# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0365/ # command:# Making conformation for sequence T0365 numbered 1 through 226 Created new target T0365 from T0365.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0365/ # command:# reading script from file T0365.t04.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sumB/T0365-1sumB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1sumB expands to /projects/compbio/data/pdb/1sum.pdb.gz 1sumB:# T0365 read from 1sumB/T0365-1sumB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sumB read from 1sumB/T0365-1sumB-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1sumB to template set # found chain 1sumB in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATI 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSI # choosing archetypes in rotamer library T0365 41 :TGNWDDAVQIRKQ 1sumB 36 :ERNESLAREVIAD T0365 54 :ISLAEKQGDSLKREIRLTLP 1sumB 52 :VDQMEVEIQEKAMEVLGLFS T0365 79 :PVER 1sumB 72 :PIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVI 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQAL 1sumB 107 :LMEEPPLKPL T0365 119 :VPFIAYLQRCIDAVGLAQQVIN 1sumB 117 :EDIPAMANQTSEMLKFALRMFA T0365 152 :GREVDFVAK 1sumB 139 :DVNVEKSFE T0365 165 :LDIIEEDTDDLQIQLRRQLFAL 1sumB 148 :VCRMDSKVDDLYEKVREELLLY T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 172 :ESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 10 number of extra gaps= 0 total=10 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1589513898.pdb -s /var/tmp/to_scwrl_1589513898.seq -o /var/tmp/from_scwrl_1589513898.pdb > /var/tmp/scwrl_1589513898.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1589513898.pdb Number of alignments=1 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xwmA/T0365-1xwmA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1xwmA expands to /projects/compbio/data/pdb/1xwm.pdb.gz 1xwmA:# T0365 read from 1xwmA/T0365-1xwmA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xwmA read from 1xwmA/T0365-1xwmA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1xwmA to template set # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAI T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 80 :VERTDL 1xwmA 72 :PVATDL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQ 1xwmA 111 :PFV T0365 119 :VPFIAYLQRCIDAVGL 1xwmA 117 :GPLVLMYRLATDMVST T0365 138 :VINELDD 1xwmA 133 :AIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQL 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASL T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLVK Number of specific fragments extracted= 11 number of extra gaps= 0 total=21 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1855843023.pdb -s /var/tmp/to_scwrl_1855843023.seq -o /var/tmp/from_scwrl_1855843023.pdb > /var/tmp/scwrl_1855843023.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1855843023.pdb Number of alignments=2 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t72A/T0365-1t72A-t04-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library always 1t72A expands to /projects/compbio/data/pdb/1t72.pdb.gz 1t72A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0365 read from 1t72A/T0365-1t72A-t04-global-adpstyle1.a2m # 1t72A read from 1t72A/T0365-1t72A-t04-global-adpstyle1.a2m # adding 1t72A to template set # found chain 1t72A in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1t72A)G1 Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQL 1t72A 148 :LAKKVIEKDDTVDELYHQLEREL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1t72A 173 :YVLEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYLS Number of specific fragments extracted= 7 number of extra gaps= 2 total=28 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1146137087.pdb -s /var/tmp/to_scwrl_1146137087.seq -o /var/tmp/from_scwrl_1146137087.pdb > /var/tmp/scwrl_1146137087.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1146137087.pdb Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vctA/T0365-1vctA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1vctA expands to /projects/compbio/data/pdb/1vct.pdb.gz 1vctA:Skipped atom 136, because occupancy 0.5 <= existing 0.500 in 1vctA Skipped atom 138, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 858, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 860, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 862, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 864, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 866, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 868, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 870, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 872, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 874, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 876, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 878, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 880, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 882, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 884, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 886, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 888, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 890, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 892, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 894, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 896, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 898, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 900, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1027, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1034, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1036, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1038, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1040, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1042, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1044, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1046, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1048, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1050, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1052, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1054, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1056, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1058, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1060, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1062, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1064, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1066, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1068, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1070, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1072, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1074, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1076, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1078, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1080, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1082, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1084, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1086, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1088, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1090, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1092, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1094, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1096, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1098, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1100, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1102, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1104, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1106, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1108, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1110, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1112, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1114, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1116, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1118, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1120, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1122, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1124, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1126, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1128, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1130, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1132, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1134, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1136, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1138, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1140, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1142, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1144, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1146, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1148, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1150, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1152, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1154, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1156, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1158, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1160, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1162, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1164, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1166, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1168, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1170, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1172, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1174, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1176, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1178, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1180, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1182, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1184, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1186, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1188, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1190, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1192, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1194, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1196, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1198, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1200, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1202, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1204, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1206, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1208, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1210, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1212, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1346, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1348, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1350, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1352, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1354, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1356, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1358, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1360, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1362, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1364, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1366, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1368, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1370, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1372, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1374, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1376, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1378, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1380, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1382, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1384, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1386, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1388, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1390, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1392, because occupancy 0.500 <= existing 0.500 in 1vctA Skipped atom 1394, because occupancy 0.500 <= existing 0.500 in 1vctA # T0365 read from 1vctA/T0365-1vctA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vctA read from 1vctA/T0365-1vctA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1vctA to template set # found chain 1vctA in template set T0365 13 :SPIK 1vctA 10 :EPKS T0365 18 :LQEHMDKVYDCASLLVPFFEATI 1vctA 14 :VKEIFIEMKDTVELMVDLAYASL T0365 41 :TGN 1vctA 38 :FGD T0365 48 :VQIRKQISLAEKQGDSLKREIRLT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMH T0365 83 :T 1vctA 73 :K T0365 84 :DLLELLTQQDKIANKAKDISGRVIG 1vctA 80 :TILQIANAIEDISNAAGDLAKMVLE T0365 110 :QLLIPQALQVPFIA 1vctA 105 :GVELHPVIKETILE Number of specific fragments extracted= 7 number of extra gaps= 0 total=35 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1254749153.pdb -s /var/tmp/to_scwrl_1254749153.seq -o /var/tmp/from_scwrl_1254749153.pdb > /var/tmp/scwrl_1254749153.