1.0000 2.0000 0.0000 Constraint 143 544 0.8000 1.0000 2.0000 0.0000 Constraint 143 536 0.8000 1.0000 2.0000 0.0000 Constraint 143 528 0.8000 1.0000 2.0000 0.0000 Constraint 143 523 0.8000 1.0000 2.0000 0.0000 Constraint 143 518 0.8000 1.0000 2.0000 0.0000 Constraint 143 510 0.8000 1.0000 2.0000 0.0000 Constraint 143 502 0.8000 1.0000 2.0000 0.0000 Constraint 143 496 0.8000 1.0000 2.0000 0.0000 Constraint 143 490 0.8000 1.0000 2.0000 0.0000 Constraint 143 479 0.8000 1.0000 2.0000 0.0000 Constraint 143 471 0.8000 1.0000 2.0000 0.0000 Constraint 143 460 0.8000 1.0000 2.0000 0.0000 Constraint 143 451 0.8000 1.0000 2.0000 0.0000 Constraint 143 446 0.8000 1.0000 2.0000 0.0000 Constraint 143 441 0.8000 1.0000 2.0000 0.0000 Constraint 143 436 0.8000 1.0000 2.0000 0.0000 Constraint 143 428 0.8000 1.0000 2.0000 0.0000 Constraint 143 419 0.8000 1.0000 2.0000 0.0000 Constraint 143 413 0.8000 1.0000 2.0000 0.0000 Constraint 143 406 0.8000 1.0000 2.0000 0.0000 Constraint 143 399 0.8000 1.0000 2.0000 0.0000 Constraint 143 392 0.8000 1.0000 2.0000 0.0000 Constraint 143 384 0.8000 1.0000 2.0000 0.0000 Constraint 143 368 0.8000 1.0000 2.0000 0.0000 Constraint 143 357 0.8000 1.0000 2.0000 0.0000 Constraint 143 349 0.8000 1.0000 2.0000 0.0000 Constraint 143 341 0.8000 1.0000 2.0000 0.0000 Constraint 143 336 0.8000 1.0000 2.0000 0.0000 Constraint 143 324 0.8000 1.0000 2.0000 0.0000 Constraint 143 317 0.8000 1.0000 2.0000 0.0000 Constraint 143 310 0.8000 1.0000 2.0000 0.0000 Constraint 143 302 0.8000 1.0000 2.0000 0.0000 Constraint 143 293 0.8000 1.0000 2.0000 0.0000 Constraint 143 287 0.8000 1.0000 2.0000 0.0000 Constraint 143 267 0.8000 1.0000 2.0000 0.0000 Constraint 143 260 0.8000 1.0000 2.0000 0.0000 Constraint 143 253 0.8000 1.0000 2.0000 0.0000 Constraint 143 240 0.8000 1.0000 2.0000 0.0000 Constraint 143 231 0.8000 1.0000 2.0000 0.0000 Constraint 143 217 0.8000 1.0000 2.0000 0.0000 Constraint 143 206 0.8000 1.0000 2.0000 0.0000 Constraint 143 195 0.8000 1.0000 2.0000 0.0000 Constraint 143 187 0.8000 1.0000 2.0000 0.0000 Constraint 143 176 0.8000 1.0000 2.0000 0.0000 Constraint 143 165 0.8000 1.0000 2.0000 0.0000 Constraint 143 158 0.8000 1.0000 2.0000 0.0000 Constraint 143 150 0.8000 1.0000 2.0000 0.0000 Constraint 136 1144 0.8000 1.0000 2.0000 0.0000 Constraint 136 1135 0.8000 1.0000 2.0000 0.0000 Constraint 136 1126 0.8000 1.0000 2.0000 0.0000 Constraint 136 1115 0.8000 1.0000 2.0000 0.0000 Constraint 136 1106 0.8000 1.0000 2.0000 0.0000 Constraint 136 1101 0.8000 1.0000 2.0000 0.0000 Constraint 136 1093 0.8000 1.0000 2.0000 0.0000 Constraint 136 1082 0.8000 1.0000 2.0000 0.0000 Constraint 136 1075 0.8000 1.0000 2.0000 0.0000 Constraint 136 1067 0.8000 1.0000 2.0000 0.0000 Constraint 136 1059 0.8000 1.0000 2.0000 0.0000 Constraint 136 1052 0.8000 1.0000 2.0000 0.0000 Constraint 136 1043 0.8000 1.0000 2.0000 0.0000 Constraint 136 1038 0.8000 1.0000 2.0000 0.0000 Constraint 136 1033 0.8000 1.0000 2.0000 0.0000 Constraint 136 1025 0.8000 1.0000 2.0000 0.0000 Constraint 136 1017 0.8000 1.0000 2.0000 0.0000 Constraint 136 1012 0.8000 1.0000 2.0000 0.0000 Constraint 136 1001 0.8000 1.0000 2.0000 0.0000 Constraint 136 992 0.8000 1.0000 2.0000 0.0000 Constraint 136 986 0.8000 1.0000 2.0000 0.0000 Constraint 136 977 0.8000 1.0000 2.0000 0.0000 Constraint 136 969 0.8000 1.0000 2.0000 0.0000 Constraint 136 961 0.8000 1.0000 2.0000 0.0000 Constraint 136 955 0.8000 1.0000 2.0000 0.0000 Constraint 136 950 0.8000 1.0000 2.0000 0.0000 Constraint 136 940 0.8000 1.0000 2.0000 0.0000 Constraint 136 927 0.8000 1.0000 2.0000 0.0000 Constraint 136 916 0.8000 1.0000 2.0000 0.0000 Constraint 136 909 0.8000 1.0000 2.0000 0.0000 Constraint 136 901 0.8000 1.0000 2.0000 0.0000 Constraint 136 878 0.8000 1.0000 2.0000 0.0000 Constraint 136 869 0.8000 1.0000 2.0000 0.0000 Constraint 136 858 0.8000 1.0000 2.0000 0.0000 Constraint 136 849 0.8000 1.0000 2.0000 0.0000 Constraint 136 844 0.8000 1.0000 2.0000 0.0000 Constraint 136 833 0.8000 1.0000 2.0000 0.0000 Constraint 136 825 0.8000 1.0000 2.0000 0.0000 Constraint 136 809 0.8000 1.0000 2.0000 0.0000 Constraint 136 793 0.8000 1.0000 2.0000 0.0000 Constraint 136 782 0.8000 1.0000 2.0000 0.0000 Constraint 136 771 0.8000 1.0000 2.0000 0.0000 Constraint 136 758 0.8000 1.0000 2.0000 0.0000 Constraint 136 752 0.8000 1.0000 2.0000 0.0000 Constraint 136 746 0.8000 1.0000 2.0000 0.0000 Constraint 136 738 0.8000 1.0000 2.0000 0.0000 Constraint 136 732 0.8000 1.0000 2.0000 0.0000 Constraint 136 725 0.8000 1.0000 2.0000 0.0000 Constraint 136 714 0.8000 1.0000 2.0000 0.0000 Constraint 136 707 0.8000 1.0000 2.0000 0.0000 Constraint 136 696 0.8000 1.0000 2.0000 0.0000 Constraint 136 685 0.8000 1.0000 2.0000 0.0000 Constraint 136 673 0.8000 1.0000 2.0000 0.0000 Constraint 136 664 0.8000 1.0000 2.0000 0.0000 Constraint 136 657 0.8000 1.0000 2.0000 0.0000 Constraint 136 649 0.8000 1.0000 2.0000 0.0000 Constraint 136 644 0.8000 1.0000 2.0000 0.0000 Constraint 136 634 0.8000 1.0000 2.0000 0.0000 Constraint 136 623 0.8000 1.0000 2.0000 0.0000 Constraint 136 616 0.8000 1.0000 2.0000 0.0000 Constraint 136 608 0.8000 1.0000 2.0000 0.0000 Constraint 136 600 0.8000 1.0000 2.0000 0.0000 Constraint 136 581 0.8000 1.0000 2.0000 0.0000 Constraint 136 572 0.8000 1.0000 2.0000 0.0000 Constraint 136 564 0.8000 1.0000 2.0000 0.0000 Constraint 136 555 0.8000 1.0000 2.0000 0.0000 Constraint 136 544 0.8000 1.0000 2.0000 0.0000 Constraint 136 536 0.8000 1.0000 2.0000 0.0000 Constraint 136 528 0.8000 1.0000 2.0000 0.0000 Constraint 136 523 0.8000 1.0000 2.0000 0.0000 Constraint 136 518 0.8000 1.0000 2.0000 0.0000 Constraint 136 510 0.8000 1.0000 2.0000 0.0000 Constraint 136 502 0.8000 1.0000 2.0000 0.0000 Constraint 136 496 0.8000 1.0000 2.0000 0.0000 Constraint 136 490 0.8000 1.0000 2.0000 0.0000 Constraint 136 479 0.8000 1.0000 2.0000 0.0000 Constraint 136 471 0.8000 1.0000 2.0000 0.0000 Constraint 136 460 0.8000 1.0000 2.0000 0.0000 Constraint 136 451 0.8000 1.0000 2.0000 0.0000 Constraint 136 446 0.8000 1.0000 2.0000 0.0000 Constraint 136 441 0.8000 1.0000 2.0000 0.0000 Constraint 136 436 0.8000 1.0000 2.0000 0.0000 Constraint 136 428 0.8000 1.0000 2.0000 0.0000 Constraint 136 419 0.8000 1.0000 2.0000 0.0000 Constraint 136 413 0.8000 1.0000 2.0000 0.0000 Constraint 136 406 0.8000 1.0000 2.0000 0.0000 Constraint 136 399 0.8000 1.0000 2.0000 0.0000 Constraint 136 392 0.8000 1.0000 2.0000 0.0000 Constraint 136 384 0.8000 1.0000 2.0000 0.0000 Constraint 136 368 0.8000 1.0000 2.0000 0.0000 Constraint 136 357 0.8000 1.0000 2.0000 0.0000 Constraint 136 349 0.8000 1.0000 2.0000 0.0000 Constraint 136 341 0.8000 1.0000 2.0000 0.0000 Constraint 136 336 0.8000 1.0000 2.0000 0.0000 Constraint 136 324 0.8000 1.0000 2.0000 0.0000 Constraint 136 317 0.8000 1.0000 2.0000 0.0000 Constraint 136 310 0.8000 1.0000 2.0000 0.0000 Constraint 136 302 0.8000 1.0000 2.0000 0.0000 Constraint 136 293 0.8000 1.0000 2.0000 0.0000 Constraint 136 287 0.8000 1.0000 2.0000 0.0000 Constraint 136 276 0.8000 1.0000 2.0000 0.0000 Constraint 136 267 0.8000 1.0000 2.0000 0.0000 Constraint 136 260 0.8000 1.0000 2.0000 0.0000 Constraint 136 253 0.8000 1.0000 2.0000 0.0000 Constraint 136 245 0.8000 1.0000 2.0000 0.0000 Constraint 136 240 0.8000 1.0000 2.0000 0.0000 Constraint 136 231 0.8000 1.0000 2.0000 0.0000 Constraint 136 226 0.8000 1.0000 2.0000 0.0000 Constraint 136 206 0.8000 1.0000 2.0000 0.0000 Constraint 136 195 0.8000 1.0000 2.0000 0.0000 Constraint 136 187 0.8000 1.0000 2.0000 0.0000 Constraint 136 176 0.8000 1.0000 2.0000 0.0000 Constraint 136 165 0.8000 1.0000 2.0000 0.0000 Constraint 136 158 0.8000 1.0000 2.0000 0.0000 Constraint 136 150 0.8000 1.0000 2.0000 0.0000 Constraint 136 143 0.8000 1.0000 2.0000 0.0000 Constraint 129 1144 0.8000 1.0000 2.0000 0.0000 Constraint 129 1135 0.8000 1.0000 2.0000 0.0000 Constraint 129 1126 0.8000 1.0000 2.0000 0.0000 Constraint 129 1115 0.8000 1.0000 2.0000 0.0000 Constraint 129 1106 0.8000 1.0000 2.0000 0.0000 Constraint 129 1101 0.8000 1.0000 2.0000 0.0000 Constraint 129 1093 0.8000 1.0000 2.0000 0.0000 Constraint 129 1082 0.8000 1.0000 2.0000 0.0000 Constraint 129 1075 0.8000 1.0000 2.0000 0.0000 Constraint 129 1059 0.8000 1.0000 2.0000 0.0000 Constraint 129 1052 0.8000 1.0000 2.0000 0.0000 Constraint 129 1043 0.8000 1.0000 2.0000 0.0000 Constraint 129 1038 0.8000 1.0000 2.0000 0.0000 Constraint 129 1017 0.8000 1.0000 2.0000 0.0000 Constraint 129 1012 0.8000 1.0000 2.0000 0.0000 Constraint 129 1001 0.8000 1.0000 2.0000 0.0000 Constraint 129 992 0.8000 1.0000 2.0000 0.0000 Constraint 129 986 0.8000 1.0000 2.0000 0.0000 Constraint 129 977 0.8000 1.0000 2.0000 0.0000 Constraint 129 969 0.8000 1.0000 2.0000 0.0000 Constraint 129 961 0.8000 1.0000 2.0000 0.0000 Constraint 129 955 0.8000 1.0000 2.0000 0.0000 Constraint 129 950 0.8000 1.0000 2.0000 0.0000 Constraint 129 940 0.8000 1.0000 2.0000 0.0000 Constraint 129 927 0.8000 1.0000 2.0000 0.0000 Constraint 129 916 0.8000 1.0000 2.0000 0.0000 Constraint 129 909 0.8000 1.0000 2.0000 0.0000 Constraint 129 901 0.8000 1.0000 2.0000 0.0000 Constraint 129 887 0.8000 1.0000 2.0000 0.0000 Constraint 129 878 0.8000 1.0000 2.0000 0.0000 Constraint 129 869 0.8000 1.0000 2.0000 0.0000 Constraint 129 858 0.8000 1.0000 2.0000 0.0000 Constraint 129 849 0.8000 1.0000 2.0000 0.0000 Constraint 129 844 0.8000 1.0000 2.0000 0.0000 Constraint 129 833 0.8000 1.0000 2.0000 0.0000 Constraint 129 809 0.8000 1.0000 2.0000 0.0000 Constraint 129 782 0.8000 1.0000 2.0000 0.0000 Constraint 129 771 0.8000 1.0000 2.0000 0.0000 Constraint 129 758 0.8000 1.0000 2.0000 0.0000 Constraint 129 752 0.8000 1.0000 2.0000 0.0000 Constraint 129 746 0.8000 1.0000 2.0000 0.0000 Constraint 129 732 0.8000 1.0000 2.0000 0.0000 Constraint 129 725 0.8000 1.0000 2.0000 0.0000 Constraint 129 714 0.8000 1.0000 2.0000 0.0000 Constraint 129 707 0.8000 1.0000 2.0000 0.0000 Constraint 129 696 0.8000 1.0000 2.0000 0.0000 Constraint 129 685 0.8000 1.0000 2.0000 0.0000 Constraint 129 673 0.8000 1.0000 2.0000 0.0000 Constraint 129 664 0.8000 1.0000 2.0000 0.0000 Constraint 129 657 0.8000 1.0000 2.0000 0.0000 Constraint 129 649 0.8000 1.0000 2.0000 0.0000 Constraint 129 644 0.8000 1.0000 2.0000 0.0000 Constraint 129 634 0.8000 1.0000 2.0000 0.0000 Constraint 129 623 0.8000 1.0000 2.0000 0.0000 Constraint 129 616 0.8000 1.0000 2.0000 0.0000 Constraint 129 581 0.8000 1.0000 2.0000 0.0000 Constraint 129 572 0.8000 1.0000 2.0000 0.0000 Constraint 129 555 0.8000 1.0000 2.0000 0.0000 Constraint 129 544 0.8000 1.0000 2.0000 0.0000 Constraint 129 536 0.8000 1.0000 2.0000 0.0000 Constraint 129 528 0.8000 1.0000 2.0000 0.0000 Constraint 129 523 0.8000 1.0000 2.0000 0.0000 Constraint 129 518 0.8000 1.0000 2.0000 0.0000 Constraint 129 510 0.8000 1.0000 2.0000 0.0000 Constraint 129 502 0.8000 1.0000 2.0000 0.0000 Constraint 129 496 0.8000 1.0000 2.0000 0.0000 Constraint 129 490 0.8000 1.0000 2.0000 0.0000 Constraint 129 479 0.8000 1.0000 2.0000 0.0000 Constraint 129 471 0.8000 1.0000 2.0000 0.0000 Constraint 129 460 0.8000 1.0000 2.0000 0.0000 Constraint 129 446 0.8000 1.0000 2.0000 0.0000 Constraint 129 441 0.8000 1.0000 2.0000 0.0000 Constraint 129 436 0.8000 1.0000 2.0000 0.0000 Constraint 129 428 0.8000 1.0000 2.0000 0.0000 Constraint 129 419 0.8000 1.0000 2.0000 0.0000 Constraint 129 413 0.8000 1.0000 2.0000 0.0000 Constraint 129 406 0.8000 1.0000 2.0000 0.0000 Constraint 129 399 0.8000 1.0000 2.0000 0.0000 Constraint 129 392 0.8000 1.0000 2.0000 0.0000 Constraint 129 384 0.8000 1.0000 2.0000 0.0000 Constraint 129 368 0.8000 1.0000 2.0000 0.0000 Constraint 129 357 0.8000 1.0000 2.0000 0.0000 Constraint 129 349 0.8000 1.0000 2.0000 0.0000 Constraint 129 341 0.8000 1.0000 2.0000 0.0000 Constraint 129 336 0.8000 1.0000 2.0000 0.0000 Constraint 129 324 0.8000 1.0000 2.0000 0.0000 Constraint 129 317 0.8000 1.0000 2.0000 0.0000 Constraint 129 310 0.8000 1.0000 2.0000 0.0000 Constraint 129 302 0.8000 1.0000 2.0000 0.0000 Constraint 129 293 0.8000 1.0000 2.0000 0.0000 Constraint 129 287 0.8000 1.0000 2.0000 0.0000 Constraint 129 267 0.8000 1.0000 2.0000 0.0000 Constraint 129 260 0.8000 1.0000 2.0000 0.0000 Constraint 129 253 0.8000 1.0000 2.0000 0.0000 Constraint 129 245 0.8000 1.0000 2.0000 0.0000 Constraint 129 240 0.8000 1.0000 2.0000 0.0000 Constraint 129 195 0.8000 1.0000 