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1254749153.pdb Number of alignments=4 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o5hA/T0365-1o5hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1o5hA expands to /projects/compbio/data/pdb/1o5h.pdb.gz 1o5hA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0365 read from 1o5hA/T0365-1o5hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1o5hA read from 1o5hA/T0365-1o5hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1o5hA to template set # found chain 1o5hA in template set T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAKKDMEA T0365 72 :LPSG 1o5hA 87 :VMKA T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 98 :LQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 149 :GF 1o5hA 162 :EI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGI Number of specific fragments extracted= 7 number of extra gaps= 0 total=42 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_213952386.pdb -s /var/tmp/to_scwrl_213952386.seq -o /var/tmp/from_scwrl_213952386.pdb > /var/tmp/scwrl_213952386.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_213952386.pdb Number of alignments=5 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n81A/T0365-1n81A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1n81A expands to /projects/compbio/data/pdb/1n81.pdb.gz 1n81A:# T0365 read from 1n81A/T0365-1n81A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1n81A read from 1n81A/T0365-1n81A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1n81A to template set # found chain 1n81A in template set T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1n81A 31 :LSPRIRKVGDIEFHACSDYIYLL T0365 38 :ATITGNWDDAVQIR 1n81A 54 :MTLSKDPEKFNYAL T0365 81 :ERTDLLELLTQ 1n81A 69 :DRVSIRRYVRK T0365 92 :QDKIANKAKDISGRVI 1n81A 94 :QDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 164 :ELDIIEEDTDDLQ 1n81A 158 :LIRMLFDTYEYVK T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 8 number of extra gaps= 0 total=50 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_2042010568.pdb -s /var/tmp/to_scwrl_2042010568.seq -o /var/tmp/from_scwrl_2042010568.pdb > /var/tmp/scwrl_2042010568.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2042010568.pdb Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j1vA/T0365-1j1vA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1j1vA expands to /projects/compbio/data/pdb/1j1v.pdb.gz 1j1vA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0365 read from 1j1vA/T0365-1j1vA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1j1vA read from 1j1vA/T0365-1j1vA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1j1vA to template set # found chain 1j1vA in template set T0365 47 :AVQIRKQISLAEK 1j1vA 376 :IDNIQKTVAEYYK T0365 80 :VERTDLL 1j1vA 389 :IKVADLL T0365 115 :QALQVPFIAYLQRCIDAVGLA 1j1vA 397 :KRRSRSVARPRQMAMALAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL Number of specific fragments extracted= 6 number of extra gaps= 0 total=56 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_695258232.pdb -s /var/tmp/to_scwrl_695258232.seq -o /var/tmp/from_scwrl_695258232.pdb > /var/tmp/scwrl_695258232.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_695258232.pdb Number of alignments=7 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hw1A/T0365-1hw1A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1hw1A/T0365-1hw1A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1hw1A read from 1hw1A/T0365-1hw1A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1hw1A in training set T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCA 1hw1A 85 :TLARLDHESVPQLIDNLLSVRTNIS T0365 33 :VPFFEATITGNWDDAVQIRK 1hw1A 110 :TIFIRTAFRQHPDKAQEVLA T0365 71 :TLPS 1hw1A 130 :TANE T0365 78 :MPVERTDL 1hw1A 134 :VADHADAF T0365 96 :ANKAKDISGRVIGRQLL 1hw1A 142 :AELDYNIFRGLAFASGN T0365 115 :QAL 1hw1A 159 :PIY T0365 119 :VPFIAYLQRCID 1hw1A 166 :NGMKGLYTRIGR T0365 131 :AVGLAQQVINELDDLLEAGFR 1hw1A 185 :ARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQLRR 1hw1A 212 :VRRYGHESGEIWHRMQK Number of specific fragments extracted= 10 number of extra gaps= 0 total=66 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1237979968.pdb -s /var/tmp/to_scwrl_1237979968.seq -o /var/tmp/from_scwrl_1237979968.pdb > /var/tmp/scwrl_1237979968.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1237979968.pdb Number of alignments=8 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ouvA/T0365-1ouvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1ouvA expands to /projects/compbio/data/pdb/1ouv.pdb.gz 1ouvA:# T0365 read from 1ouvA/T0365-1ouvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ouvA read from 1ouvA/T0365-1ouvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1ouvA to template set # found chain 1ouvA in template set T0365 11 :AKSPIKPLQEHMDKVYDCASL 1ouvA 74 :GQGVEKNLKKAASFYAKACDL T0365 32 :LVPFFEATITG 1ouvA 100 :CHLLGNLYYSG T0365 76 :LFMPVERTDLLELLTQQDKI 1ouvA 111 :QGVSQNTNKALQYYSKACDL T0365 100 :KDISGRVIGR 1ouvA 134 :EGCASLGGIY T0365 110 :QLLIPQALQVPFIA 1ouvA 145 :DGKVVTRDFKKAVE T0365 179 :LRRQLFAL 1ouvA 159 :YFTKACDL T0365 188 :S 1ouvA 167 :N T0365 191 :NPVDVMFLYKTI 1ouvA 168 :DGDGCTILGSLY T0365 205 :VGGLADLAERVGS 1ouvA 189 :LKKALASYDKACD Number of specific fragments extracted= 9 number of extra gaps= 0 total=75 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_93155710.pdb -s /var/tmp/to_scwrl_93155710.seq -o /var/tmp/from_scwrl_93155710.pdb > /var/tmp/scwrl_93155710.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_93155710.pdb Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jk0A/T0365-1jk0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1jk0A expands to /projects/compbio/data/pdb/1jk0.pdb.gz 1jk0A:# T0365 read from 1jk0A/T0365-1jk0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1jk0A read from 1jk0A/T0365-1jk0A-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1jk0A to template set # found chain 1jk0A in template set T0365 16 :KPLQEH 1jk0A 31 :ETLREE T0365 22 :MDKVYDCASLLVPFFEATITGNWDDAVQIRK 1jk0A 41 :SDMLKEKLSKDAENHKAYLKSHQVHRHKLKE T0365 53 :QISLAEKQGDS 1jk0A 95 :EIWQAYKRAEA T0365 64 :LKREIRLTLPS 1jk0A 118 :DIHDWNNRMNE T0365 84 :DL 1jk0A 129 :NE T0365 89 :LTQQDKIANKA 1jk0A 131 :RFFISRVLAFF T0365 100 :KDISGRVIGRQLL 1jk0A 149 :NENLVENFSTEVQ T0365 118 :QVPFIAYLQRCIDAVGLAQQVINELDD 1jk0A 162 :IPEAKSFYGFQIMIENIHSETYSLLID T0365 148 :AGF 1jk0A 189 :TYI T0365 153 :REVDFVAKMINELDII 1jk0A 192 :KDPKESEFLFNAIHTI T0365 171 :DTDDLQIQLRRQLFAL 1jk0A 208 :PEIGEKAEWALRWIQD T0365 188 :SEL 1jk0A 224 :ADA T0365 191 :NPVDVMFLYK 1jk0A 246 :SFASIFWLKK T0365 201 :TIEWVGGLADLAERVGSRLEL 1jk0A 265 :SNELICRDEGLHTDFACLLFA Number of specific fragments extracted= 14 number of extra gaps= 0 total=89 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1690492372.pdb -s /var/tmp/to_scwrl_1690492372.seq -o /var/tmp/from_scwrl_1690492372.pdb > /var/tmp/scwrl_1690492372.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1690492372.pdb Number of alignments=10 # command:# reading script from file T0365.t06.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sumB/T0365-1sumB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1sumB/T0365-1sumB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sumB read from 1sumB/T0365-1sumB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sumB in template set T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRK 1sumB 36 :ERNESLAREVIA T0365 53 :QISLAEKQGDSLKREIRLTLP 1sumB 51 :VVDQMEVEIQEKAMEVLGLFS T0365 79 :PVERT 1sumB 72 :PIGKP T0365 86 :LELLTQQDKIANKAKDISGRVI 1sumB 84 :IRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQALQ 1sumB 107 :LMEEPPLKPLE T0365 120 :PFIAYLQRCIDAVGLAQQVI 1sumB 118 :DIPAMANQTSEMLKFALRMF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 138 :ADVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 9 number of extra gaps= 0 total=98 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1111800029.pdb -s /var/tmp/to_scwrl_1111800029.seq -o /var/tmp/from_scwrl_1111800029.pdb > /var/tmp/scwrl_1111800029.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1111800029.pdb Number of alignments=11 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xwmA/T0365-1xwmA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1xwmA/T0365-1xwmA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xwmA read from 1xwmA/T0365-1xwmA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAI T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 76 :L 1xwmA 71 :Q T0365 80 :VERT 1xwmA 72 :PVAT T0365 84 :DL 1xwmA 79 :RI T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGG T0365 112 :LIPQAL 1xwmA 111 :PFVMDI T0365 119 :VPFIAYLQRCID 1xwmA 117 :GPLVLMYRLATD T0365 134 :LAQQVINELDD 1xwmA 129 :MVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALESE 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVAKT T0365 191 :N 1xwmA 173 :D T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 14 number of extra gaps= 0 total=112 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1984498432.pdb -s /var/tmp/to_scwrl_1984498432.seq -o /var/tmp/from_scwrl_1984498432.pdb > /var/tmp/scwrl_1984498432.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1984498432.pdb Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vctA/T0365-1vctA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1vctA/T0365-1vctA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vctA read from 1vctA/T0365-1vctA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vctA in template set T0365 114 :PQALQVPFIAYLQRCIDAVGLAQ 1vctA 14 :VKEIFIEMKDTVELMVDLAYASL T0365 142 :LDD 1vctA 37 :LFG T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALES 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAAR T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1vctA 71 :NVKEAEQVITILQIANAIEDISNAAGDLAKMVLEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=116 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_917609663.pdb -s /var/tmp/to_scwrl_917609663.seq -o /var/tmp/from_scwrl_917609663.pdb > /var/tmp/scwrl_917609663.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_917609663.pdb Number of alignments=13 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o5hA/T0365-1o5hA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1o5hA/T0365-1o5hA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1o5hA read from 1o5hA/T0365-1o5hA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1o5hA in template set T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKR 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAK T0365 67 :EIRLTLPSGLFM 1o5hA 82 :EAFEKVMKAYKS T0365 81 :E 1o5hA 94 :S T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 152 :G 1o5hA 162 :E T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 8 number of extra gaps= 0 total=124 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1683932586.pdb -s /var/tmp/to_scwrl_1683932586.seq -o /var/tmp/from_scwrl_1683932586.pdb > /var/tmp/scwrl_1683932586.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1683932586.pdb Number of alignments=14 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j1vA/T0365-1j1vA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1j1vA/T0365-1j1vA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1j1vA read from 1j1vA/T0365-1j1vA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1j1vA in template set T0365 100 :KDISGRVIGR 1j1vA 377 :DNIQKTVAEY T0365 110 :QLLIPQALQVPFIAYLQRCIDA 1j1vA 396 :SKRRSRSVARPRQMAMALAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL Number of specific fragments extracted= 5 number of extra gaps= 0 total=129 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_298167279.pdb -s /var/tmp/to_scwrl_298167279.seq -o /var/tmp/from_scwrl_298167279.pdb > /var/tmp/scwrl_298167279.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_298167279.pdb Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wkbA/T0365-1wkbA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1wkbA expands to /projects/compbio/data/pdb/1wkb.pdb.gz 1wkbA:# T0365 read from 1wkbA/T0365-1wkbA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wkbA read from 1wkbA/T0365-1wkbA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1wkbA to template set # found chain 1wkbA in template set T0365 80 :VERTDLLELLTQQDKIANKAKDIS 1wkbA 689 :WRRKEVGKLRKQIERFYELISQFA T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1wkbA 713 :EYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFR T0365 161 :MINELDIIEEDTDDLQIQLRRQ 1wkbA 749 :TRTAVQWAFYSIMNDLRWYLRR T0365 186 :LESELNPVDVMFLYKTIEWVGGLA 1wkbA 771 :TEGRDDEAKRYVLRTLADVWVRLM Number of specific fragments extracted= 4 number of extra gaps= 0 total=133 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1514620093.pdb -s /var/tmp/to_scwrl_1514620093.seq -o /var/tmp/from_scwrl_1514620093.pdb > /var/tmp/scwrl_1514620093.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1514620093.pdb Number of alignments=16 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n81A/T0365-1n81A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1n81A/T0365-1n81A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1n81A read from 1n81A/T0365-1n81A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1n81A in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEA 1n81A 25 :HETHAPLSPRIRKVGDIEFHACSDYIYLLMT T0365 40 :ITGNWDDAVQIR 1n81A 56 :LSKDPEKFNYAL T0365 59 :KQGDSLKREIRLTLPS 1n81A 71 :VSIRRYVRKNQNRYNY T0365 78 :MPVERT 1n81A 87 :FLIEER T0365 91 :QQDKIANKAKDISGRVI 1n81A 93 :VQDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALESE 1n81A 156 :KKLIRMLFDTYEYVKDV T0365 191 :N 1n81A 173 :K T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 10 number of extra gaps= 0 total=143 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_499429649.pdb -s /var/tmp/to_scwrl_499429649.seq -o /var/tmp/from_scwrl_499429649.pdb > /var/tmp/scwrl_499429649.