2.0000 0.0000 Constraint 129 187 0.8000 1.0000 2.0000 0.0000 Constraint 129 176 0.8000 1.0000 2.0000 0.0000 Constraint 129 165 0.8000 1.0000 2.0000 0.0000 Constraint 129 158 0.8000 1.0000 2.0000 0.0000 Constraint 129 150 0.8000 1.0000 2.0000 0.0000 Constraint 129 143 0.8000 1.0000 2.0000 0.0000 Constraint 129 136 0.8000 1.0000 2.0000 0.0000 Constraint 120 1144 0.8000 1.0000 2.0000 0.0000 Constraint 120 1135 0.8000 1.0000 2.0000 0.0000 Constraint 120 1126 0.8000 1.0000 2.0000 0.0000 Constraint 120 1115 0.8000 1.0000 2.0000 0.0000 Constraint 120 1106 0.8000 1.0000 2.0000 0.0000 Constraint 120 1101 0.8000 1.0000 2.0000 0.0000 Constraint 120 1093 0.8000 1.0000 2.0000 0.0000 Constraint 120 1082 0.8000 1.0000 2.0000 0.0000 Constraint 120 1075 0.8000 1.0000 2.0000 0.0000 Constraint 120 1067 0.8000 1.0000 2.0000 0.0000 Constraint 120 1059 0.8000 1.0000 2.0000 0.0000 Constraint 120 1052 0.8000 1.0000 2.0000 0.0000 Constraint 120 1038 0.8000 1.0000 2.0000 0.0000 Constraint 120 1017 0.8000 1.0000 2.0000 0.0000 Constraint 120 1012 0.8000 1.0000 2.0000 0.0000 Constraint 120 992 0.8000 1.0000 2.0000 0.0000 Constraint 120 986 0.8000 1.0000 2.0000 0.0000 Constraint 120 977 0.8000 1.0000 2.0000 0.0000 Constraint 120 969 0.8000 1.0000 2.0000 0.0000 Constraint 120 961 0.8000 1.0000 2.0000 0.0000 Constraint 120 950 0.8000 1.0000 2.0000 0.0000 Constraint 120 940 0.8000 1.0000 2.0000 0.0000 Constraint 120 916 0.8000 1.0000 2.0000 0.0000 Constraint 120 909 0.8000 1.0000 2.0000 0.0000 Constraint 120 901 0.8000 1.0000 2.0000 0.0000 Constraint 120 887 0.8000 1.0000 2.0000 0.0000 Constraint 120 878 0.8000 1.0000 2.0000 0.0000 Constraint 120 869 0.8000 1.0000 2.0000 0.0000 Constraint 120 849 0.8000 1.0000 2.0000 0.0000 Constraint 120 844 0.8000 1.0000 2.0000 0.0000 Constraint 120 833 0.8000 1.0000 2.0000 0.0000 Constraint 120 825 0.8000 1.0000 2.0000 0.0000 Constraint 120 809 0.8000 1.0000 2.0000 0.0000 Constraint 120 801 0.8000 1.0000 2.0000 0.0000 Constraint 120 793 0.8000 1.0000 2.0000 0.0000 Constraint 120 782 0.8000 1.0000 2.0000 0.0000 Constraint 120 771 0.8000 1.0000 2.0000 0.0000 Constraint 120 758 0.8000 1.0000 2.0000 0.0000 Constraint 120 752 0.8000 1.0000 2.0000 0.0000 Constraint 120 746 0.8000 1.0000 2.0000 0.0000 Constraint 120 732 0.8000 1.0000 2.0000 0.0000 Constraint 120 725 0.8000 1.0000 2.0000 0.0000 Constraint 120 714 0.8000 1.0000 2.0000 0.0000 Constraint 120 707 0.8000 1.0000 2.0000 0.0000 Constraint 120 696 0.8000 1.0000 2.0000 0.0000 Constraint 120 685 0.8000 1.0000 2.0000 0.0000 Constraint 120 673 0.8000 1.0000 2.0000 0.0000 Constraint 120 664 0.8000 1.0000 2.0000 0.0000 Constraint 120 657 0.8000 1.0000 2.0000 0.0000 Constraint 120 649 0.8000 1.0000 2.0000 0.0000 Constraint 120 644 0.8000 1.0000 2.0000 0.0000 Constraint 120 634 0.8000 1.0000 2.0000 0.0000 Constraint 120 623 0.8000 1.0000 2.0000 0.0000 Constraint 120 616 0.8000 1.0000 2.0000 0.0000 Constraint 120 608 0.8000 1.0000 2.0000 0.0000 Constraint 120 581 0.8000 1.0000 2.0000 0.0000 Constraint 120 572 0.8000 1.0000 2.0000 0.0000 Constraint 120 555 0.8000 1.0000 2.0000 0.0000 Constraint 120 544 0.8000 1.0000 2.0000 0.0000 Constraint 120 536 0.8000 1.0000 2.0000 0.0000 Constraint 120 528 0.8000 1.0000 2.0000 0.0000 Constraint 120 523 0.8000 1.0000 2.0000 0.0000 Constraint 120 518 0.8000 1.0000 2.0000 0.0000 Constraint 120 502 0.8000 1.0000 2.0000 0.0000 Constraint 120 496 0.8000 1.0000 2.0000 0.0000 Constraint 120 490 0.8000 1.0000 2.0000 0.0000 Constraint 120 479 0.8000 1.0000 2.0000 0.0000 Constraint 120 471 0.8000 1.0000 2.0000 0.0000 Constraint 120 460 0.8000 1.0000 2.0000 0.0000 Constraint 120 441 0.8000 1.0000 2.0000 0.0000 Constraint 120 436 0.8000 1.0000 2.0000 0.0000 Constraint 120 413 0.8000 1.0000 2.0000 0.0000 Constraint 120 406 0.8000 1.0000 2.0000 0.0000 Constraint 120 399 0.8000 1.0000 2.0000 0.0000 Constraint 120 384 0.8000 1.0000 2.0000 0.0000 Constraint 120 357 0.8000 1.0000 2.0000 0.0000 Constraint 120 349 0.8000 1.0000 2.0000 0.0000 Constraint 120 341 0.8000 1.0000 2.0000 0.0000 Constraint 120 336 0.8000 1.0000 2.0000 0.0000 Constraint 120 324 0.8000 1.0000 2.0000 0.0000 Constraint 120 317 0.8000 1.0000 2.0000 0.0000 Constraint 120 310 0.8000 1.0000 2.0000 0.0000 Constraint 120 302 0.8000 1.0000 2.0000 0.0000 Constraint 120 293 0.8000 1.0000 2.0000 0.0000 Constraint 120 287 0.8000 1.0000 2.0000 0.0000 Constraint 120 276 0.8000 1.0000 2.0000 0.0000 Constraint 120 267 0.8000 1.0000 2.0000 0.0000 Constraint 120 260 0.8000 1.0000 2.0000 0.0000 Constraint 120 253 0.8000 1.0000 2.0000 0.0000 Constraint 120 245 0.8000 1.0000 2.0000 0.0000 Constraint 120 240 0.8000 1.0000 2.0000 0.0000 Constraint 120 231 0.8000 1.0000 2.0000 0.0000 Constraint 120 206 0.8000 1.0000 2.0000 0.0000 Constraint 120 187 0.8000 1.0000 2.0000 0.0000 Constraint 120 176 0.8000 1.0000 2.0000 0.0000 Constraint 120 165 0.8000 1.0000 2.0000 0.0000 Constraint 120 158 0.8000 1.0000 2.0000 0.0000 Constraint 120 150 0.8000 1.0000 2.0000 0.0000 Constraint 120 143 0.8000 1.0000 2.0000 0.0000 Constraint 120 136 0.8000 1.0000 2.0000 0.0000 Constraint 120 129 0.8000 1.0000 2.0000 0.0000 Constraint 114 1144 0.8000 1.0000 2.0000 0.0000 Constraint 114 1135 0.8000 1.0000 2.0000 0.0000 Constraint 114 1126 0.8000 1.0000 2.0000 0.0000 Constraint 114 1115 0.8000 1.0000 2.0000 0.0000 Constraint 114 1106 0.8000 1.0000 2.0000 0.0000 Constraint 114 1101 0.8000 1.0000 2.0000 0.0000 Constraint 114 1093 0.8000 1.0000 2.0000 0.0000 Constraint 114 1082 0.8000 1.0000 2.0000 0.0000 Constraint 114 1075 0.8000 1.0000 2.0000 0.0000 Constraint 114 1067 0.8000 1.0000 2.0000 0.0000 Constraint 114 1059 0.8000 1.0000 2.0000 0.0000 Constraint 114 1052 0.8000 1.0000 2.0000 0.0000 Constraint 114 1043 0.8000 1.0000 2.0000 0.0000 Constraint 114 1038 0.8000 1.0000 2.0000 0.0000 Constraint 114 1033 0.8000 1.0000 2.0000 0.0000 Constraint 114 1025 0.8000 1.0000 2.0000 0.0000 Constraint 114 1017 0.8000 1.0000 2.0000 0.0000 Constraint 114 1012 0.8000 1.0000 2.0000 0.0000 Constraint 114 992 0.8000 1.0000 2.0000 0.0000 Constraint 114 977 0.8000 1.0000 2.0000 0.0000 Constraint 114 969 0.8000 1.0000 2.0000 0.0000 Constraint 114 961 0.8000 1.0000 2.0000 0.0000 Constraint 114 955 0.8000 1.0000 2.0000 0.0000 Constraint 114 950 0.8000 1.0000 2.0000 0.0000 Constraint 114 940 0.8000 1.0000 2.0000 0.0000 Constraint 114 916 0.8000 1.0000 2.0000 0.0000 Constraint 114 909 0.8000 1.0000 2.0000 0.0000 Constraint 114 901 0.8000 1.0000 2.0000 0.0000 Constraint 114 887 0.8000 1.0000 2.0000 0.0000 Constraint 114 878 0.8000 1.0000 2.0000 0.0000 Constraint 114 869 0.8000 1.0000 2.0000 0.0000 Constraint 114 858 0.8000 1.0000 2.0000 0.0000 Constraint 114 849 0.8000 1.0000 2.0000 0.0000 Constraint 114 844 0.8000 1.0000 2.0000 0.0000 Constraint 114 833 0.8000 1.0000 2.0000 0.0000 Constraint 114 825 0.8000 1.0000 2.0000 0.0000 Constraint 114 809 0.8000 1.0000 2.0000 0.0000 Constraint 114 801 0.8000 1.0000 2.0000 0.0000 Constraint 114 793 0.8000 1.0000 2.0000 0.0000 Constraint 114 782 0.8000 1.0000 2.0000 0.0000 Constraint 114 771 0.8000 1.0000 2.0000 0.0000 Constraint 114 758 0.8000 1.0000 2.0000 0.0000 Constraint 114 752 0.8000 1.0000 2.0000 0.0000 Constraint 114 746 0.8000 1.0000 2.0000 0.0000 Constraint 114 738 0.8000 1.0000 2.0000 0.0000 Constraint 114 732 0.8000 1.0000 2.0000 0.0000 Constraint 114 725 0.8000 1.0000 2.0000 0.0000 Constraint 114 714 0.8000 1.0000 2.0000 0.0000 Constraint 114 707 0.8000 1.0000 2.0000 0.0000 Constraint 114 696 0.8000 1.0000 2.0000 0.0000 Constraint 114 685 0.8000 1.0000 2.0000 0.0000 Constraint 114 673 0.8000 1.0000 2.0000 0.0000 Constraint 114 664 0.8000 1.0000 2.0000 0.0000 Constraint 114 657 0.8000 1.0000 2.0000 0.0000 Constraint 114 649 0.8000 1.0000 2.0000 0.0000 Constraint 114 644 0.8000 1.0000 2.0000 0.0000 Constraint 114 634 0.8000 1.0000 2.0000 0.0000 Constraint 114 623 0.8000 1.0000 2.0000 0.0000 Constraint 114 616 0.8000 1.0000 2.0000 0.0000 Constraint 114 608 0.8000 1.0000 2.0000 0.0000 Constraint 114 600 0.8000 1.0000 2.0000 0.0000 Constraint 114 581 0.8000 1.0000 2.0000 0.0000 Constraint 114 572 0.8000 1.0000 2.0000 0.0000 Constraint 114 555 0.8000 1.0000 2.0000 0.0000 Constraint 114 544 0.8000 1.0000 2.0000 0.0000 Constraint 114 523 0.8000 1.0000 2.0000 0.0000 Constraint 114 518 0.8000 1.0000 2.0000 0.0000 Constraint 114 502 0.8000 1.0000 2.0000 0.0000 Constraint 114 496 0.8000 1.0000 2.0000 0.0000 Constraint 114 490 0.8000 1.0000 2.0000 0.0000 Constraint 114 479 0.8000 1.0000 2.0000 0.0000 Constraint 114 460 0.8000 1.0000 2.0000 0.0000 Constraint 114 446 0.8000 1.0000 2.0000 0.0000 Constraint 114 441 0.8000 1.0000 2.0000 0.0000 Constraint 114 436 0.8000 1.0000 2.0000 0.0000 Constraint 114 419 0.8000 1.0000 2.0000 0.0000 Constraint 114 413 0.8000 1.0000 2.0000 0.0000 Constraint 114 406 0.8000 1.0000 2.0000 0.0000 Constraint 114 399 0.8000 1.0000 2.0000 0.0000 Constraint 114 392 0.8000 1.0000 2.0000 0.0000 Constraint 114 384 0.8000 1.0000 2.0000 0.0000 Constraint 114 357 0.8000 1.0000 2.0000 0.0000 Constraint 114 349 0.8000 1.0000 2.0000 0.0000 Constraint 114 341 0.8000 1.0000 2.0000 0.0000 Constraint 114 336 0.8000 1.0000 2.0000 0.0000 Constraint 114 324 0.8000 1.0000 2.0000 0.0000 Constraint 114 317 0.8000 1.0000 2.0000 0.0000 Constraint 114 310 0.8000 1.0000 2.0000 0.0000 Constraint 114 302 0.8000 1.0000 2.0000 0.0000 Constraint 114 293 0.8000 1.0000 2.0000 0.0000 Constraint 114 287 0.8000 1.0000 2.0000 0.0000 Constraint 114 276 0.8000 1.0000 2.0000 0.0000 Constraint 114 267 0.8000 1.0000 2.0000 0.0000 Constraint 114 260 0.8000 1.0000 2.0000 0.0000 Constraint 114 253 0.8000 1.0000 2.0000 0.0000 Constraint 114 240 0.8000 1.0000 2.0000 0.0000 Constraint 114 206 0.8000 1.0000 2.0000 0.0000 Constraint 114 195 0.8000 1.0000 2.0000 0.0000 Constraint 114 176 0.8000 1.0000 2.0000 0.0000 Constraint 114 165 0.8000 1.0000 2.0000 0.0000 Constraint 114 158 0.8000 1.0000 2.0000 0.0000 Constraint 114 150 0.8000 1.0000 2.0000 0.0000 Constraint 114 143 0.8000 1.0000 2.0000 0.0000 Constraint 114 136 0.8000 1.0000 2.0000 0.0000 Constraint 114 129 0.8000 1.0000 2.0000 0.0000 Constraint 114 120 0.8000 1.0000 2.0000 0.0000 Constraint 103 1144 0.8000 1.0000 2.0000 0.0000 Constraint 103 1135 0.8000 1.0000 2.0000 0.0000 Constraint 103 1126 0.8000 1.0000 2.0000 0.0000 Constraint 103 1115 0.8000 1.0000 2.0000 0.0000 Constraint 103 1106 0.8000 1.0000 2.0000 0.0000 Constraint 103 1101 0.8000 1.0000 2.0000 0.0000 Constraint 103 1093 0.8000 1.0000 2.0000 0.0000 Constraint 103 1082 0.8000 1.0000 2.0000 0.0000 Constraint 103 1075 0.8000 1.0000 2.0000 0.0000 Constraint 103 1059 0.8000 1.0000 2.0000 0.0000 Constraint 103 1052 0.8000 1.0000 2.0000 0.0000 Constraint 103 1043 0.8000 1.0000 2.0000 0.0000 Constraint 103 1038 0.8000 1.0000 2.0000 0.0000 Constraint 103 1033 0.8000 1.0000 2.0000 0.0000 Constraint 103 1025 0.8000 1.0000 2.0000 0.0000 Constraint 103 1017 0.8000 1.0000 2.0000 0.0000 Constraint 103 1012 0.8000 1.0000 2.0000 0.0000 Constraint 103 1001 0.8000 1.0000 2.0000 0.0000 Constraint 103 992 0.8000 1.0000 2.0000 0.0000 Constraint 103 986 0.8000 1.0000 2.0000 0.0000 Constraint 103 977 0.8000 1.0000 2.0000 0.0000 Constraint 103 969 0.8000 1.0000 2.0000 0.0000 Constraint 103 961 0.8000 1.0000 2.0000 0.0000 Constraint 103 955 0.8000 1.0000 2.0000 0.0000 Constraint 103 950 0.8000 1.0000 2.0000 0.0000 Constraint 103 940 0.8000 1.0000 2.0000 0.0000 Constraint 103 932 0.8000 1.0000 2.0000 0.0000 Constraint 103 927 0.8000 1.0000 2.0000 0.0000 Constraint 103 916 0.8000 1.0000 2.0000 0.0000 Constraint 103 909 0.8000 1.0000 2.0000 0.0000 Constraint 103 901 0.8000 1.0000 2.0000 0.0000 Constraint 103 887 0.8000 1.0000 2.0000 0.0000 Constraint 103 878 0.8000 1.0000 2.0000 0.0000 Constraint 103 869 0.8000 1.0000 2.0000 0.0000 Constraint 103 858 0.8000 1.0000 2.0000 0.0000 Constraint 103 849 0.8000 1.0000 2.0000 0.0000 Constraint 103 844 0.8000 1.0000 2.0000 0.0000 Constraint 103 833 0.8000 1.0000 2.0000 0.0000 Constraint 103 809 0.8000 1.0000 2.0000 0.0000 Constraint 103 801 0.8000 1.0000 2.0000 0.0000 Constraint 103 782 0.8000 1.0000 2.0000 0.0000 Constraint 103 771 0.8000 1.0000 2.0000 0.0000 Constraint 103 758 0.8000 1.0000 2.0000 0.0000 Constraint 103 752 0.8000 1.0000 2.0000 0.0000 Constraint 103 746 0.8000 1.0000 2.0000 0.0000 Constraint 103 732 0.8000 