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_499429649.pdb Number of alignments=17 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hw1A/T0365-1hw1A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1hw1A/T0365-1hw1A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1hw1A read from 1hw1A/T0365-1hw1A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1hw1A in training set T0365 7 :LGVFAKSPIKPLQEHMDKVYDC 1hw1A 87 :ARLDHESVPQLIDNLLSVRTNI T0365 32 :LVPFFEATITGNWDDAVQIR 1hw1A 109 :STIFIRTAFRQHPDKAQEVL T0365 70 :LTLPS 1hw1A 129 :ATANE T0365 78 :MPVERTDL 1hw1A 134 :VADHADAF T0365 96 :ANKAKDISGRVIGRQLL 1hw1A 142 :AELDYNIFRGLAFASGN T0365 115 :QA 1hw1A 159 :PI T0365 117 :LQVPFIAYLQRCI 1hw1A 164 :ILNGMKGLYTRIG T0365 130 :DAVGLAQQVINELDDLLEAGFR 1hw1A 184 :EARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQLRR 1hw1A 212 :VRRYGHESGEIWHRMQK Number of specific fragments extracted= 10 number of extra gaps= 0 total=153 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1282291498.pdb -s /var/tmp/to_scwrl_1282291498.seq -o /var/tmp/from_scwrl_1282291498.pdb > /var/tmp/scwrl_1282291498.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1282291498.pdb Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oq9A/T0365-1oq9A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1oq9A expands to /projects/compbio/data/pdb/1oq9.pdb.gz 1oq9A:# T0365 read from 1oq9A/T0365-1oq9A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1oq9A read from 1oq9A/T0365-1oq9A-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1oq9A to template set # found chain 1oq9A in template set T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYD 1oq9A 24 :VHVQVTHSMPPQKIEIFKSLDNWAEE T0365 42 :GNWDDAVQIRKQISLAEKQ 1oq9A 71 :PASDGFDEQVRELRERAKE T0365 61 :GDSLKREIRLTLPS 1oq9A 107 :ALPTYQTMLNTLDG T0365 75 :GLFMPVE 1oq9A 125 :TGASPTS T0365 82 :RTDLLELLTQQDKIAN 1oq9A 136 :TRAWTAEENRHGDLLN T0365 98 :KAKDISGRVIGRQLL 1oq9A 164 :QIEKTIQYLIGSGMD T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1oq9A 181 :TENSPYLGFIYTSFQERATFISHGNTARQAKE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1oq9A 213 :HGDIKLAQICGTIAADEKRHETAYTKIVEKLFEID T0365 191 :NPVDVMFLYKTIEW 1oq9A 248 :PDGTVLAFADMMRK T0365 206 :GGLADLAERVGSR 1oq9A 276 :DNLFDHFSAVAQR Number of specific fragments extracted= 10 number of extra gaps= 0 total=163 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_16922351.pdb -s /var/tmp/to_scwrl_16922351.seq -o /var/tmp/from_scwrl_16922351.pdb > /var/tmp/scwrl_16922351.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_16922351.pdb Number of alignments=19 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1urvA/T0365-1urvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1urvA expands to /projects/compbio/data/pdb/1urv.pdb.gz 1urvA:# T0365 read from 1urvA/T0365-1urvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1urvA read from 1urvA/T0365-1urvA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1urvA to template set # found chain 1urvA in template set T0365 21 :HMDKVYDCASLLV 1urvA 23 :ERKAVQAMWARLY T0365 42 :GNWDDA 1urvA 36 :ANSEDV T0365 61 :GDSLKREIRLTLPSGLFM 1urvA 42 :GVAILVRFFVNFPSAKQY T0365 108 :GRQLLIPQALQV 1urvA 63 :FKHMEDPLEMER T0365 130 :DAVGLAQQVINELDDLLEAG 1urvA 77 :QLRKHASRVMGALNTVVENL T0365 153 :REVDFVAKMINELDIIE 1urvA 97 :HDPDKVSSVLALVGKAH T0365 172 :TDDLQIQLRRQLFAL 1urvA 124 :FKILSGVILEVVAEE T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAER 1urvA 140 :ASDFPPETQRAWAKLRGLIYSHVTAAYK Number of specific fragments extracted= 8 number of extra gaps= 0 total=171 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1759007338.pdb -s /var/tmp/to_scwrl_1759007338.seq -o /var/tmp/from_scwrl_1759007338.pdb > /var/tmp/scwrl_1759007338.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1759007338.pdb Number of alignments=20 # command:# reading script from file T0365.t2k.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sumB/T0365-1sumB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1sumB/T0365-1sumB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sumB read from 1sumB/T0365-1sumB-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sumB in template set Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRKQ 1sumB 36 :ERNESLAREVIAD T0365 54 :ISLAEKQGDSLKREIRLTLP 1sumB 52 :VDQMEVEIQEKAMEVLGLFS T0365 83 :TDLLELLTQQDKIANKAKDISGRVI 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQAL 1sumB 107 :LMEEPPLKPL T0365 120 :PFIAYLQRCIDAVGLAQQVIN 1sumB 118 :DIPAMANQTSEMLKFALRMFA T0365 152 :GREVDFVAKMI 1sumB 139 :DVNVEKSFEVC T0365 167 :IIEEDTDDLQIQLRRQLFALESE 1sumB 150 :RMDSKVDDLYEKVREELLLYMME T0365 191 :N 1sumB 173 :S T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELML 1sumB 177 :VKRALLLLEIAGNIEIIADYATNIVEVSVYMV Number of specific fragments extracted= 10 number of extra gaps= 1 total=181 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1015857464.pdb -s /var/tmp/to_scwrl_1015857464.seq -o /var/tmp/from_scwrl_1015857464.pdb > /var/tmp/scwrl_1015857464.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1015857464.pdb Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xwmA/T0365-1xwmA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1xwmA/T0365-1xwmA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xwmA read from 1xwmA/T0365-1xwmA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xwmA in template set T0365 14 :PIKPLQEHMDKVYDCASLLVPFFE 1xwmA 12 :LHNKLIEMGRLTEVALQQAIEAFQ T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 80 :VERTD 1xwmA 72 :PVATD T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLLIP 1xwmA 83 :AIKIASDIERIADFAVNIAKACIRIGGQPF T0365 119 :VPFIAYLQRCIDAVGLAQQVINE 1xwmA 117 :GPLVLMYRLATDMVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALES 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVAK T0365 190 :LN 1xwmA 172 :TD T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELML 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 10 number of extra gaps= 0 total=191 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1122551741.pdb -s /var/tmp/to_scwrl_1122551741.seq -o /var/tmp/from_scwrl_1122551741.pdb > /var/tmp/scwrl_1122551741.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1122551741.pdb Number of alignments=22 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n81A/T0365-1n81A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1n81A/T0365-1n81A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1n81A read from 1n81A/T0365-1n81A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1n81A in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEATI 1n81A 25 :HETHAPLSPRIRKVGDIEFHACSDYIYLLMTLS T0365 42 :GNWDDAVQIR 1n81A 58 :KDPEKFNYAL T0365 53 :QISLAEK 1n81A 72 :SIRRYVR T0365 67 :EIRLTLPSGL 1n81A 79 :KNQNRYNYFL T0365 80 :VERT 1n81A 89 :IEER T0365 91 :QQDKIANKAKDISGRV 1n81A 93 :VQDNIVNRISDRLISY T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 109 :CTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALES 1n81A 156 :KKLIRMLFDTYEYVKD T0365 190 :LN 1n81A 172 :VK T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 11 number of extra gaps= 0 total=202 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1698487329.pdb -s /var/tmp/to_scwrl_1698487329.seq -o /var/tmp/from_scwrl_1698487329.pdb > /var/tmp/scwrl_1698487329.