1.0000 2.0000 0.0000 Constraint 103 725 0.8000 1.0000 2.0000 0.0000 Constraint 103 714 0.8000 1.0000 2.0000 0.0000 Constraint 103 707 0.8000 1.0000 2.0000 0.0000 Constraint 103 696 0.8000 1.0000 2.0000 0.0000 Constraint 103 685 0.8000 1.0000 2.0000 0.0000 Constraint 103 673 0.8000 1.0000 2.0000 0.0000 Constraint 103 664 0.8000 1.0000 2.0000 0.0000 Constraint 103 657 0.8000 1.0000 2.0000 0.0000 Constraint 103 649 0.8000 1.0000 2.0000 0.0000 Constraint 103 644 0.8000 1.0000 2.0000 0.0000 Constraint 103 634 0.8000 1.0000 2.0000 0.0000 Constraint 103 623 0.8000 1.0000 2.0000 0.0000 Constraint 103 616 0.8000 1.0000 2.0000 0.0000 Constraint 103 608 0.8000 1.0000 2.0000 0.0000 Constraint 103 581 0.8000 1.0000 2.0000 0.0000 Constraint 103 572 0.8000 1.0000 2.0000 0.0000 Constraint 103 555 0.8000 1.0000 2.0000 0.0000 Constraint 103 544 0.8000 1.0000 2.0000 0.0000 Constraint 103 536 0.8000 1.0000 2.0000 0.0000 Constraint 103 528 0.8000 1.0000 2.0000 0.0000 Constraint 103 523 0.8000 1.0000 2.0000 0.0000 Constraint 103 518 0.8000 1.0000 2.0000 0.0000 Constraint 103 510 0.8000 1.0000 2.0000 0.0000 Constraint 103 502 0.8000 1.0000 2.0000 0.0000 Constraint 103 496 0.8000 1.0000 2.0000 0.0000 Constraint 103 490 0.8000 1.0000 2.0000 0.0000 Constraint 103 479 0.8000 1.0000 2.0000 0.0000 Constraint 103 446 0.8000 1.0000 2.0000 0.0000 Constraint 103 441 0.8000 1.0000 2.0000 0.0000 Constraint 103 436 0.8000 1.0000 2.0000 0.0000 Constraint 103 428 0.8000 1.0000 2.0000 0.0000 Constraint 103 419 0.8000 1.0000 2.0000 0.0000 Constraint 103 413 0.8000 1.0000 2.0000 0.0000 Constraint 103 406 0.8000 1.0000 2.0000 0.0000 Constraint 103 399 0.8000 1.0000 2.0000 0.0000 Constraint 103 392 0.8000 1.0000 2.0000 0.0000 Constraint 103 384 0.8000 1.0000 2.0000 0.0000 Constraint 103 357 0.8000 1.0000 2.0000 0.0000 Constraint 103 349 0.8000 1.0000 2.0000 0.0000 Constraint 103 341 0.8000 1.0000 2.0000 0.0000 Constraint 103 336 0.8000 1.0000 2.0000 0.0000 Constraint 103 324 0.8000 1.0000 2.0000 0.0000 Constraint 103 317 0.8000 1.0000 2.0000 0.0000 Constraint 103 310 0.8000 1.0000 2.0000 0.0000 Constraint 103 287 0.8000 1.0000 2.0000 0.0000 Constraint 103 276 0.8000 1.0000 2.0000 0.0000 Constraint 103 260 0.8000 1.0000 2.0000 0.0000 Constraint 103 253 0.8000 1.0000 2.0000 0.0000 Constraint 103 245 0.8000 1.0000 2.0000 0.0000 Constraint 103 240 0.8000 1.0000 2.0000 0.0000 Constraint 103 231 0.8000 1.0000 2.0000 0.0000 Constraint 103 226 0.8000 1.0000 2.0000 0.0000 Constraint 103 165 0.8000 1.0000 2.0000 0.0000 Constraint 103 158 0.8000 1.0000 2.0000 0.0000 Constraint 103 150 0.8000 1.0000 2.0000 0.0000 Constraint 103 143 0.8000 1.0000 2.0000 0.0000 Constraint 103 136 0.8000 1.0000 2.0000 0.0000 Constraint 103 129 0.8000 1.0000 2.0000 0.0000 Constraint 103 120 0.8000 1.0000 2.0000 0.0000 Constraint 103 114 0.8000 1.0000 2.0000 0.0000 Constraint 95 1144 0.8000 1.0000 2.0000 0.0000 Constraint 95 1135 0.8000 1.0000 2.0000 0.0000 Constraint 95 1126 0.8000 1.0000 2.0000 0.0000 Constraint 95 1115 0.8000 1.0000 2.0000 0.0000 Constraint 95 1106 0.8000 1.0000 2.0000 0.0000 Constraint 95 1101 0.8000 1.0000 2.0000 0.0000 Constraint 95 1082 0.8000 1.0000 2.0000 0.0000 Constraint 95 1075 0.8000 1.0000 2.0000 0.0000 Constraint 95 1059 0.8000 1.0000 2.0000 0.0000 Constraint 95 1052 0.8000 1.0000 2.0000 0.0000 Constraint 95 1038 0.8000 1.0000 2.0000 0.0000 Constraint 95 1017 0.8000 1.0000 2.0000 0.0000 Constraint 95 1012 0.8000 1.0000 2.0000 0.0000 Constraint 95 1001 0.8000 1.0000 2.0000 0.0000 Constraint 95 992 0.8000 1.0000 2.0000 0.0000 Constraint 95 986 0.8000 1.0000 2.0000 0.0000 Constraint 95 977 0.8000 1.0000 2.0000 0.0000 Constraint 95 969 0.8000 1.0000 2.0000 0.0000 Constraint 95 961 0.8000 1.0000 2.0000 0.0000 Constraint 95 955 0.8000 1.0000 2.0000 0.0000 Constraint 95 950 0.8000 1.0000 2.0000 0.0000 Constraint 95 940 0.8000 1.0000 2.0000 0.0000 Constraint 95 932 0.8000 1.0000 2.0000 0.0000 Constraint 95 927 0.8000 1.0000 2.0000 0.0000 Constraint 95 916 0.8000 1.0000 2.0000 0.0000 Constraint 95 909 0.8000 1.0000 2.0000 0.0000 Constraint 95 901 0.8000 1.0000 2.0000 0.0000 Constraint 95 887 0.8000 1.0000 2.0000 0.0000 Constraint 95 878 0.8000 1.0000 2.0000 0.0000 Constraint 95 869 0.8000 1.0000 2.0000 0.0000 Constraint 95 858 0.8000 1.0000 2.0000 0.0000 Constraint 95 849 0.8000 1.0000 2.0000 0.0000 Constraint 95 844 0.8000 1.0000 2.0000 0.0000 Constraint 95 833 0.8000 1.0000 2.0000 0.0000 Constraint 95 825 0.8000 1.0000 2.0000 0.0000 Constraint 95 809 0.8000 1.0000 2.0000 0.0000 Constraint 95 801 0.8000 1.0000 2.0000 0.0000 Constraint 95 793 0.8000 1.0000 2.0000 0.0000 Constraint 95 782 0.8000 1.0000 2.0000 0.0000 Constraint 95 771 0.8000 1.0000 2.0000 0.0000 Constraint 95 758 0.8000 1.0000 2.0000 0.0000 Constraint 95 752 0.8000 1.0000 2.0000 0.0000 Constraint 95 746 0.8000 1.0000 2.0000 0.0000 Constraint 95 738 0.8000 1.0000 2.0000 0.0000 Constraint 95 732 0.8000 1.0000 2.0000 0.0000 Constraint 95 725 0.8000 1.0000 2.0000 0.0000 Constraint 95 714 0.8000 1.0000 2.0000 0.0000 Constraint 95 707 0.8000 1.0000 2.0000 0.0000 Constraint 95 696 0.8000 1.0000 2.0000 0.0000 Constraint 95 685 0.8000 1.0000 2.0000 0.0000 Constraint 95 673 0.8000 1.0000 2.0000 0.0000 Constraint 95 664 0.8000 1.0000 2.0000 0.0000 Constraint 95 657 0.8000 1.0000 2.0000 0.0000 Constraint 95 649 0.8000 1.0000 2.0000 0.0000 Constraint 95 644 0.8000 1.0000 2.0000 0.0000 Constraint 95 634 0.8000 1.0000 2.0000 0.0000 Constraint 95 623 0.8000 1.0000 2.0000 0.0000 Constraint 95 616 0.8000 1.0000 2.0000 0.0000 Constraint 95 608 0.8000 1.0000 2.0000 0.0000 Constraint 95 581 0.8000 1.0000 2.0000 0.0000 Constraint 95 572 0.8000 1.0000 2.0000 0.0000 Constraint 95 544 0.8000 1.0000 2.0000 0.0000 Constraint 95 523 0.8000 1.0000 2.0000 0.0000 Constraint 95 518 0.8000 1.0000 2.0000 0.0000 Constraint 95 502 0.8000 1.0000 2.0000 0.0000 Constraint 95 496 0.8000 1.0000 2.0000 0.0000 Constraint 95 490 0.8000 1.0000 2.0000 0.0000 Constraint 95 479 0.8000 1.0000 2.0000 0.0000 Constraint 95 460 0.8000 1.0000 2.0000 0.0000 Constraint 95 446 0.8000 1.0000 2.0000 0.0000 Constraint 95 441 0.8000 1.0000 2.0000 0.0000 Constraint 95 436 0.8000 1.0000 2.0000 0.0000 Constraint 95 419 0.8000 1.0000 2.0000 0.0000 Constraint 95 413 0.8000 1.0000 2.0000 0.0000 Constraint 95 406 0.8000 1.0000 2.0000 0.0000 Constraint 95 399 0.8000 1.0000 2.0000 0.0000 Constraint 95 392 0.8000 1.0000 2.0000 0.0000 Constraint 95 384 0.8000 1.0000 2.0000 0.0000 Constraint 95 368 0.8000 1.0000 2.0000 0.0000 Constraint 95 357 0.8000 1.0000 2.0000 0.0000 Constraint 95 349 0.8000 1.0000 2.0000 0.0000 Constraint 95 341 0.8000 1.0000 2.0000 0.0000 Constraint 95 336 0.8000 1.0000 2.0000 0.0000 Constraint 95 317 0.8000 1.0000 2.0000 0.0000 Constraint 95 310 0.8000 1.0000 2.0000 0.0000 Constraint 95 287 0.8000 1.0000 2.0000 0.0000 Constraint 95 276 0.8000 1.0000 2.0000 0.0000 Constraint 95 260 0.8000 1.0000 2.0000 0.0000 Constraint 95 253 0.8000 1.0000 2.0000 0.0000 Constraint 95 245 0.8000 1.0000 2.0000 0.0000 Constraint 95 240 0.8000 1.0000 2.0000 0.0000 Constraint 95 231 0.8000 1.0000 2.0000 0.0000 Constraint 95 226 0.8000 1.0000 2.0000 0.0000 Constraint 95 217 0.8000 1.0000 2.0000 0.0000 Constraint 95 206 0.8000 1.0000 2.0000 0.0000 Constraint 95 158 0.8000 1.0000 2.0000 0.0000 Constraint 95 150 0.8000 1.0000 2.0000 0.0000 Constraint 95 143 0.8000 1.0000 2.0000 0.0000 Constraint 95 136 0.8000 1.0000 2.0000 0.0000 Constraint 95 129 0.8000 1.0000 2.0000 0.0000 Constraint 95 120 0.8000 1.0000 2.0000 0.0000 Constraint 95 114 0.8000 1.0000 2.0000 0.0000 Constraint 95 103 0.8000 1.0000 2.0000 0.0000 Constraint 85 1144 0.8000 1.0000 2.0000 0.0000 Constraint 85 1135 0.8000 1.0000 2.0000 0.0000 Constraint 85 1126 0.8000 1.0000 2.0000 0.0000 Constraint 85 1115 0.8000 1.0000 2.0000 0.0000 Constraint 85 1106 0.8000 1.0000 2.0000 0.0000 Constraint 85 1101 0.8000 1.0000 2.0000 0.0000 Constraint 85 1093 0.8000 1.0000 2.0000 0.0000 Constraint 85 1082 0.8000 1.0000 2.0000 0.0000 Constraint 85 1075 0.8000 1.0000 2.0000 0.0000 Constraint 85 1067 0.8000 1.0000 2.0000 0.0000 Constraint 85 1059 0.8000 1.0000 2.0000 0.0000 Constraint 85 1052 0.8000 1.0000 2.0000 0.0000 Constraint 85 1038 0.8000 1.0000 2.0000 0.0000 Constraint 85 1033 0.8000 1.0000 2.0000 0.0000 Constraint 85 1025 0.8000 1.0000 2.0000 0.0000 Constraint 85 1017 0.8000 1.0000 2.0000 0.0000 Constraint 85 1012 0.8000 1.0000 2.0000 0.0000 Constraint 85 992 0.8000 1.0000 2.0000 0.0000 Constraint 85 986 0.8000 1.0000 2.0000 0.0000 Constraint 85 977 0.8000 1.0000 2.0000 0.0000 Constraint 85 969 0.8000 1.0000 2.0000 0.0000 Constraint 85 961 0.8000 1.0000 2.0000 0.0000 Constraint 85 955 0.8000 1.0000 2.0000 0.0000 Constraint 85 950 0.8000 1.0000 2.0000 0.0000 Constraint 85 940 0.8000 1.0000 2.0000 0.0000 Constraint 85 932 0.8000 1.0000 2.0000 0.0000 Constraint 85 927 0.8000 1.0000 2.0000 0.0000 Constraint 85 916 0.8000 1.0000 2.0000 0.0000 Constraint 85 909 0.8000 1.0000 2.0000 0.0000 Constraint 85 901 0.8000 1.0000 2.0000 0.0000 Constraint 85 887 0.8000 1.0000 2.0000 0.0000 Constraint 85 878 0.8000 1.0000 2.0000 0.0000 Constraint 85 869 0.8000 1.0000 2.0000 0.0000 Constraint 85 858 0.8000 1.0000 2.0000 0.0000 Constraint 85 849 0.8000 1.0000 2.0000 0.0000 Constraint 85 844 0.8000 1.0000 2.0000 0.0000 Constraint 85 833 0.8000 1.0000 2.0000 0.0000 Constraint 85 825 0.8000 1.0000 2.0000 0.0000 Constraint 85 809 0.8000 1.0000 2.0000 0.0000 Constraint 85 801 0.8000 1.0000 2.0000 0.0000 Constraint 85 793 0.8000 1.0000 2.0000 0.0000 Constraint 85 782 0.8000 1.0000 2.0000 0.0000 Constraint 85 771 0.8000 1.0000 2.0000 0.0000 Constraint 85 758 0.8000 1.0000 2.0000 0.0000 Constraint 85 752 0.8000 1.0000 2.0000 0.0000 Constraint 85 746 0.8000 1.0000 2.0000 0.0000 Constraint 85 738 0.8000 1.0000 2.0000 0.0000 Constraint 85 732 0.8000 1.0000 2.0000 0.0000 Constraint 85 725 0.8000 1.0000 2.0000 0.0000 Constraint 85 714 0.8000 1.0000 2.0000 0.0000 Constraint 85 707 0.8000 1.0000 2.0000 0.0000 Constraint 85 696 0.8000 1.0000 2.0000 0.0000 Constraint 85 685 0.8000 1.0000 2.0000 0.0000 Constraint 85 673 0.8000 1.0000 2.0000 0.0000 Constraint 85 664 0.8000 1.0000 2.0000 0.0000 Constraint 85 657 0.8000 1.0000 2.0000 0.0000 Constraint 85 649 0.8000 1.0000 2.0000 0.0000 Constraint 85 644 0.8000 1.0000 2.0000 0.0000 Constraint 85 634 0.8000 1.0000 2.0000 0.0000 Constraint 85 623 0.8000 1.0000 2.0000 0.0000 Constraint 85 616 0.8000 1.0000 2.0000 0.0000 Constraint 85 608 0.8000 1.0000 2.0000 0.0000 Constraint 85 572 0.8000 1.0000 2.0000 0.0000 Constraint 85 544 0.8000 1.0000 2.0000 0.0000 Constraint 85 536 0.8000 1.0000 2.0000 0.0000 Constraint 85 523 0.8000 1.0000 2.0000 0.0000 Constraint 85 518 0.8000 1.0000 2.0000 0.0000 Constraint 85 510 0.8000 1.0000 2.0000 0.0000 Constraint 85 502 0.8000 1.0000 2.0000 0.0000 Constraint 85 496 0.8000 1.0000 2.0000 0.0000 Constraint 85 490 0.8000 1.0000 2.0000 0.0000 Constraint 85 479 0.8000 1.0000 2.0000 0.0000 Constraint 85 446 0.8000 1.0000 2.0000 0.0000 Constraint 85 441 0.8000 1.0000 2.0000 0.0000 Constraint 85 436 0.8000 1.0000 2.0000 0.0000 Constraint 85 428 0.8000 1.0000 2.0000 0.0000 Constraint 85 419 0.8000 1.0000 2.0000 0.0000 Constraint 85 413 0.8000 1.0000 2.0000 0.0000 Constraint 85 406 0.8000 1.0000 2.0000 0.0000 Constraint 85 399 0.8000 1.0000 2.0000 0.0000 Constraint 85 392 0.8000 1.0000 2.0000 0.0000 Constraint 85 384 0.8000 1.0000 2.0000 0.0000 Constraint 85 368 0.8000 1.0000 2.0000 0.0000 Constraint 85 357 0.8000 1.0000 2.0000 0.0000 Constraint 85 349 0.8000 1.0000 2.0000 0.0000 Constraint 85 341 0.8000 1.0000 2.0000 0.0000 Constraint 85 336 0.8000 1.0000 2.0000 0.0000 Constraint 85 324 0.8000 1.0000 2.0000 0.0000 Constraint 85 317 0.8000 1.0000 2.0000 0.0000 Constraint 85 310 0.8000 1.0000 2.0000 0.0000 Constraint 85 302 0.8000 1.0000 2.0000 0.0000 Constraint 85 287 0.8000 1.0000 2.0000 0.0000 Constraint 85 276 0.8000 1.0000 2.0000 0.0000 Constraint 85 260 0.8000 1.0000 2.0000 0.0000 Constraint 85 253 0.8000 1.0000 2.0000 0.0000 Constraint 85 245 0.8000 1.0000 2.0000 0.0000 Constraint 85 240 0.8000 1.0000 2.0000 0.0000 Constraint 85 231 0.8000 1.0000 2.0000 0.0000 Constraint 85 226 0.8000 1.0000 2.0000 0.0000 Constraint 85 217 0.8000 1.0000 2.0000 0.0000 Constraint 85 206 0.8000 1.0000 2.0000 0.0000 Constraint 85 195 0.8000 1.0000 2.0000 0.0000 Constraint 85 150 0.8000 1.0000 2.0000 0.0000 Constraint 85 143 0.8000 1.0000 2.0000 0.0000 Constraint 85 136 0.8000 1.0000 2.0000 0.0000 Constraint 85 129 0.8000 1.0000 2.0000 0.0000 Constraint 85 120 0.8000 1.0000 2.0000 0.0000 Constraint 85 114 0.8000 1.0000 2.0000 0.0000 Constraint 85 103 0.8000 1.0000 2.0000 0.0000 Constraint 85 95 0.8000 1.0000 2.0000 0.0000 Constraint 80 1144 0.8000 1.0000 2.0000 0.0000 Constraint 80 1135 0.8000 1.0000 2.0000 0.0000 Constraint 80 1126 0.8000 1.0000 2.0000 0.0000 Constraint 80 1115 0.8000 1.0000 2.0000 0.0000 Constraint 80 1106 0.8000 1.0000 2.0000 0.0000 Constraint 80 1101 0.8000 1.0000 2.0000 0.0000 Constraint 80 1093 0.8000 1.0000 2.0000 0.0000 Constraint 80 1082 0.8000 1.0000 2.0000 0.0000 Constraint 80 1075 0.8000 1.0000 2.0000 0.0000 Constraint 80 1067 0.8000 1.0000 2.0000 0.0000 Constraint 80 1059 0.8000 1.0000 2.0000 0.0000 Constraint 80 1052 0.8000 1.0000 2.0000 0.0000 Constraint 80 1043 0.8000 1.0000 2.0000 0.0000 Constraint 80 1038 0.8000 1.0000 2.0000 0.0000 Constraint 80 1033 0.8000 1.0000 2.0000 0.0000 Constraint 80 1025 0.8000 1.0000 2.0000 0.0000 Constraint 80 1017 0.8000 1.0000 2.0000 0.0000 Constraint 80 1012 0.8000 1.0000 2.0000 0.0000 Constraint 80 1001 0.8000 1.0000 2.0000 0.0000 Constraint 80 992 0.8000 1.0000 2.0000 0.0000 Constraint 80 986 0.8000 1.0000 2.0000 0.0000 Constraint 80 977 0.8000 1.0000 2.0000 0.0000 Constraint 80 969 0.8000 1.0000 2.0000 0.0000 Constraint 80 961 0.8000 1.0000 2.0000 0.0000 Constraint 80 955 0.8000 1.0000 2.0000 0.0000 Constraint 80 950 0.8000 1.0000 2.0000 0.0000 Constraint 80 940 0.8000 1.0000 2.0000 0.0000 Constraint 80 932 0.8000 1.0000 2.0000 0.0000 Constraint 80 927 0.8000 1.0000 2.0000 0.0000 Constraint 80 916 0.8000 1.0000 2.0000 0.0000 Constraint 80 909 0.8000 1.0000 2.0000 0.0000 Constraint 80 901 0.8000 1.0000 2.0000 0.0000 Constraint 80 887 0.8000 1.0000 2.0000 0.0000 Constraint 80 878 0.8000 1.0000 2.0000 0.0000 Constraint 80 869 0.8000 1.0000 2.0000 0.0000 Constraint 80 858 0.8000 1.0000 2.0000 0.0000 Constraint 80 849 0.8000 1.0000 2.0000 0.0000 Constraint 80 844 0.8000 1.0000 2.0000 0.0000 Constraint 80 833 0.8000 1.0000 2.0000 0.0000 Constraint 80 825 0.8000 1.0000 2.0000 0.0000 Constraint 80 809 0.8000 1.0000 2.0000 0.0000 Constraint 80 801 0.8000 1.0000 2.0000 0.0000 Constraint 80 782 0.8000 1.0000 2.0000 0.0000 Constraint 80 771 0.8000 1.0000 2.0000 0.0000 Constraint 80 752 0.8000 1.0000 2.0000 0.0000 Constraint 80 746 0.8000 1.0000 2.0000 0.0000 Constraint 80 738 0.8000 1.0000 2.0000 0.0000 Constraint 80 732 0.8000 1.0000 2.0000 0.0000 Constraint 80 725 0.8000 1.0000 2.0000 0.0000 Constraint 80 714 0.8000 1.0000 2.0000 0.0000 Constraint 80 707 0.8000 1.0000 2.0000 0.0000 Constraint 80 696 0.8000 1.0000 2.0000 0.0000 Constraint 80 685 0.8000 1.0000 2.0000 0.0000 Constraint 80 673 0.8000 1.0000 2.0000 0.0000 Constraint 80 664 0.8000 1.0000 2.0000 0.0000 Constraint 80 657 0.8000 1.0000 2.0000 0.0000 Constraint 80 649 0.8000 1.0000 2.0000 0.0000 Constraint 80 644 0.8000 1.0000 2.0000 0.0000 Constraint 80 634 0.8000 1.0000 2.0000 0.0000 Constraint 80 623 0.8000 1.0000 2.0000 0.0000 Constraint 80 616 0.8000 1.0000 2.0000 0.0000 Constraint 80 608 0.8000 1.0000 2.0000 0.0000 Constraint 80 600 0.8000 1.0000 2.0000 0.0000 Constraint 80 581 0.8000 1.0000 2.0000 0.0000 Constraint 80 572 0.8000 1.0000 2.0000 0.0000 Constraint 80 564 0.8000 1.0000 2.0000 0.0000 Constraint 80 555 0.8000 1.0000 2.0000 0.0000 Constraint 80 544 0.8000 1.0000 2.0000 0.0000 Constraint 80 536 0.8000 1.0000 2.0000 0.0000 Constraint 80 523 0.8000 1.0000 2.0000 0.0000 Constraint 80 518 0.8000 1.0000 2.0000 0.0000 Constraint 80 496 0.8000 1.0000 2.0000 0.0000 Constraint 80 490 0.8000 1.0000 2.0000 0.0000 Constraint 80 479 0.8000 1.0000 2.0000 0.0000 Constraint 80 460 0.8000 1.0000 2.0000 0.0000 Constraint 80 446 0.8000 1.0000 2.0000 0.0000 Constraint 80 441 0.8000 1.0000 2.0000 0.0000 Constraint 80 436 0.8000 1.0000 2.0000 0.0000 Constraint 80 428 0.8000 1.0000 2.0000 0.0000 Constraint 80 419 0.8000 1.0000 2.0000 0.0000 Constraint 80 413 0.8000 1.0000 2.0000 0.0000 Constraint 80 406 0.8000 1.0000 2.0000 0.0000 Constraint 80 399 0.8000 1.0000 2.0000 0.0000 Constraint 80 384 0.8000 1.0000 2.0000 0.0000 Constraint 80 368 0.8000 1.0000 2.0000 0.0000 Constraint 80 357 0.8000 1.0000 2.0000 0.0000 Constraint 80 349 0.8000 1.0000 2.0000 0.0000 Constraint 80 341 0.8000 1.0000 2.0000 0.0000 Constraint 80 336 0.8000 1.0000 2.0000 0.0000 Constraint 80 324 0.8000 1.0000 2.0000 0.0000 Constraint 80 317 0.8000 1.0000 2.0000 0.0000 Constraint 80 310 0.8000 1.0000 2.0000 0.0000 Constraint 80 302 0.8000 1.0000 2.0000 0.0000 Constraint 80 293 0.8000 1.0000 2.0000 0.0000 Constraint 80 287 0.8000 1.0000 2.0000 0.0000 Constraint 80 276 0.8000 1.0000 2.0000 0.0000 Constraint 80 267 0.8000 1.0000 2.0000 0.0000 Constraint 80 260 0.8000 1.0000 2.0000 0.0000 Constraint 80 240 0.8000 1.0000 2.0000 0.0000 Constraint 80 231 0.8000 1.0000 2.0000 0.0000 Constraint 80 226 0.8000 1.0000 2.0000 0.0000 Constraint 80 206 0.8000 1.0000 2.0000 0.0000 Constraint 80 195 0.8000 1.0000 2.0000 0.0000 Constraint 80 187 0.8000 1.0000 2.0000 0.0000 Constraint 80 158 0.8000 1.0000 2.0000 0.0000 Constraint 80 143 0.8000 1.0000 2.0000 0.0000 Constraint 80 136 0.8000 1.0000 2.0000 0.0000 Constraint 80 129 0.8000 1.0000 2.0000 0.0000 Constraint 80 120 0.8000 1.0000 2.0000 0.0000 Constraint 80 114 0.8000 1.0000 2.0000 0.0000 Constraint 80 103 0.8000 1.0000 2.0000 0.0000 Constraint 80 95 0.8000 1.0000 2.0000 0.0000 Constraint 80 85 0.8000 1.0000 2.0000 0.0000 Constraint 75 1144 0.8000 1.0000 2.0000 0.0000 Constraint 75 1135 0.8000 1.0000 2.0000 0.0000 Constraint 75 1126 0.8000 1.0000 2.0000 0.0000 Constraint 75 1115 0.8000 1.0000 2.0000 0.0000 Constraint 75 1106 0.8000 1.0000 2.0000 0.0000 Constraint 75 1101 0.8000 1.0000 2.0000 0.0000 Constraint 75 1093 0.8000 1.0000 2.0000 0.0000 Constraint 75 1082 0.8000 1.0000 2.0000 0.0000 Constraint 75 1075 0.8000 1.0000 2.0000 0.0000 Constraint 75 1059 0.8000 1.0000 2.0000 0.0000 Constraint 75 1052 0.8000 1.0000 2.0000 0.0000 Constraint 75 1038 0.8000 1.0000 2.0000 0.0000 Constraint 75 1033 0.8000 1.0000 2.0000 0.0000 Constraint 75 1025 0.8000 1.0000 2.0000 0.0000 Constraint 75 1017 0.8000 1.0000 2.0000 0.0000 Constraint 75 1012 0.8000 1.0000 2.0000 0.0000 Constraint 75 1001 0.8000 1.0000 2.0000 0.0000 Constraint 75 992 0.8000 1.0000 2.0000 0.0000 Constraint 75 986 0.8000 1.0000 2.0000 0.0000 Constraint 75 977 0.8000 1.0000 2.0000 0.0000 Constraint 75 969 0.8000 1.0000 2.0000 0.0000 Constraint 75 961 0.8000 1.0000 2.0000 0.0000 Constraint 75 955 0.8000 1.0000 2.0000 0.0000 Constraint 75 950 0.8000 1.0000 2.0000 0.0000 Constraint 75 940 0.8000 1.0000 2.0000 0.0000 Constraint 75 932 0.8000 1.0000 2.0000 0.0000 Constraint 75 927 0.8000 1.0000 2.0000 0.0000 Constraint 75 916 0.8000 1.0000 2.0000 0.0000 Constraint 75 909 0.8000 1.0000 2.0000 0.0000 Constraint 75 901 0.8000 1.0000 2.0000 0.0000 Constraint 75 887 0.8000 1.0000 2.0000 0.0000 Constraint 75 878 0.8000 1.0000 2.0000 0.0000 Constraint 75 869 0.8000 1.0000 2.0000 0.0000 Constraint 75 858 0.8000 1.0000 2.0000 0.0000 Constraint 75 849 0.8000 1.0000 2.0000 0.0000 Constraint 75 844 0.8000 1.0000 2.0000 0.0000 Constraint 75 833 0.8000 1.0000 2.0000 0.0000 Constraint 75 825 0.8000 1.0000 2.0000 0.0000 Constraint 75 809 0.8000 1.0000 2.0000 0.0000 Constraint 75 801 0.8000 1.0000 2.0000 0.0000 Constraint 75 793 0.8000 1.0000 2.0000 0.0000 Constraint 75 782 0.8000 1.0000 2.0000 0.0000 Constraint 75 771 0.8000 1.0000 2.0000 0.0000 Constraint 75 758 0.8000 1.0000 2.0000 0.0000 Constraint 75 752 0.8000 1.0000 2.0000 0.0000 Constraint 75 746 0.8000 1.0000 2.0000 0.0000 Constraint 75 738 0.8000 1.0000 2.0000 0.0000 Constraint 75 732 0.8000 1.0000 2.0000 0.0000 Constraint 75 714 0.8000 1.0000 2.0000 0.0000 Constraint 75 707 0.8000 1.0000 2.0000 0.0000 Constraint 75 696 0.8000 1.0000 2.0000 0.0000 Constraint 75 685 0.8000 1.0000 2.0000 0.0000 Constraint 75 673 0.8000 1.0000 2.0000 0.0000 Constraint 75 664 0.8000 1.0000 2.0000 0.0000 Constraint 75 657 0.8000 1.0000 2.0000 0.0000 Constraint 75 649 0.8000 1.0000 2.0000 0.0000 Constraint 75 644 0.8000 1.0000 2.0000 0.0000 Constraint 75 634 0.8000 1.0000 2.0000 0.0000 Constraint 75 623 0.8000 1.0000 2.0000 0.0000 Constraint 75 616 0.8000 1.0000 2.0000 0.0000 Constraint 75 608 0.8000 1.0000 2.0000 0.0000 Constraint 75 600 0.8000 1.0000 2.0000 0.0000 Constraint 75 581 0.8000 1.0000 2.0000 0.0000 Constraint 75 572 0.8000 1.0000 2.0000 0.0000 Constraint 75 544 0.8000 1.0000 2.0000 0.0000 Constraint 75 536 0.8000 1.0000 2.0000 0.0000 Constraint 75 523 0.8000 1.0000 2.0000 0.0000 Constraint 75 518 0.8000 1.0000 2.0000 0.0000 Constraint 75 510 0.8000 1.0000 2.0000 0.0000 Constraint 75 502 0.8000 1.0000 2.0000 0.0000 Constraint 75 496 0.8000 1.0000 2.0000 0.0000 Constraint 75 490 0.8000 1.0000 2.0000 0.0000 Constraint 75 479 0.8000 1.0000 2.0000 0.0000 Constraint 75 471 0.8000 1.0000 2.0000 0.0000 Constraint 75 460 0.8000 1.0000 2.0000 0.0000 Constraint 75 451 0.8000 1.0000 2.0000 0.0000 Constraint 75 446 0.8000 1.0000 2.0000 0.0000 Constraint 75 441 0.8000 1.0000 2.0000 0.0000 Constraint 75 436 0.8000 1.0000 2.0000 0.0000 Constraint 75 428 0.8000 1.0000 2.0000 0.0000 Constraint 75 419 0.8000 1.0000 2.0000 0.0000 Constraint 75 413 0.8000 1.0000 2.0000 0.0000 Constraint 75 406 0.8000 1.0000 2.0000 0.0000 Constraint 75 399 0.8000 1.0000 2.0000 0.0000 Constraint 75 392 0.8000 1.0000 2.0000 0.0000 Constraint 75 384 0.8000 1.0000 2.0000 0.0000 Constraint 75 368 0.8000 1.0000 2.0000 0.0000 Constraint 75 357 0.8000 1.0000 2.0000 0.0000 Constraint 75 349 0.8000 1.0000 2.0000 0.0000 Constraint 75 341 0.8000 1.0000 2.0000 0.0000 Constraint 75 336 0.8000 1.0000 2.0000 0.0000 Constraint 75 324 0.8000 1.0000 2.0000 0.0000 Constraint 75 317 0.8000 1.0000 2.0000 0.0000 Constraint 75 310 0.8000 1.0000 2.0000 0.0000 Constraint 75 302 0.8000 1.0000 2.0000 0.0000 Constraint 75 293 0.8000 1.0000 2.0000 0.0000 Constraint 75 287 0.8000 1.0000 2.0000 0.0000 Constraint 75 276 0.8000 1.0000 2.0000 0.0000 Constraint 75 267 0.8000 1.0000 2.0000 0.0000 Constraint 75 260 0.8000 1.0000 2.0000 0.0000 Constraint 75 240 0.8000 1.0000 2.0000 0.0000 Constraint 75 195 0.8000 1.0000 2.0000 0.0000 Constraint 75 187 0.8000 1.0000 2.0000 0.0000 Constraint 75 176 0.8000 1.0000 2.0000 0.0000 Constraint 75 158 0.8000 1.0000 2.0000 0.0000 Constraint 75 150 0.8000 1.0000 2.0000 0.0000 Constraint 75 143 0.8000 1.0000 2.0000 0.0000 Constraint 75 136 0.8000 1.0000 2.0000 0.0000 Constraint 75 129 0.8000 1.0000 2.0000 0.0000 Constraint 75 120 0.8000 1.0000 2.0000 0.0000 Constraint 75 114 0.8000 1.0000 2.0000 0.0000 Constraint 75 103 0.8000 1.0000 2.0000 0.0000 Constraint 75 95 0.8000 1.0000 2.0000 0.0000 Constraint 75 85 0.8000 1.0000 2.0000 0.0000 Constraint 75 80 0.8000 1.0000 2.0000 0.0000 Constraint 67 1144 0.8000 1.0000 2.0000 0.0000 Constraint 67 1135 0.8000 1.0000 2.0000 0.0000 Constraint 67 1126 0.8000 1.0000 2.0000 0.0000 Constraint 67 1115 0.8000 1.0000 2.0000 0.0000 Constraint 67 1106 0.8000 1.0000 2.0000 0.0000 Constraint 67 1101 0.8000 1.0000 2.0000 0.0000 Constraint 67 1082 0.8000 1.0000 2.0000 0.0000 Constraint 67 1075 0.8000 1.0000 2.0000 0.0000 Constraint 67 1059 0.8000 1.0000 2.0000 0.0000 Constraint 67 1052 0.8000 1.0000 2.0000 0.0000 Constraint 67 1038 0.8000 1.0000 2.0000 0.0000 Constraint 67 1033 0.8000 1.0000 2.0000 0.0000 Constraint 67 1025 0.8000 1.0000 2.0000 0.0000 Constraint 67 1017 0.8000 1.0000 2.0000 0.0000 Constraint 67 1012 0.8000 1.0000 2.0000 0.0000 Constraint 67 1001 0.8000 1.0000 2.0000 0.0000 Constraint 67 992 0.8000 1.0000 2.0000 0.0000 Constraint 67 986 0.8000 1.0000 2.0000 0.0000 Constraint 67 977 0.8000 1.0000 2.0000 0.0000 Constraint 67 969 0.8000 1.0000 2.0000 0.0000 Constraint 67 961 0.8000 1.0000 2.0000 0.0000 Constraint 67 955 0.8000 1.0000 2.0000 0.0000 Constraint 67 950 0.8000 1.0000 2.0000 0.0000 Constraint 67 940 0.8000 1.0000 2.0000 0.0000 Constraint 67 916 0.8000 1.0000 2.0000 0.0000 Constraint 67 887 0.8000 1.0000 2.0000 0.0000 Constraint 67 878 0.8000 1.0000 2.0000 0.0000 Constraint 67 869 0.8000 1.0000 2.0000 0.0000 Constraint 67 858 0.8000 1.0000 2.0000 