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1698487329.pdb Number of alignments=23 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vctA/T0365-1vctA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1vctA/T0365-1vctA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vctA read from 1vctA/T0365-1vctA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vctA in template set T0365 87 :ELLTQQDKIANKAKDISGRVIGRQL 1vctA 16 :EIFIEMKDTVELMVDLAYASLLFGD T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINE 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVL T0365 148 :AGFRGREVDFVAKMINELDIIEEDTDDLQ 1vctA 68 :AARNVKEAEQVITILQIANAIEDISNAAG T0365 178 :QLRRQLFALES 1vctA 97 :DLAKMVLEGVE T0365 190 :LNPVDVMFLYK 1vctA 108 :LHPVIKETILE Number of specific fragments extracted= 5 number of extra gaps= 0 total=207 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_272312086.pdb -s /var/tmp/to_scwrl_272312086.seq -o /var/tmp/from_scwrl_272312086.pdb > /var/tmp/scwrl_272312086.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_272312086.pdb Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o5hA/T0365-1o5hA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1o5hA/T0365-1o5hA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1o5hA read from 1o5hA/T0365-1o5hA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1o5hA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1o5hA)E2 T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAKKDMEA T0365 72 :LPSG 1o5hA 87 :VMKA T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 150 :F 1o5hA 163 :I T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKML Number of specific fragments extracted= 7 number of extra gaps= 0 total=214 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_359147515.pdb -s /var/tmp/to_scwrl_359147515.seq -o /var/tmp/from_scwrl_359147515.pdb > /var/tmp/scwrl_359147515.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_359147515.pdb Number of alignments=25 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1eumA/T0365-1eumA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1eumA expands to /projects/compbio/data/pdb/1eum.pdb.gz 1eumA:# T0365 read from 1eumA/T0365-1eumA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1eumA read from 1eumA/T0365-1eumA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1eumA to template set # found chain 1eumA in template set T0365 12 :KSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQI 1eumA 4 :PEMIEKLNEQMNLELYSSLLYQQMSAWCSYHTFEGAAAFLRRH T0365 58 :EKQGDSLKREIRLT 1eumA 47 :AQEEMTHMQRLFDY T0365 99 :AKDI 1eumA 61 :LTDT T0365 109 :RQLLIPQ 1eumA 66 :NLPRINT T0365 121 :FIAYLQRCIDAVGLAQQVINELDDLLEAG 1eumA 83 :LDELFQETYKHEQLITQKINELAHAAMTN T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1eumA 112 :QDYPTFNFLQWYVSEQHEEEKLFKSIIDKLSLAGK T0365 191 :NPVDVMFLYK 1eumA 147 :SGEGLYFIDK T0365 204 :WV 1eumA 157 :EL Number of specific fragments extracted= 8 number of extra gaps= 0 total=222 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1666231348.pdb -s /var/tmp/to_scwrl_1666231348.seq -o /var/tmp/from_scwrl_1666231348.pdb > /var/tmp/scwrl_1666231348.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1666231348.pdb Number of alignments=26 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t72A/T0365-1t72A-t2k-global-adpstyle1.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1t72A/T0365-1t72A-t2k-global-adpstyle1.a2m # 1t72A read from 1t72A/T0365-1t72A-t2k-global-adpstyle1.a2m # found chain 1t72A in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1t72A)G1 Warning: unaligning (T0365)R82 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)T83 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIRMIALYQP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTLL T0365 162 :INELDIIEEDTDDLQIQLRRQLFA 1t72A 149 :AKKVIEKDDTVDELYHQLERELMT T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 1t72A 175 :LEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYL Number of specific fragments extracted= 5 number of extra gaps= 2 total=227 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1987519914.pdb -s /var/tmp/to_scwrl_1987519914.seq -o /var/tmp/from_scwrl_1987519914.pdb > /var/tmp/scwrl_1987519914.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1987519914.pdb Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vljA/T0365-1vljA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1vljA/T0365-1vljA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vljA read from 1vljA/T0365-1vljA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vljA in training set T0365 21 :HMDKVYDCASLLVPFFEATI 1vljA 213 :SNEIAEGTIRTIMKMTERLI T0365 41 :TGNWDDAVQIRKQ 1vljA 235 :PDDYEARANLAWS T0365 68 :IRLTLPSGL 1vljA 248 :ATIALNGTM T0365 84 :DLLELLTQQDKIA 1vljA 266 :ACHRIEHSLSALY T0365 97 :NKAKDISGRVIGRQLLIPQALQVPFIAYLQ 1vljA 284 :AGLAIVFPAWMKYVYRKNPAQFERFAKKIF T0365 127 :RCIDAVGLAQQVINEL 1vljA 322 :LILKGIEAFKNWLKKV T0365 148 :AGFRGREVDFVAKM 1vljA 346 :AGIPEEDIDKIVDN T0365 176 :QIQLRRQLFALES 1vljA 360 :VMLLVEKNLKPKG T0365 189 :ELNPVD 1vljA 380 :VLERED T0365 198 :LYKTIE 1vljA 386 :VREILK Number of specific fragments extracted= 10 number of extra gaps= 0 total=237 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1195950185.pdb -s /var/tmp/to_scwrl_1195950185.seq -o /var/tmp/from_scwrl_1195950185.pdb > /var/tmp/scwrl_1195950185.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1195950185.pdb Number of alignments=28 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ofcX/T0365-1ofcX-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always 1ofcX expands to /projects/compbio/data/pdb/1ofc.pdb.gz 1ofcX:Skipped atom 744, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 746, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 748, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 750, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 752, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 754, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 756, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 934, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 936, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 938, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 940, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 942, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1428, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1430, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1432, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1434, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1436, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1438, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1440, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1729, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1731, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1733, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1735, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1812, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1814, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1816, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1818, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1820, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1822, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1824, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1849, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1851, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1853, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1855, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1857, because occupancy 0.500 <= existing 0.500 in 1ofcX Skipped atom 1859, because occupancy 0.500 <= existing 0.500 in 1ofcX # T0365 read from 1ofcX/T0365-1ofcX-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1ofcX read from 1ofcX/T0365-1ofcX-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # adding 1ofcX to template set # found chain 1ofcX in template set Warning: unaligning (T0365)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 2 :PVNSILGVFAKSPIKPLQEHMDK 1ofcX 723 :PIVQDFQFFPPRLFELLDQEIYY T0365 37 :EATIT 1ofcX 746 :FRKTV T0365 45 :DDAVQIRKQIS 1ofcX 766 :KVQREEQRKID T0365 62 :DSLKREIRLT 1ofcX 783 :EEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 100 :KDISG 1ofcX 821 :DNIAK T0365 110 :QLL 1ofcX 826 :DVE T0365 113 :IPQA 1ofcX 830 :KTPE T0365 120 :PFIAYLQRCIDA 1ofcX 834 :EVIEYNAVFWER T0365 153 :REVDFVA 1ofcX 850 :QDIERIM T0365 163 :NELDIIEEDTDDL 1ofcX 857 :GQIERGEGKIQRR T0365 176 :QIQLRRQLFALE 1ofcX 872 :IKKALDQKMSRY T0365 190 :LNPVDVMFLYKT 1ofcX 902 :YTEIEDRFLVCM T0365 202 :IEWVGGLADL 1ofcX 925 :YEELRAAIRA T0365 212 :AERVGSRLELMLAR 1ofcX 952 :LQRRCNTLITLIER Number of specific fragments extracted= 16 number of extra gaps= 3 total=253 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_625843881.pdb -s /var/tmp/to_scwrl_625843881.seq -o /var/tmp/from_scwrl_625843881.pdb > /var/tmp/scwrl_625843881.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_625843881.pdb Number of alignments=29 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j1vA/T0365-1j1vA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1j1vA/T0365-1j1vA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1j1vA read from 1j1vA/T0365-1j1vA-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1j1vA in template set T0365 47 :AVQIRKQISLA 1j1vA 376 :IDNIQKTVAEY T0365 80 :VERTDLL 1j1vA 389 :IKVADLL T0365 111 :LLIPQALQVPFIAYLQ 1j1vA 397 :KRRSRSVARPRQMAMA T0365 128 :CIDAV 1j1vA 413 :LAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL Number of specific fragments extracted= 7 number of extra gaps= 0 total=260 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_532495011.pdb -s /var/tmp/to_scwrl_532495011.seq -o /var/tmp/from_scwrl_532495011.pdb > /var/tmp/scwrl_532495011.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_532495011.pdb Number of alignments=30 # command:# reading script from file T0365.undertaker-align.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sumB/T0365-1sumB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1sumB/T0365-1sumB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1sumB read from 1sumB/T0365-1sumB-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1sumB in template set T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRK 1sumB 36 :ERNESLAREVIA T0365 53 :QISLAEKQGDSLKREIRLTLP 1sumB 51 :VVDQMEVEIQEKAMEVLGLFS T0365 79 :PVERT 1sumB 72 :PIGKP T0365 86 :LELLTQQDKIANKAKDISGRVI 1sumB 84 :IRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQALQ 1sumB 107 :LMEEPPLKPLE T0365 120 :PFIAYLQRCIDAVGLAQQVI 1sumB 118 :DIPAMANQTSEMLKFALRMF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 138 :ADVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 9 number of extra gaps= 0 total=269 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_415675634.pdb -s /var/tmp/to_scwrl_415675634.seq -o /var/tmp/from_scwrl_415675634.pdb > /var/tmp/scwrl_415675634.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_415675634.pdb Number of alignments=31 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xwmA/T0365-1xwmA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1xwmA/T0365-1xwmA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1xwmA read from 1xwmA/T0365-1xwmA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAI T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 76 :L 1xwmA 71 :Q T0365 80 :VERT 1xwmA 72 :PVAT T0365 84 :DL 1xwmA 79 :RI T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGG T0365 112 :LIPQAL 1xwmA 111 :PFVMDI T0365 119 :VPFIAYLQRCID 1xwmA 117 :GPLVLMYRLATD T0365 134 :LAQQVINELDD 1xwmA 129 :MVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALESE 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVAKT T0365 191 :N 1xwmA 173 :D T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 14 number of extra gaps= 0 total=283 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_67874133.pdb -s /var/tmp/to_scwrl_67874133.seq -o /var/tmp/from_scwrl_67874133.pdb > /var/tmp/scwrl_67874133.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_67874133.pdb Number of alignments=32 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vctA/T0365-1vctA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1vctA/T0365-1vctA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1vctA read from 1vctA/T0365-1vctA-t06-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1vctA in template set T0365 114 :PQALQVPFIAYLQRCIDAVGLAQ 1vctA 14 :VKEIFIEMKDTVELMVDLAYASL T0365 142 :LDD 1vctA 37 :LFG T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALES 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAAR T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1vctA 71 :NVKEAEQVITILQIANAIEDISNAAGDLAKMVLEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=287 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_240854387.pdb -s /var/tmp/to_scwrl_240854387.seq -o /var/tmp/from_scwrl_240854387.pdb > /var/tmp/scwrl_240854387.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_240854387.pdb Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o5hA/T0365-1o5hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1o5hA/T0365-1o5hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1o5hA read from 1o5hA/T0365-1o5hA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1o5hA in template set T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAKKDMEA T0365 72 :LPSG 1o5hA 87 :VMKA T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 98 :LQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 149 :GF 1o5hA 162 :EI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGI Number of specific fragments extracted= 7 number of extra gaps= 0 total=294 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1561812721.pdb -s /var/tmp/to_scwrl_1561812721.seq -o /var/tmp/from_scwrl_1561812721.pdb > /var/tmp/scwrl_1561812721.