0.0000 Constraint 67 849 0.8000 1.0000 2.0000 0.0000 Constraint 67 844 0.8000 1.0000 2.0000 0.0000 Constraint 67 833 0.8000 1.0000 2.0000 0.0000 Constraint 67 825 0.8000 1.0000 2.0000 0.0000 Constraint 67 809 0.8000 1.0000 2.0000 0.0000 Constraint 67 801 0.8000 1.0000 2.0000 0.0000 Constraint 67 793 0.8000 1.0000 2.0000 0.0000 Constraint 67 782 0.8000 1.0000 2.0000 0.0000 Constraint 67 771 0.8000 1.0000 2.0000 0.0000 Constraint 67 758 0.8000 1.0000 2.0000 0.0000 Constraint 67 752 0.8000 1.0000 2.0000 0.0000 Constraint 67 746 0.8000 1.0000 2.0000 0.0000 Constraint 67 738 0.8000 1.0000 2.0000 0.0000 Constraint 67 732 0.8000 1.0000 2.0000 0.0000 Constraint 67 714 0.8000 1.0000 2.0000 0.0000 Constraint 67 696 0.8000 1.0000 2.0000 0.0000 Constraint 67 685 0.8000 1.0000 2.0000 0.0000 Constraint 67 673 0.8000 1.0000 2.0000 0.0000 Constraint 67 664 0.8000 1.0000 2.0000 0.0000 Constraint 67 657 0.8000 1.0000 2.0000 0.0000 Constraint 67 649 0.8000 1.0000 2.0000 0.0000 Constraint 67 644 0.8000 1.0000 2.0000 0.0000 Constraint 67 634 0.8000 1.0000 2.0000 0.0000 Constraint 67 623 0.8000 1.0000 2.0000 0.0000 Constraint 67 616 0.8000 1.0000 2.0000 0.0000 Constraint 67 608 0.8000 1.0000 2.0000 0.0000 Constraint 67 581 0.8000 1.0000 2.0000 0.0000 Constraint 67 572 0.8000 1.0000 2.0000 0.0000 Constraint 67 564 0.8000 1.0000 2.0000 0.0000 Constraint 67 555 0.8000 1.0000 2.0000 0.0000 Constraint 67 544 0.8000 1.0000 2.0000 0.0000 Constraint 67 536 0.8000 1.0000 2.0000 0.0000 Constraint 67 523 0.8000 1.0000 2.0000 0.0000 Constraint 67 518 0.8000 1.0000 2.0000 0.0000 Constraint 67 496 0.8000 1.0000 2.0000 0.0000 Constraint 67 490 0.8000 1.0000 2.0000 0.0000 Constraint 67 479 0.8000 1.0000 2.0000 0.0000 Constraint 67 460 0.8000 1.0000 2.0000 0.0000 Constraint 67 446 0.8000 1.0000 2.0000 0.0000 Constraint 67 441 0.8000 1.0000 2.0000 0.0000 Constraint 67 436 0.8000 1.0000 2.0000 0.0000 Constraint 67 428 0.8000 1.0000 2.0000 0.0000 Constraint 67 419 0.8000 1.0000 2.0000 0.0000 Constraint 67 413 0.8000 1.0000 2.0000 0.0000 Constraint 67 406 0.8000 1.0000 2.0000 0.0000 Constraint 67 399 0.8000 1.0000 2.0000 0.0000 Constraint 67 392 0.8000 1.0000 2.0000 0.0000 Constraint 67 384 0.8000 1.0000 2.0000 0.0000 Constraint 67 368 0.8000 1.0000 2.0000 0.0000 Constraint 67 357 0.8000 1.0000 2.0000 0.0000 Constraint 67 349 0.8000 1.0000 2.0000 0.0000 Constraint 67 341 0.8000 1.0000 2.0000 0.0000 Constraint 67 336 0.8000 1.0000 2.0000 0.0000 Constraint 67 324 0.8000 1.0000 2.0000 0.0000 Constraint 67 317 0.8000 1.0000 2.0000 0.0000 Constraint 67 310 0.8000 1.0000 2.0000 0.0000 Constraint 67 302 0.8000 1.0000 2.0000 0.0000 Constraint 67 293 0.8000 1.0000 2.0000 0.0000 Constraint 67 287 0.8000 1.0000 2.0000 0.0000 Constraint 67 276 0.8000 1.0000 2.0000 0.0000 Constraint 67 267 0.8000 1.0000 2.0000 0.0000 Constraint 67 260 0.8000 1.0000 2.0000 0.0000 Constraint 67 253 0.8000 1.0000 2.0000 0.0000 Constraint 67 240 0.8000 1.0000 2.0000 0.0000 Constraint 67 231 0.8000 1.0000 2.0000 0.0000 Constraint 67 129 0.8000 1.0000 2.0000 0.0000 Constraint 67 120 0.8000 1.0000 2.0000 0.0000 Constraint 67 114 0.8000 1.0000 2.0000 0.0000 Constraint 67 103 0.8000 1.0000 2.0000 0.0000 Constraint 67 95 0.8000 1.0000 2.0000 0.0000 Constraint 67 85 0.8000 1.0000 2.0000 0.0000 Constraint 67 80 0.8000 1.0000 2.0000 0.0000 Constraint 67 75 0.8000 1.0000 2.0000 0.0000 Constraint 58 1144 0.8000 1.0000 2.0000 0.0000 Constraint 58 1135 0.8000 1.0000 2.0000 0.0000 Constraint 58 1126 0.8000 1.0000 2.0000 0.0000 Constraint 58 1115 0.8000 1.0000 2.0000 0.0000 Constraint 58 1106 0.8000 1.0000 2.0000 0.0000 Constraint 58 1101 0.8000 1.0000 2.0000 0.0000 Constraint 58 1093 0.8000 1.0000 2.0000 0.0000 Constraint 58 1082 0.8000 1.0000 2.0000 0.0000 Constraint 58 1075 0.8000 1.0000 2.0000 0.0000 Constraint 58 1067 0.8000 1.0000 2.0000 0.0000 Constraint 58 1059 0.8000 1.0000 2.0000 0.0000 Constraint 58 1052 0.8000 1.0000 2.0000 0.0000 Constraint 58 1043 0.8000 1.0000 2.0000 0.0000 Constraint 58 1038 0.8000 1.0000 2.0000 0.0000 Constraint 58 1033 0.8000 1.0000 2.0000 0.0000 Constraint 58 1025 0.8000 1.0000 2.0000 0.0000 Constraint 58 1017 0.8000 1.0000 2.0000 0.0000 Constraint 58 1012 0.8000 1.0000 2.0000 0.0000 Constraint 58 1001 0.8000 1.0000 2.0000 0.0000 Constraint 58 992 0.8000 1.0000 2.0000 0.0000 Constraint 58 986 0.8000 1.0000 2.0000 0.0000 Constraint 58 977 0.8000 1.0000 2.0000 0.0000 Constraint 58 969 0.8000 1.0000 2.0000 0.0000 Constraint 58 961 0.8000 1.0000 2.0000 0.0000 Constraint 58 950 0.8000 1.0000 2.0000 0.0000 Constraint 58 940 0.8000 1.0000 2.0000 0.0000 Constraint 58 916 0.8000 1.0000 2.0000 0.0000 Constraint 58 909 0.8000 1.0000 2.0000 0.0000 Constraint 58 901 0.8000 1.0000 2.0000 0.0000 Constraint 58 887 0.8000 1.0000 2.0000 0.0000 Constraint 58 878 0.8000 1.0000 2.0000 0.0000 Constraint 58 869 0.8000 1.0000 2.0000 0.0000 Constraint 58 858 0.8000 1.0000 2.0000 0.0000 Constraint 58 849 0.8000 1.0000 2.0000 0.0000 Constraint 58 844 0.8000 1.0000 2.0000 0.0000 Constraint 58 833 0.8000 1.0000 2.0000 0.0000 Constraint 58 825 0.8000 1.0000 2.0000 0.0000 Constraint 58 809 0.8000 1.0000 2.0000 0.0000 Constraint 58 801 0.8000 1.0000 2.0000 0.0000 Constraint 58 793 0.8000 1.0000 2.0000 0.0000 Constraint 58 782 0.8000 1.0000 2.0000 0.0000 Constraint 58 771 0.8000 1.0000 2.0000 0.0000 Constraint 58 758 0.8000 1.0000 2.0000 0.0000 Constraint 58 752 0.8000 1.0000 2.0000 0.0000 Constraint 58 746 0.8000 1.0000 2.0000 0.0000 Constraint 58 738 0.8000 1.0000 2.0000 0.0000 Constraint 58 732 0.8000 1.0000 2.0000 0.0000 Constraint 58 725 0.8000 1.0000 2.0000 0.0000 Constraint 58 714 0.8000 1.0000 2.0000 0.0000 Constraint 58 707 0.8000 1.0000 2.0000 0.0000 Constraint 58 696 0.8000 1.0000 2.0000 0.0000 Constraint 58 685 0.8000 1.0000 2.0000 0.0000 Constraint 58 673 0.8000 1.0000 2.0000 0.0000 Constraint 58 664 0.8000 1.0000 2.0000 0.0000 Constraint 58 657 0.8000 1.0000 2.0000 0.0000 Constraint 58 649 0.8000 1.0000 2.0000 0.0000 Constraint 58 644 0.8000 1.0000 2.0000 0.0000 Constraint 58 634 0.8000 1.0000 2.0000 0.0000 Constraint 58 623 0.8000 1.0000 2.0000 0.0000 Constraint 58 616 0.8000 1.0000 2.0000 0.0000 Constraint 58 608 0.8000 1.0000 2.0000 0.0000 Constraint 58 600 0.8000 1.0000 2.0000 0.0000 Constraint 58 581 0.8000 1.0000 2.0000 0.0000 Constraint 58 572 0.8000 1.0000 2.0000 0.0000 Constraint 58 564 0.8000 1.0000 2.0000 0.0000 Constraint 58 555 0.8000 1.0000 2.0000 0.0000 Constraint 58 544 0.8000 1.0000 2.0000 0.0000 Constraint 58 536 0.8000 1.0000 2.0000 0.0000 Constraint 58 523 0.8000 1.0000 2.0000 0.0000 Constraint 58 518 0.8000 1.0000 2.0000 0.0000 Constraint 58 510 0.8000 1.0000 2.0000 0.0000 Constraint 58 502 0.8000 1.0000 2.0000 0.0000 Constraint 58 496 0.8000 1.0000 2.0000 0.0000 Constraint 58 490 0.8000 1.0000 2.0000 0.0000 Constraint 58 479 0.8000 1.0000 2.0000 0.0000 Constraint 58 471 0.8000 1.0000 2.0000 0.0000 Constraint 58 460 0.8000 1.0000 2.0000 0.0000 Constraint 58 451 0.8000 1.0000 2.0000 0.0000 Constraint 58 446 0.8000 1.0000 2.0000 0.0000 Constraint 58 441 0.8000 1.0000 2.0000 0.0000 Constraint 58 436 0.8000 1.0000 2.0000 0.0000 Constraint 58 428 0.8000 1.0000 2.0000 0.0000 Constraint 58 419 0.8000 1.0000 2.0000 0.0000 Constraint 58 413 0.8000 1.0000 2.0000 0.0000 Constraint 58 406 0.8000 1.0000 2.0000 0.0000 Constraint 58 399 0.8000 1.0000 2.0000 0.0000 Constraint 58 392 0.8000 1.0000 2.0000 0.0000 Constraint 58 384 0.8000 1.0000 2.0000 0.0000 Constraint 58 368 0.8000 1.0000 2.0000 0.0000 Constraint 58 357 0.8000 1.0000 2.0000 0.0000 Constraint 58 349 0.8000 1.0000 2.0000 0.0000 Constraint 58 341 0.8000 1.0000 2.0000 0.0000 Constraint 58 336 0.8000 1.0000 2.0000 0.0000 Constraint 58 324 0.8000 1.0000 2.0000 0.0000 Constraint 58 317 0.8000 1.0000 2.0000 0.0000 Constraint 58 310 0.8000 1.0000 2.0000 0.0000 Constraint 58 302 0.8000 1.0000 2.0000 0.0000 Constraint 58 293 0.8000 1.0000 2.0000 0.0000 Constraint 58 287 0.8000 1.0000 2.0000 0.0000 Constraint 58 276 0.8000 1.0000 2.0000 0.0000 Constraint 58 267 0.8000 1.0000 2.0000 0.0000 Constraint 58 260 0.8000 1.0000 2.0000 0.0000 Constraint 58 253 0.8000 1.0000 2.0000 0.0000 Constraint 58 245 0.8000 1.0000 2.0000 0.0000 Constraint 58 240 0.8000 1.0000 2.0000 0.0000 Constraint 58 231 0.8000 1.0000 2.0000 0.0000 Constraint 58 226 0.8000 1.0000 2.0000 0.0000 Constraint 58 158 0.8000 1.0000 2.0000 0.0000 Constraint 58 129 0.8000 1.0000 2.0000 0.0000 Constraint 58 120 0.8000 1.0000 2.0000 0.0000 Constraint 58 114 0.8000 1.0000 2.0000 0.0000 Constraint 58 103 0.8000 1.0000 2.0000 0.0000 Constraint 58 95 0.8000 1.0000 2.0000 0.0000 Constraint 58 85 0.8000 1.0000 2.0000 0.0000 Constraint 58 80 0.8000 1.0000 2.0000 0.0000 Constraint 58 75 0.8000 1.0000 2.0000 0.0000 Constraint 58 67 0.8000 1.0000 2.0000 0.0000 Constraint 50 1144 0.8000 1.0000 2.0000 0.0000 Constraint 50 1135 0.8000 1.0000 2.0000 0.0000 Constraint 50 1126 0.8000 1.0000 2.0000 0.0000 Constraint 50 1115 0.8000 1.0000 2.0000 0.0000 Constraint 50 1106 0.8000 1.0000 2.0000 0.0000 Constraint 50 1101 0.8000 1.0000 2.0000 0.0000 Constraint 50 1093 0.8000 1.0000 2.0000 0.0000 Constraint 50 1082 0.8000 1.0000 2.0000 0.0000 Constraint 50 1075 0.8000 1.0000 2.0000 0.0000 Constraint 50 1067 0.8000 1.0000 2.0000 0.0000 Constraint 50 1059 0.8000 1.0000 2.0000 0.0000 Constraint 50 1052 0.8000 1.0000 2.0000 0.0000 Constraint 50 1043 0.8000 1.0000 2.0000 0.0000 Constraint 50 1038 0.8000 1.0000 2.0000 0.0000 Constraint 50 1033 0.8000 1.0000 2.0000 0.0000 Constraint 50 1025 0.8000 1.0000 2.0000 0.0000 Constraint 50 1017 0.8000 1.0000 2.0000 0.0000 Constraint 50 1012 0.8000 1.0000 2.0000 0.0000 Constraint 50 1001 0.8000 1.0000 2.0000 0.0000 Constraint 50 992 0.8000 1.0000 2.0000 0.0000 Constraint 50 986 0.8000 1.0000 2.0000 0.0000 Constraint 50 977 0.8000 1.0000 2.0000 0.0000 Constraint 50 969 0.8000 1.0000 2.0000 0.0000 Constraint 50 961 0.8000 1.0000 2.0000 0.0000 Constraint 50 955 0.8000 1.0000 2.0000 0.0000 Constraint 50 950 0.8000 1.0000 2.0000 0.0000 Constraint 50 940 0.8000 1.0000 2.0000 0.0000 Constraint 50 932 0.8000 1.0000 2.0000 0.0000 Constraint 50 927 0.8000 1.0000 2.0000 0.0000 Constraint 50 916 0.8000 1.0000 2.0000 0.0000 Constraint 50 909 0.8000 1.0000 2.0000 0.0000 Constraint 50 901 0.8000 1.0000 2.0000 0.0000 Constraint 50 887 0.8000 1.0000 2.0000 0.0000 Constraint 50 878 0.8000 1.0000 2.0000 0.0000 Constraint 50 869 0.8000 1.0000 2.0000 0.0000 Constraint 50 858 0.8000 1.0000 2.0000 0.0000 Constraint 50 849 0.8000 1.0000 2.0000 0.0000 Constraint 50 844 0.8000 1.0000 2.0000 0.0000 Constraint 50 833 0.8000 1.0000 2.0000 0.0000 Constraint 50 825 0.8000 1.0000 2.0000 0.0000 Constraint 50 809 0.8000 1.0000 2.0000 0.0000 Constraint 50 801 0.8000 1.0000 2.0000 0.0000 Constraint 50 782 0.8000 1.0000 2.0000 0.0000 Constraint 50 771 0.8000 1.0000 2.0000 0.0000 Constraint 50 752 0.8000 1.0000 2.0000 0.0000 Constraint 50 746 0.8000 1.0000 2.0000 0.0000 Constraint 50 738 0.8000 1.0000 2.0000 0.0000 Constraint 50 732 0.8000 1.0000 2.0000 0.0000 Constraint 50 725 0.8000 1.0000 2.0000 0.0000 Constraint 50 714 0.8000 1.0000 2.0000 0.0000 Constraint 50 707 0.8000 1.0000 2.0000 0.0000 Constraint 50 696 0.8000 1.0000 2.0000 0.0000 Constraint 50 685 0.8000 1.0000 2.0000 0.0000 Constraint 50 673 0.8000 1.0000 2.0000 0.0000 Constraint 50 664 0.8000 1.0000 2.0000 0.0000 Constraint 50 657 0.8000 1.0000 2.0000 0.0000 Constraint 50 649 0.8000 1.0000 2.0000 0.0000 Constraint 50 644 0.8000 1.0000 2.0000 0.0000 Constraint 50 634 0.8000 1.0000 2.0000 0.0000 Constraint 50 623 0.8000 1.0000 2.0000 0.0000 Constraint 50 616 0.8000 1.0000 2.0000 0.0000 Constraint 50 608 0.8000 1.0000 2.0000 0.0000 Constraint 50 581 0.8000 1.0000 2.0000 0.0000 Constraint 50 572 0.8000 1.0000 2.0000 0.0000 Constraint 50 555 0.8000 1.0000 2.0000 0.0000 Constraint 50 544 0.8000 1.0000 2.0000 0.0000 Constraint 50 536 0.8000 1.0000 2.0000 0.0000 Constraint 50 523 0.8000 1.0000 2.0000 0.0000 Constraint 50 518 0.8000 1.0000 2.0000 0.0000 Constraint 50 510 0.8000 1.0000 2.0000 0.0000 Constraint 50 502 0.8000 1.0000 2.0000 0.0000 Constraint 50 496 0.8000 1.0000 2.0000 0.0000 Constraint 50 490 0.8000 1.0000 2.0000 0.0000 Constraint 50 479 0.8000 1.0000 2.0000 0.0000 Constraint 50 471 0.8000 1.0000 2.0000 0.0000 Constraint 50 460 0.8000 1.0000 2.0000 0.0000 Constraint 50 451 0.8000 1.0000 2.0000 0.0000 Constraint 50 446 0.8000 1.0000 2.0000 0.0000 Constraint 50 441 0.8000 1.0000 2.0000 0.0000 Constraint 50 436 0.8000 1.0000 2.0000 0.0000 Constraint 50 428 0.8000 1.0000 2.0000 0.0000 Constraint 50 419 0.8000 1.0000 2.0000 0.0000 Constraint 50 413 0.8000 1.0000 2.0000 0.0000 Constraint 50 406 0.8000 1.0000 2.0000 0.0000 Constraint 50 399 0.8000 1.0000 2.0000 0.0000 Constraint 50 384 0.8000 1.0000 2.0000 0.0000 Constraint 50 368 0.8000 1.0000 2.0000 0.0000 Constraint 50 357 0.8000 1.0000 2.0000 0.0000 Constraint 50 349 0.8000 1.0000 2.0000 0.0000 Constraint 50 341 0.8000 1.0000 2.0000 0.0000 Constraint 50 336 0.8000 1.0000 2.0000 0.0000 Constraint 50 324 0.8000 1.0000 2.0000 0.0000 Constraint 50 317 0.8000 1.0000 2.0000 0.0000 Constraint 50 310 0.8000 1.0000 2.0000 0.0000 Constraint 50 302 0.8000 1.0000 2.0000 0.0000 Constraint 50 293 0.8000 1.0000 2.0000 0.0000 Constraint 50 287 0.8000 1.0000 2.0000 0.0000 Constraint 50 276 0.8000 1.0000 2.0000 0.0000 Constraint 50 267 0.8000 1.0000 2.0000 0.0000 Constraint 50 260 0.8000 1.0000 2.0000 0.0000 Constraint 50 253 0.8000 1.0000 2.0000 0.0000 Constraint 50 245 0.8000 1.0000 2.0000 0.0000 Constraint 50 240 0.8000 1.0000 2.0000 0.0000 Constraint 50 231 0.8000 1.0000 2.0000 0.0000 Constraint 50 226 0.8000 1.0000 2.0000 0.0000 Constraint 50 217 0.8000 1.0000 2.0000 0.0000 Constraint 50 114 0.8000 1.0000 2.0000 0.0000 Constraint 50 103 0.8000 1.0000 2.0000 0.0000 Constraint 50 95 0.8000 1.0000 2.0000 0.0000 Constraint 50 85 0.8000 1.0000 2.0000 0.0000 Constraint 50 80 0.8000 1.0000 2.0000 0.0000 Constraint 50 75 0.8000 1.0000 2.0000 0.0000 Constraint 50 67 0.8000 1.0000 2.0000 0.0000 Constraint 50 58 0.8000 1.0000 2.0000 0.0000 Constraint 42 1144 0.8000 1.0000 2.0000 0.0000 Constraint 42 1135 0.8000 1.0000 2.0000 0.0000 Constraint 42 1126 0.8000 1.0000 2.0000 0.0000 Constraint 42 1115 0.8000 1.0000 2.0000 0.0000 Constraint 42 1106 0.8000 1.0000 2.0000 0.0000 Constraint 42 1101 0.8000 1.0000 2.0000 0.0000 Constraint 42 1093 0.8000 1.0000 2.0000 0.0000 Constraint 42 1082 0.8000 1.0000 2.0000 0.0000 Constraint 42 1075 0.8000 1.0000 2.0000 0.0000 Constraint 42 1059 0.8000 1.0000 2.0000 0.0000 Constraint 42 1052 0.8000 1.0000 2.0000 0.0000 Constraint 42 1043 0.8000 1.0000 2.0000 0.0000 Constraint 42 1038 0.8000 1.0000 2.0000 0.0000 Constraint 42 1033 0.8000 1.0000 2.0000 0.0000 Constraint 42 1025 0.8000 1.0000 2.0000 0.0000 Constraint 42 1017 0.8000 1.0000 2.0000 0.0000 Constraint 42 1012 0.8000 1.0000 2.0000 0.0000 Constraint 42 1001 0.8000 1.0000 2.0000 0.0000 Constraint 42 992 0.8000 1.0000 2.0000 0.0000 Constraint 42 986 0.8000 1.0000 2.0000 0.0000 Constraint 42 977 0.8000 1.0000 2.0000 0.0000 Constraint 42 969 0.8000 1.0000 2.0000 0.0000 Constraint 42 961 0.8000 1.0000 2.0000 0.0000 Constraint 42 955 0.8000 1.0000 2.0000 0.0000 Constraint 42 950 0.8000 1.0000 2.0000 0.0000 Constraint 42 940 0.8000 1.0000 2.0000 0.0000 Constraint 42 932 0.8000 1.0000 2.0000 0.0000 Constraint 42 927 0.8000 1.0000 2.0000 0.0000 Constraint 42 916 0.8000 1.0000 2.0000 0.0000 Constraint 42 909 0.8000 1.0000 2.0000 0.0000 Constraint 42 901 0.8000 1.0000 2.0000 0.0000 Constraint 42 887 0.8000 1.0000 2.0000 0.0000 Constraint 42 878 0.8000 1.0000 2.0000 0.0000 Constraint 42 869 0.8000 1.0000 2.0000 0.0000 Constraint 42 858 0.8000 1.0000 2.0000 0.0000 Constraint 42 849 0.8000 1.0000 2.0000 0.0000 Constraint 42 844 0.8000 1.0000 2.0000 0.0000 Constraint 42 833 0.8000 1.0000 2.0000 0.0000 Constraint 42 825 0.8000 1.0000 2.0000 0.0000 Constraint 42 809 0.8000 1.0000 2.0000 0.0000 Constraint 42 801 0.8000 1.0000 2.0000 0.0000 Constraint 42 793 0.8000 1.0000 2.0000 0.0000 Constraint 42 782 0.8000 1.0000 2.0000 0.0000 Constraint 42 771 0.8000 1.0000 2.0000 0.0000 Constraint 42 746 0.8000 1.0000 2.0000 0.0000 Constraint 42 738 0.8000 1.0000 2.0000 0.0000 Constraint 42 732 0.8000 1.0000 2.0000 0.0000 Constraint 42 714 0.8000 1.0000 2.0000 0.0000 Constraint 42 707 0.8000 1.0000 2.0000 0.0000 Constraint 42 696 0.8000 1.0000 2.0000 0.0000 Constraint 42 685 0.8000 1.0000 2.0000 0.0000 Constraint 42 673 0.8000 1.0000 2.0000 0.0000 Constraint 42 664 0.8000 1.0000 2.0000 0.0000 Constraint 42 657 0.8000 1.0000 2.0000 0.0000 Constraint 42 649 0.8000 1.0000 2.0000 0.0000 Constraint 42 644 0.8000 1.0000 2.0000 0.0000 Constraint 42 634 0.8000 1.0000 2.0000 0.0000 Constraint 42 623 0.8000 1.0000 2.0000 0.0000 Constraint 42 616 0.8000 1.0000 2.0000 0.0000 Constraint 42 608 0.8000 1.0000 2.0000 0.0000 Constraint 42 600 0.8000 1.0000 2.0000 0.0000 Constraint 42 581 0.8000 1.0000 2.0000 0.0000 Constraint 42 572 0.8000 1.0000 2.0000 0.0000 Constraint 42 564 0.8000 1.0000 2.0000 0.0000 Constraint 42 555 0.8000 1.0000 2.0000 0.0000 Constraint 42 544 0.8000 1.0000 2.0000 0.0000 Constraint 42 536 0.8000 1.0000 2.0000 0.0000 Constraint 42 523 0.8000 1.0000 2.0000 0.0000 Constraint 42 518 0.8000 1.0000 2.0000 0.0000 Constraint 42 510 0.8000 1.0000 2.0000 0.0000 Constraint 42 502 0.8000 1.0000 2.0000 0.0000 Constraint 42 496 0.8000 1.0000 2.0000 0.0000 Constraint 42 490 0.8000 1.0000 2.0000 0.0000 Constraint 42 479 0.8000 1.0000 2.0000 0.0000 Constraint 42 460 0.8000 1.0000 2.0000 0.0000 Constraint 42 446 0.8000 1.0000 2.0000 0.0000 Constraint 42 441 0.8000 1.0000 2.0000 0.0000 Constraint 42 436 0.8000 1.0000 2.0000 0.0000 Constraint 42 428 0.8000 1.0000 2.0000 0.0000 Constraint 42 419 0.8000 1.0000 2.0000 0.0000 Constraint 42 413 0.8000 1.0000 2.0000 0.0000 Constraint 42 406 0.8000 1.0000 2.0000 0.0000 Constraint 42 399 0.8000 1.0000 2.0000 0.0000 Constraint 42 392 0.8000 1.0000 2.0000 0.0000 Constraint 42 384 0.8000 1.0000 2.0000 0.0000 Constraint 42 368 0.8000 1.0000 2.0000 0.0000 Constraint 42 357 0.8000 1.0000 2.0000 0.0000 Constraint 42 349 0.8000 1.0000 2.0000 0.0000 Constraint 42 341 0.8000 1.0000 2.0000 0.0000 Constraint 42 336 0.8000 1.0000 2.0000 0.0000 Constraint 42 324 0.8000 1.0000 2.0000 0.0000 Constraint 42 317 0.8000 1.0000 2.0000 0.0000 Constraint 42 310 0.8000 1.0000 2.0000 0.0000 Constraint 42 302 0.8000 1.0000 2.0000 0.0000 Constraint 42 293 0.8000 1.0000 2.0000 0.0000 Constraint 42 287 0.8000 1.0000 2.0000 0.0000 Constraint 42 276 0.8000 1.0000 2.0000 0.0000 Constraint 42 267 0.8000 1.0000 2.0000 0.0000 Constraint 42 260 0.8000 1.0000 2.0000 0.0000 Constraint 42 253 0.8000 1.0000 2.0000 0.0000 Constraint 42 245 0.8000 1.0000 2.0000 0.0000 Constraint 42 240 0.8000 1.0000 2.0000 0.0000 Constraint 42 231 0.8000 1.0000 2.0000 0.0000 Constraint 42 226 0.8000 1.0000 2.0000 0.0000 Constraint 42 217 0.8000 1.0000 2.0000 0.0000 Constraint 42 206 0.8000 1.0000 2.0000 0.0000 Constraint 42 129 0.8000 1.0000 2.0000 0.0000 Constraint 42 114 0.8000 1.0000 2.0000 0.0000 Constraint 42 103 0.8000 1.0000 2.0000 0.0000 Constraint 42 95 0.8000 1.0000 2.0000 0.0000 Constraint 42 85 0.8000 1.0000 2.0000 0.0000 Constraint 42 80 0.8000 1.0000 2.0000 0.0000 Constraint 42 75 0.8000 1.0000 2.0000 0.0000 Constraint 42 67 0.8000 1.0000 2.0000 0.0000 Constraint 42 58 0.8000 1.0000 2.0000 0.0000 Constraint 42 50 0.8000 1.0000 2.0000 0.0000 Constraint 33 1144 0.8000 1.0000 2.0000 0.0000 Constraint 33 1135 0.8000 1.0000 2.0000 0.0000 Constraint 33 1126 0.8000 1.0000 2.0000 0.0000 Constraint 33 1115 0.8000 1.0000 2.0000 0.0000 Constraint 33 1106 0.8000 1.0000 2.0000 0.0000 Constraint 33 1101 0.8000 1.0000 2.0000 0.0000 Constraint 33 1093 0.8000 1.0000 2.0000 0.0000 Constraint 33 1082 0.8000 1.0000 2.0000 0.0000 Constraint 33 1075 0.8000 1.0000 2.0000 0.0000 Constraint 33 1059 0.8000 1.0000 2.0000 0.0000 Constraint 33 1052 0.8000 1.0000 2.0000 0.0000 Constraint 33 1043 0.8000 1.0000 2.0000 0.0000 Constraint 33 1038 0.8000 1.0000 2.0000 0.0000 Constraint 33 1033 0.8000 1.0000 2.0000 0.0000 Constraint 33 1025 0.8000 1.0000 2.0000 0.0000 Constraint 33 1017 0.8000 1.0000 2.0000 0.0000 Constraint 33 1012 0.8000 1.0000 2.0000 0.0000 Constraint 33 1001 0.8000 1.0000 2.0000 0.0000 Constraint 33 992 0.8000 1.0000 2.0000 0.0000 Constraint 33 986 0.8000 1.0000 2.0000 0.0000 Constraint 33 977 0.8000 1.0000 2.0000 0.0000 Constraint 33 969 0.8000 1.0000 2.0000 0.0000 Constraint 33 950 0.8000 1.0000 2.0000 0.0000 Constraint 33 940 0.8000 1.0000 2.0000 0.0000 Constraint 33 916 0.8000 1.0000 2.0000 0.0000 Constraint 33 909 0.8000 1.0000 2.0000 0.0000 Constraint 33 901 0.8000 1.0000 2.0000 0.0000 Constraint 33 887 0.8000 1.0000 2.0000 0.0000 Constraint 33 878 0.8000 1.0000 2.0000 0.0000 Constraint 33 869 0.8000 1.0000 2.0000 0.0000 Constraint 33 858 0.8000 1.0000 2.0000 0.0000 Constraint 33 849 0.8000 1.0000 2.0000 0.0000 Constraint 33 844 0.8000 1.0000 2.0000 0.0000 Constraint 33 833 0.8000 1.0000 2.0000 0.0000 Constraint 33 825 0.8000 1.0000 2.0000 0.0000 Constraint 33 809 0.8000 1.0000 2.0000 0.0000 Constraint 33 801 0.8000 1.0000 2.0000 0.0000 Constraint 33 793 0.8000 1.0000 2.0000 0.0000 Constraint 33 782 0.8000 1.0000 2.0000 0.0000 Constraint 33 771 0.8000 1.0000 2.0000 0.0000 Constraint 33 758 0.8000 1.0000 2.0000 0.0000 Constraint 33 752 0.8000 1.0000 2.0000 0.0000 Constraint 33 746 0.8000 1.0000 2.0000 0.0000 Constraint 33 738 0.8000 1.0000 2.0000 0.0000 Constraint 33 732 0.8000 1.0000 2.0000 0.0000 Constraint 33 725 0.8000 1.0000 2.0000 0.0000 Constraint 33 714 0.8000 1.0000 2.0000 0.0000 Constraint 33 707 0.8000 1.0000 2.0000 0.0000 Constraint 33 696 0.8000 1.0000 2.0000 0.0000 Constraint 33 685 0.8000 1.0000 2.0000 0.0000 Constraint 33 673 0.8000 1.0000 2.0000 0.0000 Constraint 33 664 0.8000 1.0000 2.0000 0.0000 Constraint 33 657 0.8000 1.0000 2.0000 0.0000 Constraint 33 649 0.8000 1.0000 2.0000 0.0000 Constraint 33 644 0.8000 1.0000 2.0000 0.0000 Constraint 33 634 0.8000 1.0000 2.0000 0.0000 Constraint 33 623 0.8000 1.0000 2.0000 0.0000 Constraint 33 616 0.8000 1.0000 2.0000 0.0000 Constraint 33 608 0.8000 1.0000 2.0000 0.0000 Constraint 33 600 0.8000 1.0000 2.0000 0.0000 Constraint 33 581 0.8000 1.0000 2.0000 0.0000 Constraint 33 572 0.8000 1.0000 2.0000 0.0000 Constraint 33 564 0.8000 1.0000 2.0000 0.0000 Constraint 33 555 0.8000 1.0000 2.0000 0.0000 Constraint 33 544 0.8000 1.0000 2.0000 0.0000 Constraint 33 536 0.8000 1.0000 2.0000 0.0000 Constraint 33 528 0.8000 1.0000 2.0000 0.0000 Constraint 33 523 0.8000 1.0000 2.0000 0.0000 Constraint 33 518 0.8000 1.0000 2.0000 0.0000 Constraint 33 510 0.8000 1.0000 2.0000 0.0000 Constraint 33 502 0.8000 1.0000 2.0000 0.0000 Constraint 33 496 0.8000 1.0000 2.0000 0.0000 Constraint 33 490 0.8000 1.0000 2.0000 0.0000 Constraint 33 479 0.8000 1.0000 2.0000 0.0000 Constraint 33 471 0.8000 1.0000 2.0000 0.0000 Constraint 33 460 0.8000 1.0000 2.0000 0.0000 Constraint 33 451 0.8000 1.0000 2.0000 0.0000 Constraint 33 446 0.8000 1.0000 2.0000 0.0000 Constraint 33 441 0.8000 1.0000 2.0000 0.0000 Constraint 33 436 0.8000 1.0000 2.0000 0.0000 Constraint 33 428 0.8000 1.0000 2.0000 0.0000 Constraint 33 419 0.8000 1.0000 2.0000 0.0000 Constraint 33 413 0.8000 1.0000 2.0000 0.0000 Constraint 33 406 0.8000 1.0000 2.0000 0.0000 Constraint 33 399 0.8000 1.0000 2.0000 0.0000 Constraint 33 392 0.8000 1.0000 2.0000 0.0000 Constraint 33 384 0.8000 1.0000 2.0000 0.0000 Constraint 33 368 0.8000 1.0000 2.0000 0.0000 Constraint 33 357 0.8000 1.0000 2.0000 0.0000 Constraint 33 349 0.8000 1.0000 2.0000 0.0000 Constraint 33 341 0.8000 1.0000 2.0000 0.0000 Constraint 33 336 0.8000 1.0000 2.0000 0.0000 Constraint 33 324 0.8000 1.0000 2.0000 0.0000 Constraint 33 317 0.8000 1.0000 2.0000 0.0000 Constraint 33 310 0.8000 1.0000 2.0000 0.0000 Constraint 33 302 0.8000 1.0000 2.0000 0.0000 Constraint 33 293 0.8000 1.0000 2.0000 0.0000 Constraint 33 287 0.8000 1.0000 2.0000 0.0000 Constraint 33 276 0.8000 1.0000 2.0000 0.0000 Constraint 33 267 0.8000 1.0000 2.0000 0.0000 Constraint 33 260 0.8000 1.0000 2.0000 0.0000 Constraint 33 253 0.8000 1.0000 2.0000 0.0000 Constraint 33 245 0.8000 1.0000 2.0000 0.0000 Constraint 33 240 0.8000 1.0000 2.0000 0.0000 Constraint 33 231 0.8000 1.0000 2.0000 0.0000 Constraint 33 226 0.8000 1.0000 2.0000 0.0000 Constraint 33 217 0.8000 1.0000 2.0000 0.0000 Constraint 33 206 0.8000 1.0000 2.0000 0.0000 Constraint 33 195 0.8000 1.0000 2.0000 0.0000 Constraint 33 150 0.8000 1.0000 2.0000 0.0000 Constraint 33 129 0.8000 1.0000 2.0000 0.0000 Constraint 33 114 0.8000 1.0000 2.0000 