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1561812721.pdb Number of alignments=34 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n81A/T0365-1n81A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1n81A/T0365-1n81A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1n81A read from 1n81A/T0365-1n81A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1n81A in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEATI 1n81A 25 :HETHAPLSPRIRKVGDIEFHACSDYIYLLMTLS T0365 42 :GNWDDAVQIR 1n81A 58 :KDPEKFNYAL T0365 53 :QISLAEK 1n81A 72 :SIRRYVR T0365 67 :EIRLTLPSGL 1n81A 79 :KNQNRYNYFL T0365 80 :VERT 1n81A 89 :IEER T0365 91 :QQDKIANKAKDISGRV 1n81A 93 :VQDNIVNRISDRLISY T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 109 :CTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALES 1n81A 156 :KKLIRMLFDTYEYVKD T0365 190 :LN 1n81A 172 :VK T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 11 number of extra gaps= 0 total=305 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1322623286.pdb -s /var/tmp/to_scwrl_1322623286.seq -o /var/tmp/from_scwrl_1322623286.pdb > /var/tmp/scwrl_1322623286.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1322623286.pdb Number of alignments=35 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j1vA/T0365-1j1vA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1j1vA/T0365-1j1vA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1j1vA read from 1j1vA/T0365-1j1vA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1j1vA in template set T0365 47 :AVQIRKQISLAEK 1j1vA 376 :IDNIQKTVAEYYK T0365 80 :VERTDLL 1j1vA 389 :IKVADLL T0365 115 :QALQVPFIAYLQRCIDAVGLA 1j1vA 397 :KRRSRSVARPRQMAMALAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL Number of specific fragments extracted= 6 number of extra gaps= 0 total=311 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_454806773.pdb -s /var/tmp/to_scwrl_454806773.seq -o /var/tmp/from_scwrl_454806773.pdb > /var/tmp/scwrl_454806773.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_454806773.pdb Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hw1A/T0365-1hw1A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1hw1A/T0365-1hw1A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1hw1A read from 1hw1A/T0365-1hw1A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1hw1A in training set T0365 7 :LGVFAKSPIKPLQEHMDKVYD 1hw1A 87 :ARLDHESVPQLIDNLLSVRTN T0365 31 :LLVPFFEATITGNWDDAVQIRKQ 1hw1A 108 :ISTIFIRTAFRQHPDKAQEVLAT T0365 72 :LPS 1hw1A 131 :ANE T0365 78 :MPVERT 1hw1A 134 :VADHAD T0365 87 :ELLTQQDKIANKAKDISG 1hw1A 140 :AFAELDYNIFRGLAFASG T0365 114 :PQALQVPF 1hw1A 158 :NPIYGLIL T0365 122 :IAYLQRCID 1hw1A 169 :KGLYTRIGR T0365 131 :AVGLAQQVINELDDLLEAGFR 1hw1A 185 :ARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQLRR 1hw1A 212 :VRRYGHESGEIWHRMQK Number of specific fragments extracted= 10 number of extra gaps= 0 total=321 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1456339642.pdb -s /var/tmp/to_scwrl_1456339642.seq -o /var/tmp/from_scwrl_1456339642.pdb > /var/tmp/scwrl_1456339642.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1456339642.pdb Number of alignments=37 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wkbA/T0365-1wkbA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1wkbA/T0365-1wkbA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1wkbA read from 1wkbA/T0365-1wkbA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1wkbA in template set T0365 80 :VERTDLLELLTQQDKIANKAKDIS 1wkbA 689 :WRRKEVGKLRKQIERFYELISQFA T0365 108 :GRQLL 1wkbA 713 :EYEVK T0365 115 :Q 1wkbA 718 :G T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINEL 1wkbA 721 :ELKDIDRWMLHRLNKAIKETTNALEEF T0365 143 :DDLLEAGF 1wkbA 750 :RTAVQWAF T0365 170 :EDTDDLQIQLRRQL 1wkbA 758 :YSIMNDLRWYLRRT T0365 185 :A 1wkbA 772 :E T0365 188 :SELNPVDVMFLYKTIEWVGGLA 1wkbA 773 :GRDDEAKRYVLRTLADVWVRLM Number of specific fragments extracted= 8 number of extra gaps= 0 total=329 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_2017881518.pdb -s /var/tmp/to_scwrl_2017881518.seq -o /var/tmp/from_scwrl_2017881518.pdb > /var/tmp/scwrl_2017881518.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_2017881518.pdb Number of alignments=38 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1urvA/T0365-1urvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1urvA/T0365-1urvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1urvA read from 1urvA/T0365-1urvA-t04-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1urvA in template set Warning: unaligning (T0365)S103 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)G104 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 21 :HMDKVYDCASLLV 1urvA 23 :ERKAVQAMWARLY T0365 34 :PFFEATI 1urvA 44 :AILVRFF T0365 41 :TGNWDDAVQ 1urvA 66 :MEDPLEMER T0365 53 :QISLAEKQGDSLKREIRLTLP 1urvA 77 :QLRKHASRVMGALNTVVENLH T0365 81 :ERTDLLELLTQQDKI 1urvA 98 :DPDKVSSVLALVGKA T0365 102 :I 1urvA 113 :H T0365 110 :QLLI 1urvA 116 :KHKV T0365 116 :AL 1urvA 120 :EP T0365 119 :VPFIAYLQRCID 1urvA 122 :VYFKILSGVILE T0365 145 :LLEAGFRGREVDFVAKMINELDII 1urvA 134 :VVAEEFASDFPPETQRAWAKLRGL T0365 172 :TDDLQIQLRRQ 1urvA 158 :IYSHVTAAYKE Number of specific fragments extracted= 11 number of extra gaps= 1 total=340 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1692786741.pdb -s /var/tmp/to_scwrl_1692786741.seq -o /var/tmp/from_scwrl_1692786741.pdb > /var/tmp/scwrl_1692786741.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1692786741.pdb Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oq9A/T0365-1oq9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m with NO bystroff filtering # adding to alignment library always # T0365 read from 1oq9A/T0365-1oq9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # 1oq9A read from 1oq9A/T0365-1oq9A-t2k-local-str2+near-backbone-11-0.8+0.6+0.8-adpstyle5.a2m # found chain 1oq9A in template set T0365 63 :SLKREIRLTLPSGL 1oq9A 109 :PTYQTMLNTLDGVR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRC 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGS T0365 129 :IDAVGLAQQVIN 1oq9A 200 :FISHGNTARQAK T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1oq9A 212 :EHGDIKLAQICGTIAADEKRHETAYTKIVEKLFEID T0365 191 :NPVDVMFLYKTIEW 1oq9A 248 :PDGTVLAFADMMRK T0365 207 :GLADLAERVG 1oq9A 277 :NLFDHFSAVA T0365 217 :SRLELML 1oq9A 299 :DILEFLV Number of specific fragments extracted= 7