0.0000 Constraint 33 103 0.8000 1.0000 2.0000 0.0000 Constraint 33 95 0.8000 1.0000 2.0000 0.0000 Constraint 33 85 0.8000 1.0000 2.0000 0.0000 Constraint 33 80 0.8000 1.0000 2.0000 0.0000 Constraint 33 75 0.8000 1.0000 2.0000 0.0000 Constraint 33 67 0.8000 1.0000 2.0000 0.0000 Constraint 33 58 0.8000 1.0000 2.0000 0.0000 Constraint 33 50 0.8000 1.0000 2.0000 0.0000 Constraint 33 42 0.8000 1.0000 2.0000 0.0000 Constraint 25 1144 0.8000 1.0000 2.0000 0.0000 Constraint 25 1135 0.8000 1.0000 2.0000 0.0000 Constraint 25 1126 0.8000 1.0000 2.0000 0.0000 Constraint 25 1115 0.8000 1.0000 2.0000 0.0000 Constraint 25 1106 0.8000 1.0000 2.0000 0.0000 Constraint 25 1101 0.8000 1.0000 2.0000 0.0000 Constraint 25 1093 0.8000 1.0000 2.0000 0.0000 Constraint 25 1082 0.8000 1.0000 2.0000 0.0000 Constraint 25 1075 0.8000 1.0000 2.0000 0.0000 Constraint 25 1067 0.8000 1.0000 2.0000 0.0000 Constraint 25 1059 0.8000 1.0000 2.0000 0.0000 Constraint 25 1052 0.8000 1.0000 2.0000 0.0000 Constraint 25 1043 0.8000 1.0000 2.0000 0.0000 Constraint 25 1038 0.8000 1.0000 2.0000 0.0000 Constraint 25 1033 0.8000 1.0000 2.0000 0.0000 Constraint 25 1025 0.8000 1.0000 2.0000 0.0000 Constraint 25 1017 0.8000 1.0000 2.0000 0.0000 Constraint 25 1012 0.8000 1.0000 2.0000 0.0000 Constraint 25 1001 0.8000 1.0000 2.0000 0.0000 Constraint 25 992 0.8000 1.0000 2.0000 0.0000 Constraint 25 986 0.8000 1.0000 2.0000 0.0000 Constraint 25 977 0.8000 1.0000 2.0000 0.0000 Constraint 25 969 0.8000 1.0000 2.0000 0.0000 Constraint 25 961 0.8000 1.0000 2.0000 0.0000 Constraint 25 955 0.8000 1.0000 2.0000 0.0000 Constraint 25 950 0.8000 1.0000 2.0000 0.0000 Constraint 25 940 0.8000 1.0000 2.0000 0.0000 Constraint 25 932 0.8000 1.0000 2.0000 0.0000 Constraint 25 927 0.8000 1.0000 2.0000 0.0000 Constraint 25 916 0.8000 1.0000 2.0000 0.0000 Constraint 25 909 0.8000 1.0000 2.0000 0.0000 Constraint 25 901 0.8000 1.0000 2.0000 0.0000 Constraint 25 887 0.8000 1.0000 2.0000 0.0000 Constraint 25 878 0.8000 1.0000 2.0000 0.0000 Constraint 25 869 0.8000 1.0000 2.0000 0.0000 Constraint 25 858 0.8000 1.0000 2.0000 0.0000 Constraint 25 849 0.8000 1.0000 2.0000 0.0000 Constraint 25 844 0.8000 1.0000 2.0000 0.0000 Constraint 25 833 0.8000 1.0000 2.0000 0.0000 Constraint 25 825 0.8000 1.0000 2.0000 0.0000 Constraint 25 809 0.8000 1.0000 2.0000 0.0000 Constraint 25 801 0.8000 1.0000 2.0000 0.0000 Constraint 25 793 0.8000 1.0000 2.0000 0.0000 Constraint 25 782 0.8000 1.0000 2.0000 0.0000 Constraint 25 771 0.8000 1.0000 2.0000 0.0000 Constraint 25 758 0.8000 1.0000 2.0000 0.0000 Constraint 25 752 0.8000 1.0000 2.0000 0.0000 Constraint 25 746 0.8000 1.0000 2.0000 0.0000 Constraint 25 738 0.8000 1.0000 2.0000 0.0000 Constraint 25 732 0.8000 1.0000 2.0000 0.0000 Constraint 25 725 0.8000 1.0000 2.0000 0.0000 Constraint 25 714 0.8000 1.0000 2.0000 0.0000 Constraint 25 707 0.8000 1.0000 2.0000 0.0000 Constraint 25 696 0.8000 1.0000 2.0000 0.0000 Constraint 25 685 0.8000 1.0000 2.0000 0.0000 Constraint 25 673 0.8000 1.0000 2.0000 0.0000 Constraint 25 664 0.8000 1.0000 2.0000 0.0000 Constraint 25 657 0.8000 1.0000 2.0000 0.0000 Constraint 25 649 0.8000 1.0000 2.0000 0.0000 Constraint 25 644 0.8000 1.0000 2.0000 0.0000 Constraint 25 634 0.8000 1.0000 2.0000 0.0000 Constraint 25 623 0.8000 1.0000 2.0000 0.0000 Constraint 25 616 0.8000 1.0000 2.0000 0.0000 Constraint 25 608 0.8000 1.0000 2.0000 0.0000 Constraint 25 600 0.8000 1.0000 2.0000 0.0000 Constraint 25 581 0.8000 1.0000 2.0000 0.0000 Constraint 25 572 0.8000 1.0000 2.0000 0.0000 Constraint 25 564 0.8000 1.0000 2.0000 0.0000 Constraint 25 555 0.8000 1.0000 2.0000 0.0000 Constraint 25 544 0.8000 1.0000 2.0000 0.0000 Constraint 25 536 0.8000 1.0000 2.0000 0.0000 Constraint 25 528 0.8000 1.0000 2.0000 0.0000 Constraint 25 523 0.8000 1.0000 2.0000 0.0000 Constraint 25 518 0.8000 1.0000 2.0000 0.0000 Constraint 25 510 0.8000 1.0000 2.0000 0.0000 Constraint 25 502 0.8000 1.0000 2.0000 0.0000 Constraint 25 496 0.8000 1.0000 2.0000 0.0000 Constraint 25 490 0.8000 1.0000 2.0000 0.0000 Constraint 25 479 0.8000 1.0000 2.0000 0.0000 Constraint 25 471 0.8000 1.0000 2.0000 0.0000 Constraint 25 460 0.8000 1.0000 2.0000 0.0000 Constraint 25 451 0.8000 1.0000 2.0000 0.0000 Constraint 25 446 0.8000 1.0000 2.0000 0.0000 Constraint 25 441 0.8000 1.0000 2.0000 0.0000 Constraint 25 436 0.8000 1.0000 2.0000 0.0000 Constraint 25 428 0.8000 1.0000 2.0000 0.0000 Constraint 25 419 0.8000 1.0000 2.0000 0.0000 Constraint 25 413 0.8000 1.0000 2.0000 0.0000 Constraint 25 406 0.8000 1.0000 2.0000 0.0000 Constraint 25 399 0.8000 1.0000 2.0000 0.0000 Constraint 25 392 0.8000 1.0000 2.0000 0.0000 Constraint 25 384 0.8000 1.0000 2.0000 0.0000 Constraint 25 368 0.8000 1.0000 2.0000 0.0000 Constraint 25 357 0.8000 1.0000 2.0000 0.0000 Constraint 25 349 0.8000 1.0000 2.0000 0.0000 Constraint 25 341 0.8000 1.0000 2.0000 0.0000 Constraint 25 336 0.8000 1.0000 2.0000 0.0000 Constraint 25 324 0.8000 1.0000 2.0000 0.0000 Constraint 25 317 0.8000 1.0000 2.0000 0.0000 Constraint 25 310 0.8000 1.0000 2.0000 0.0000 Constraint 25 302 0.8000 1.0000 2.0000 0.0000 Constraint 25 293 0.8000 1.0000 2.0000 0.0000 Constraint 25 287 0.8000 1.0000 2.0000 0.0000 Constraint 25 276 0.8000 1.0000 2.0000 0.0000 Constraint 25 267 0.8000 1.0000 2.0000 0.0000 Constraint 25 260 0.8000 1.0000 2.0000 0.0000 Constraint 25 253 0.8000 1.0000 2.0000 0.0000 Constraint 25 245 0.8000 1.0000 2.0000 0.0000 Constraint 25 240 0.8000 1.0000 2.0000 0.0000 Constraint 25 231 0.8000 1.0000 2.0000 0.0000 Constraint 25 226 0.8000 1.0000 2.0000 0.0000 Constraint 25 217 0.8000 1.0000 2.0000 0.0000 Constraint 25 206 0.8000 1.0000 2.0000 0.0000 Constraint 25 195 0.8000 1.0000 2.0000 0.0000 Constraint 25 187 0.8000 1.0000 2.0000 0.0000 Constraint 25 176 0.8000 1.0000 2.0000 0.0000 Constraint 25 150 0.8000 1.0000 2.0000 0.0000 Constraint 25 143 0.8000 1.0000 2.0000 0.0000 Constraint 25 129 0.8000 1.0000 2.0000 0.0000 Constraint 25 120 0.8000 1.0000 2.0000 0.0000 Constraint 25 114 0.8000 1.0000 2.0000 0.0000 Constraint 25 95 0.8000 1.0000 2.0000 0.0000 Constraint 25 85 0.8000 1.0000 2.0000 0.0000 Constraint 25 80 0.8000 1.0000 2.0000 0.0000 Constraint 25 75 0.8000 1.0000 2.0000 0.0000 Constraint 25 67 0.8000 1.0000 2.0000 0.0000 Constraint 25 58 0.8000 1.0000 2.0000 0.0000 Constraint 25 50 0.8000 1.0000 2.0000 0.0000 Constraint 25 42 0.8000 1.0000 2.0000 0.0000 Constraint 25 33 0.8000 1.0000 2.0000 0.0000 Constraint 18 1144 0.8000 1.0000 2.0000 0.0000 Constraint 18 1135 0.8000 1.0000 2.0000 0.0000 Constraint 18 1126 0.8000 1.0000 2.0000 0.0000 Constraint 18 1115 0.8000 1.0000 2.0000 0.0000 Constraint 18 1106 0.8000 1.0000 2.0000 0.0000 Constraint 18 1101 0.8000 1.0000 2.0000 0.0000 Constraint 18 1093 0.8000 1.0000 2.0000 0.0000 Constraint 18 1082 0.8000 1.0000 2.0000 0.0000 Constraint 18 1075 0.8000 1.0000 2.0000 0.0000 Constraint 18 1067 0.8000 1.0000 2.0000 0.0000 Constraint 18 1059 0.8000 1.0000 2.0000 0.0000 Constraint 18 1052 0.8000 1.0000 2.0000 0.0000 Constraint 18 1043 0.8000 1.0000 2.0000 0.0000 Constraint 18 1038 0.8000 1.0000 2.0000 0.0000 Constraint 18 1033 0.8000 1.0000 2.0000 0.0000 Constraint 18 1025 0.8000 1.0000 2.0000 0.0000 Constraint 18 1017 0.8000 1.0000 2.0000 0.0000 Constraint 18 1012 0.8000 1.0000 2.0000 0.0000 Constraint 18 1001 0.8000 1.0000 2.0000 0.0000 Constraint 18 992 0.8000 1.0000 2.0000 0.0000 Constraint 18 986 0.8000 1.0000 2.0000 0.0000 Constraint 18 977 0.8000 1.0000 2.0000 0.0000 Constraint 18 969 0.8000 1.0000 2.0000 0.0000 Constraint 18 950 0.8000 1.0000 2.0000 0.0000 Constraint 18 940 0.8000 1.0000 2.0000 0.0000 Constraint 18 932 0.8000 1.0000 2.0000 0.0000 Constraint 18 927 0.8000 1.0000 2.0000 0.0000 Constraint 18 916 0.8000 1.0000 2.0000 0.0000 Constraint 18 909 0.8000 1.0000 2.0000 0.0000 Constraint 18 901 0.8000 1.0000 2.0000 0.0000 Constraint 18 887 0.8000 1.0000 2.0000 0.0000 Constraint 18 878 0.8000 1.0000 2.0000 0.0000 Constraint 18 869 0.8000 1.0000 2.0000 0.0000 Constraint 18 858 0.8000 1.0000 2.0000 0.0000 Constraint 18 849 0.8000 1.0000 2.0000 0.0000 Constraint 18 844 0.8000 1.0000 2.0000 0.0000 Constraint 18 833 0.8000 1.0000 2.0000 0.0000 Constraint 18 825 0.8000 1.0000 2.0000 0.0000 Constraint 18 809 0.8000 1.0000 2.0000 0.0000 Constraint 18 801 0.8000 1.0000 2.0000 0.0000 Constraint 18 793 0.8000 1.0000 2.0000 0.0000 Constraint 18 782 0.8000 1.0000 2.0000 0.0000 Constraint 18 771 0.8000 1.0000 2.0000 0.0000 Constraint 18 758 0.8000 1.0000 2.0000 0.0000 Constraint 18 752 0.8000 1.0000 2.0000 0.0000 Constraint 18 746 0.8000 1.0000 2.0000 0.0000 Constraint 18 738 0.8000 1.0000 2.0000 0.0000 Constraint 18 732 0.8000 1.0000 2.0000 0.0000 Constraint 18 725 0.8000 1.0000 2.0000 0.0000 Constraint 18 714 0.8000 1.0000 2.0000 0.0000 Constraint 18 707 0.8000 1.0000 2.0000 0.0000 Constraint 18 696 0.8000 1.0000 2.0000 0.0000 Constraint 18 685 0.8000 1.0000 2.0000 0.0000 Constraint 18 673 0.8000 1.0000 2.0000 0.0000 Constraint 18 664 0.8000 1.0000 2.0000 0.0000 Constraint 18 657 0.8000 1.0000 2.0000 0.0000 Constraint 18 649 0.8000 1.0000 2.0000 0.0000 Constraint 18 644 0.8000 1.0000 2.0000 0.0000 Constraint 18 634 0.8000 1.0000 2.0000 0.0000 Constraint 18 623 0.8000 1.0000 2.0000 0.0000 Constraint 18 616 0.8000 1.0000 2.0000 0.0000 Constraint 18 608 0.8000 1.0000 2.0000 0.0000 Constraint 18 581 0.8000 1.0000 2.0000 0.0000 Constraint 18 572 0.8000 1.0000 2.0000 0.0000 Constraint 18 564 0.8000 1.0000 2.0000 0.0000 Constraint 18 544 0.8000 1.0000 2.0000 0.0000 Constraint 18 536 0.8000 1.0000 2.0000 0.0000 Constraint 18 528 0.8000 1.0000 2.0000 0.0000 Constraint 18 518 0.8000 1.0000 2.0000 0.0000 Constraint 18 510 0.8000 1.0000 2.0000 0.0000 Constraint 18 502 0.8000 1.0000 2.0000 0.0000 Constraint 18 496 0.8000 1.0000 2.0000 0.0000 Constraint 18 490 0.8000 1.0000 2.0000 0.0000 Constraint 18 479 0.8000 1.0000 2.0000 0.0000 Constraint 18 471 0.8000 1.0000 2.0000 0.0000 Constraint 18 460 0.8000 1.0000 2.0000 0.0000 Constraint 18 451 0.8000 1.0000 2.0000 0.0000 Constraint 18 446 0.8000 1.0000 2.0000 0.0000 Constraint 18 441 0.8000 1.0000 2.0000 0.0000 Constraint 18 436 0.8000 1.0000 2.0000 0.0000 Constraint 18 428 0.8000 1.0000 2.0000 0.0000 Constraint 18 419 0.8000 1.0000 2.0000 0.0000 Constraint 18 413 0.8000 1.0000 2.0000 0.0000 Constraint 18 406 0.8000 1.0000 2.0000 0.0000 Constraint 18 399 0.8000 1.0000 2.0000 0.0000 Constraint 18 392 0.8000 1.0000 2.0000 0.0000 Constraint 18 384 0.8000 1.0000 2.0000 0.0000 Constraint 18 368 0.8000 1.0000 2.0000 0.0000 Constraint 18 357 0.8000 1.0000 2.0000 0.0000 Constraint 18 349 0.8000 1.0000 2.0000 0.0000 Constraint 18 341 0.8000 1.0000 2.0000 0.0000 Constraint 18 336 0.8000 1.0000 2.0000 0.0000 Constraint 18 324 0.8000 1.0000 2.0000 0.0000 Constraint 18 317 0.8000 1.0000 2.0000 0.0000 Constraint 18 310 0.8000 1.0000 2.0000 0.0000 Constraint 18 302 0.8000 1.0000 2.0000 0.0000 Constraint 18 293 0.8000 1.0000 2.0000 0.0000 Constraint 18 287 0.8000 1.0000 2.0000 0.0000 Constraint 18 276 0.8000 1.0000 2.0000 0.0000 Constraint 18 267 0.8000 1.0000 2.0000 0.0000 Constraint 18 260 0.8000 1.0000 2.0000 0.0000 Constraint 18 253 0.8000 1.0000 2.0000 0.0000 Constraint 18 245 0.8000 1.0000 2.0000 0.0000 Constraint 18 240 0.8000 1.0000 2.0000 0.0000 Constraint 18 231 0.8000 1.0000 2.0000 0.0000 Constraint 18 226 0.8000 1.0000 2.0000 0.0000 Constraint 18 217 0.8000 1.0000 2.0000 0.0000 Constraint 18 206 0.8000 1.0000 2.0000 0.0000 Constraint 18 195 0.8000 1.0000 2.0000 0.0000 Constraint 18 187 0.8000 1.0000 2.0000 0.0000 Constraint 18 176 0.8000 1.0000 2.0000 0.0000 Constraint 18 150 0.8000 1.0000 2.0000 0.0000 Constraint 18 143 0.8000 1.0000 2.0000 0.0000 Constraint 18 129 0.8000 1.0000 2.0000 0.0000 Constraint 18 120 0.8000 1.0000 2.0000 0.0000 Constraint 18 103 0.8000 1.0000 2.0000 0.0000 Constraint 18 95 0.8000 1.0000 2.0000 0.0000 Constraint 18 80 0.8000 1.0000 2.0000 0.0000 Constraint 18 75 0.8000 1.0000 2.0000 0.0000 Constraint 18 67 0.8000 1.0000 2.0000 0.0000 Constraint 18 58 0.8000 1.0000 2.0000 0.0000 Constraint 18 50 0.8000 1.0000 2.0000 0.0000 Constraint 18 42 0.8000 1.0000 2.0000 0.0000 Constraint 18 33 0.8000 1.0000 2.0000 0.0000 Constraint 18 25 0.8000 1.0000 2.0000 0.0000 Constraint 11 1144 0.8000 1.0000 2.0000 0.0000 Constraint 11 1135 0.8000 1.0000 2.0000 0.0000 Constraint 11 1126 0.8000 1.0000 2.0000 0.0000 Constraint 11 1115 0.8000 1.0000 2.0000 0.0000 Constraint 11 1106 0.8000 1.0000 2.0000 0.0000 Constraint 11 1101 0.8000 1.0000 2.0000 0.0000 Constraint 11 1093 0.8000 1.0000 2.0000 0.0000 Constraint 11 1082 0.8000 1.0000 2.0000 0.0000 Constraint 11 1075 0.8000 1.0000 2.0000 0.0000 Constraint 11 1067 0.8000 1.0000 2.0000 0.0000 Constraint 11 1059 0.8000 1.0000 2.0000 0.0000 Constraint 11 1052 0.8000 1.0000 2.0000 0.0000 Constraint 11 1043 0.8000 1.0000 2.0000 0.0000 Constraint 11 1038 0.8000 1.0000 2.0000 0.0000 Constraint 11 1033 0.8000 1.0000 2.0000 0.0000 Constraint 11 1025 0.8000 1.0000 2.0000 0.0000 Constraint 11 1017 0.8000 1.0000 2.0000 0.0000 Constraint 11 1012 0.8000 1.0000 2.0000 0.0000 Constraint 11 1001 0.8000 1.0000 2.0000 0.0000 Constraint 11 992 0.8000 1.0000 2.0000 0.0000 Constraint 11 986 0.8000 1.0000 2.0000 0.0000 Constraint 11 977 0.8000 1.0000 2.0000 0.0000 Constraint 11 969 0.8000 1.0000 2.0000 0.0000 Constraint 11 961 0.8000 1.0000 2.0000 0.0000 Constraint 11 955 0.8000 1.0000 2.0000 0.0000 Constraint 11 950 0.8000 1.0000 2.0000 0.0000 Constraint 11 940 0.8000 1.0000 2.0000 0.0000 Constraint 11 932 0.8000 1.0000 2.0000 0.0000 Constraint 11 927 0.8000 1.0000 2.0000 0.0000 Constraint 11 916 0.8000 1.0000 2.0000 0.0000 Constraint 11 909 0.8000 1.0000 2.0000 0.0000 Constraint 11 901 0.8000 1.0000 2.0000 0.0000 Constraint 11 887 0.8000 1.0000 2.0000 0.0000 Constraint 11 878 0.8000 1.0000 2.0000 0.0000 Constraint 11 869 0.8000 1.0000 2.0000 0.0000 Constraint 11 858 0.8000 1.0000 2.0000 0.0000 Constraint 11 849 0.8000 1.0000 2.0000 0.0000 Constraint 11 844 0.8000 1.0000 2.0000 0.0000 Constraint 11 833 0.8000 1.0000 2.0000 0.0000 Constraint 11 825 0.8000 1.0000 2.0000 0.0000 Constraint 11 809 0.8000 1.0000 2.0000 0.0000 Constraint 11 801 0.8000 1.0000 2.0000 0.0000 Constraint 11 793 0.8000 1.0000 2.0000 0.0000 Constraint 11 782 0.8000 1.0000 2.0000 0.0000 Constraint 11 771 0.8000 1.0000 2.0000 0.0000 Constraint 11 758 0.8000 1.0000 2.0000 0.0000 Constraint 11 752 0.8000 1.0000 2.0000 0.0000 Constraint 11 746 0.8000 1.0000 2.0000 0.0000 Constraint 11 738 0.8000 1.0000 2.0000 0.0000 Constraint 11 732 0.8000 1.0000 2.0000 0.0000 Constraint 11 725 0.8000 1.0000 2.0000 0.0000 Constraint 11 714 0.8000 1.0000 2.0000 0.0000 Constraint 11 707 0.8000 1.0000 2.0000 0.0000 Constraint 11 696 0.8000 1.0000 2.0000 0.0000 Constraint 11 685 0.8000 1.0000 2.0000 0.0000 Constraint 11 673 0.8000 1.0000 2.0000 0.0000 Constraint 11 664 0.8000 1.0000 2.0000 0.0000 Constraint 11 657 0.8000 1.0000 2.0000 0.0000 Constraint 11 649 0.8000 1.0000 2.0000 0.0000 Constraint 11 644 0.8000 1.0000 2.0000 0.0000 Constraint 11 634 0.8000 1.0000 2.0000 0.0000 Constraint 11 623 0.8000 1.0000 2.0000 0.0000 Constraint 11 616 0.8000 1.0000 2.0000 0.0000 Constraint 11 608 0.8000 1.0000 2.0000 0.0000 Constraint 11 600 0.8000 1.0000 2.0000 0.0000 Constraint 11 581 0.8000 1.0000 2.0000 0.0000 Constraint 11 572 0.8000 1.0000 2.0000 0.0000 Constraint 11 564 0.8000 1.0000 2.0000 0.0000 Constraint 11 555 0.8000 1.0000 2.0000 0.0000 Constraint 11 544 0.8000 1.0000 2.0000 0.0000 Constraint 11 536 0.8000 1.0000 2.0000 0.0000 Constraint 11 528 0.8000 1.0000 2.0000 0.0000 Constraint 11 523 0.8000 1.0000 2.0000 0.0000 Constraint 11 518 0.8000 1.0000 2.0000 0.0000 Constraint 11 510 0.8000 1.0000 2.0000 0.0000 Constraint 11 502 0.8000 1.0000 2.0000 0.0000 Constraint 11 496 0.8000 1.0000 2.0000 0.0000 Constraint 11 490 0.8000 1.0000 2.0000 0.0000 Constraint 11 479 0.8000 1.0000 2.0000 0.0000 Constraint 11 471 0.8000 1.0000 2.0000 0.0000 Constraint 11 460 0.8000 1.0000 2.0000 0.0000 Constraint 11 451 0.8000 1.0000 2.0000 0.0000 Constraint 11 446 0.8000 1.0000 2.0000 0.0000 Constraint 11 441 0.8000 1.0000 2.0000 0.0000 Constraint 11 436 0.8000 1.0000 2.0000 0.0000 Constraint 11 428 0.8000 1.0000 2.0000 0.0000 Constraint 11 419 0.8000 1.0000 2.0000 0.0000 Constraint 11 413 0.8000 1.0000 2.0000 0.0000 Constraint 11 406 0.8000 1.0000 2.0000 0.0000 Constraint 11 399 0.8000 1.0000 2.0000 0.0000 Constraint 11 392 0.8000 1.0000 2.0000 0.0000 Constraint 11 384 0.8000 1.0000 2.0000 0.0000 Constraint 11 368 0.8000 1.0000 2.0000 0.0000 Constraint 11 357 0.8000 1.0000 2.0000 0.0000 Constraint 11 349 0.8000 1.0000 2.0000 0.0000 Constraint 11 341 0.8000 1.0000 2.0000 0.0000 Constraint 11 336 0.8000 1.0000 2.0000 0.0000 Constraint 11 324 0.8000 1.0000 2.0000 0.0000 Constraint 11 317 0.8000 1.0000 2.0000 0.0000 Constraint 11 310 0.8000 1.0000 2.0000 0.0000 Constraint 11 302 0.8000 1.0000 2.0000 0.0000 Constraint 11 293 0.8000 1.0000 2.0000 0.0000 Constraint 11 287 0.8000 1.0000 2.0000 0.0000 Constraint 11 276 0.8000 1.0000 2.0000 0.0000 Constraint 11 267 0.8000 1.0000 2.0000 0.0000 Constraint 11 260 0.8000 1.0000 2.0000 0.0000 Constraint 11 253 0.8000 1.0000 2.0000 0.0000 Constraint 11 245 0.8000 1.0000 2.0000 0.0000 Constraint 11 240 0.8000 1.0000 2.0000 0.0000 Constraint 11 231 0.8000 1.0000 2.0000 0.0000 Constraint 11 226 0.8000 1.0000 2.0000 0.0000 Constraint 11 217 0.8000 1.0000 2.0000 0.0000 Constraint 11 206 0.8000 1.0000 2.0000 0.0000 Constraint 11 195 0.8000 1.0000 2.0000 0.0000 Constraint 11 187 0.8000 1.0000 2.0000 0.0000 Constraint 11 176 0.8000 1.0000 2.0000 0.0000 Constraint 11 165 0.8000 1.0000 2.0000 0.0000 Constraint 11 158 0.8000 1.0000 2.0000 0.0000 Constraint 11 150 0.8000 1.0000 2.0000 0.0000 Constraint 11 143 0.8000 1.0000 2.0000 0.0000 Constraint 11 129 0.8000 1.0000 2.0000 0.0000 Constraint 11 120 0.8000 1.0000 2.0000 0.0000 Constraint 11 114 0.8000 1.0000 2.0000 0.0000 Constraint 11 103 0.8000 1.0000 2.0000 0.0000 Constraint 11 95 0.8000 1.0000 2.0000 0.0000 Constraint 11 85 0.8000 1.0000 2.0000 0.0000 Constraint 11 80 0.8000 1.0000 2.0000 0.0000 Constraint 11 75 0.8000 1.0000 2.0000 0.0000 Constraint 11 67 0.8000 1.0000 2.0000 0.0000 Constraint 11 58 0.8000 1.0000 2.0000 0.0000 Constraint 11 50 0.8000 1.0000 2.0000 0.0000 Constraint 11 42 0.8000 1.0000 2.0000 0.0000 Constraint 11 33 0.8000 1.0000 2.0000 0.0000 Constraint 11 25 0.8000 1.0000 2.0000 0.0000 Constraint 11 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 1144 0.8000 1.0000 2.0000 0.0000 Constraint 3 1135 0.8000 1.0000 2.0000 0.0000 Constraint 3 1126 0.8000 1.0000 2.0000 0.0000 Constraint 3 1115 0.8000 1.0000 2.0000 0.0000 Constraint 3 1106 0.8000 1.0000 2.0000 0.0000 Constraint 3 1101 0.8000 1.0000 2.0000 0.0000 Constraint 3 1093 0.8000 1.0000 2.0000 0.0000 Constraint 3 1082 0.8000 1.0000 2.0000 0.0000 Constraint 3 1075 0.8000 1.0000 2.0000 0.0000 Constraint 3 1067 0.8000 1.0000 2.0000 0.0000 Constraint 3 1059 0.8000 1.0000 2.0000 0.0000 Constraint 3 1052 0.8000 1.0000 2.0000 0.0000 Constraint 3 1043 0.8000 1.0000 2.0000 0.0000 Constraint 3 1038 0.8000 1.0000 2.0000 0.0000 Constraint 3 1033 0.8000 1.0000 2.0000 0.0000 Constraint 3 1025 0.8000 1.0000 2.0000 0.0000 Constraint 3 1017 0.8000 1.0000 2.0000 0.0000 Constraint 3 1012 0.8000 1.0000 2.0000 0.0000 Constraint 3 1001 0.8000 1.0000 2.0000 0.0000 Constraint 3 992 0.8000 1.0000 2.0000 0.0000 Constraint 3 986 0.8000 1.0000 2.0000 0.0000 Constraint 3 977 0.8000 1.0000 2.0000 0.0000 Constraint 3 969 0.8000 1.0000 2.0000 0.0000 Constraint 3 961 0.8000 1.0000 2.0000 0.0000 Constraint 3 955 0.8000 1.0000 2.0000 0.0000 Constraint 3 950 0.8000 1.0000 2.0000 0.0000 Constraint 3 940 0.8000 1.0000 2.0000 0.0000 Constraint 3 932 0.8000 1.0000 2.0000 0.0000 Constraint 3 927 0.8000 1.0000 2.0000 0.0000 Constraint 3 916 0.8000 1.0000 2.0000 0.0000 Constraint 3 909 0.8000 1.0000 2.0000 0.0000 Constraint 3 901 0.8000 1.0000 2.0000 0.0000 Constraint 3 887 0.8000 1.0000 2.0000 0.0000 Constraint 3 878 0.8000 1.0000 2.0000 0.0000 Constraint 3 869 0.8000 1.0000 2.0000 0.0000 Constraint 3 858 0.8000 1.0000 2.0000 0.0000 Constraint 3 849 0.8000 1.0000 2.0000 0.0000 Constraint 3 844 0.8000 1.0000 2.0000 0.0000 Constraint 3 833 0.8000 1.0000 2.0000 0.0000 Constraint 3 825 0.8000 1.0000 2.0000 0.0000 Constraint 3 809 0.8000 1.0000 2.0000 0.0000 Constraint 3 801 0.8000 1.0000 2.0000 0.0000 Constraint 3 793 0.8000 1.0000 2.0000 0.0000 Constraint 3 782 0.8000 1.0000 2.0000 0.0000 Constraint 3 771 0.8000 1.0000 2.0000 0.0000 Constraint 3 758 0.8000 1.0000 2.0000 0.0000 Constraint 3 752 0.8000 1.0000 2.0000 0.0000 Constraint 3 746 0.8000 1.0000 2.0000 0.0000 Constraint 3 738 0.8000 1.0000 2.0000 0.0000 Constraint 3 732 0.8000 1.0000 2.0000 0.0000 Constraint 3 725 0.8000 1.0000 2.0000 0.0000 Constraint 3 714 0.8000 1.0000 2.0000 0.0000 Constraint 3 707 0.8000 1.0000 2.0000 0.0000 Constraint 3 696 0.8000 1.0000 2.0000 0.0000 Constraint 3 685 0.8000 1.0000 2.0000 0.0000 Constraint 3 673 0.8000 1.0000 2.0000 0.0000 Constraint 3 664 0.8000 1.0000 2.0000 0.0000 Constraint 3 657 0.8000 1.0000 2.0000 0.0000 Constraint 3 649 0.8000 1.0000 2.0000 0.0000 Constraint 3 644 0.8000 1.0000 2.0000 0.0000 Constraint 3 634 0.8000 1.0000 2.0000 0.0000 Constraint 3 623 0.8000 1.0000 2.0000 0.0000 Constraint 3 616 0.8000 1.0000 2.0000 0.0000 Constraint 3 608 0.8000 1.0000 2.0000 0.0000 Constraint 3 581 0.8000 1.0000 2.0000 0.0000 Constraint 3 572 0.8000 1.0000 2.0000 0.0000 Constraint 3 564 0.8000 1.0000 2.0000 0.0000 Constraint 3 544 0.8000 1.0000 2.0000 0.0000 Constraint 3 536 0.8000 1.0000 2.0000 0.0000 Constraint 3 528 0.8000 1.0000 2.0000 0.0000 Constraint 3 523 0.8000 1.0000 2.0000 0.0000 Constraint 3 518 0.8000 1.0000 2.0000 0.0000 Constraint 3 510 0.8000 1.0000 2.0000 0.0000 Constraint 3 502 0.8000 1.0000 2.0000 0.0000 Constraint 3 496 0.8000 1.0000 2.0000 0.0000 Constraint 3 490 0.8000 1.0000 2.0000 0.0000 Constraint 3 479 0.8000 1.0000 2.0000 0.0000 Constraint 3 471 0.8000 1.0000 2.0000 0.0000 Constraint 3 460 0.8000 1.0000 2.0000 0.0000 Constraint 3 451 0.8000 1.0000 2.0000 0.0000 Constraint 3 446 0.8000 1.0000 2.0000 0.0000 Constraint 3 441 0.8000 1.0000 2.0000 0.0000 Constraint 3 436 0.8000 1.0000 2.0000 0.0000 Constraint 3 428 0.8000 1.0000 2.0000 0.0000 Constraint 3 419 0.8000 1.0000 2.0000 0.0000 Constraint 3 413 0.8000 1.0000 2.0000 0.0000 Constraint 3 406 0.8000 1.0000 2.0000 0.0000 Constraint 3 399 0.8000 1.0000 2.0000 0.0000 Constraint 3 392 0.8000 1.0000 2.0000 0.0000 Constraint 3 384 0.8000 1.0000 2.0000 0.0000 Constraint 3 368 0.8000 1.0000 2.0000 0.0000 Constraint 3 357 0.8000 1.0000 2.0000 0.0000 Constraint 3 349 0.8000 1.0000 2.0000 0.0000 Constraint 3 341 0.8000 1.0000 2.0000 0.0000 Constraint 3 336 0.8000 1.0000 2.0000 0.0000 Constraint 3 324 0.8000 1.0000 2.0000 0.0000 Constraint 3 317 0.8000 1.0000 2.0000 0.0000 Constraint 3 310 0.8000 1.0000 2.0000 0.0000 Constraint 3 302 0.8000 1.0000 2.0000 0.0000 Constraint 3 293 0.8000 1.0000 2.0000 0.0000 Constraint 3 287 0.8000 1.0000 2.0000 0.0000 Constraint 3 276 0.8000 1.0000 2.0000 0.0000 Constraint 3 267 0.8000 1.0000 2.0000 0.0000 Constraint 3 260 0.8000 1.0000 2.0000 0.0000 Constraint 3 253 0.8000 1.0000 2.0000 0.0000 Constraint 3 245 0.8000 1.0000 2.0000 0.0000 Constraint 3 240 0.8000 1.0000 2.0000 0.0000 Constraint 3 231 0.8000 1.0000 2.0000 0.0000 Constraint 3 226 0.8000 1.0000 2.0000 0.0000 Constraint 3 217 0.8000 1.0000 2.0000 0.0000 Constraint 3 206 0.8000 1.0000 2.0000 0.0000 Constraint 3 195 0.8000 1.0000 2.0000 0.0000 Constraint 3 187 0.8000 1.0000 2.0000 0.0000 Constraint 3 176 0.8000 1.0000 2.0000 0.0000 Constraint 3 165 0.8000 1.0000 2.0000 0.0000 Constraint 3 158 0.8000 1.0000 2.0000 0.0000 Constraint 3 150 0.8000 1.0000 2.0000 0.0000 Constraint 3 143 0.8000 1.0000 2.0000 0.0000 Constraint 3 136 0.8000 1.0000 2.0000 0.0000 Constraint 3 129 0.8000 1.0000 2.0000 0.0000 Constraint 3 120 0.8000 1.0000 2.0000 0.0000 Constraint 3 114 0.8000 1.0000 2.0000 0.0000 Constraint 3 103 0.8000 1.0000 2.0000 0.0000 Constraint 3 95 0.8000 1.0000 2.0000 0.0000 Constraint 3 85 0.8000 1.0000 2.0000 0.0000 Constraint 3 80 0.8000 1.0000 2.0000 0.0000 Constraint 3 75 0.8000 1.0000 2.0000 0.0000 Constraint 3 67 0.8000 1.0000 2.0000 0.0000 Constraint 3 58 0.8000 1.0000 2.0000 0.0000 Constraint 3 50 0.8000 1.0000 2.0000 0.0000 Constraint 3 42 0.8000 1.0000 2.0000 0.0000 Constraint 3 33 0.8000 1.0000 2.0000 0.0000 Constraint 3 25 0.8000 1.0000 2.0000 0.0000 Constraint 3 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 11 0.8000 1.0000 2.0000 0.0000 Done printing distance constraints # command: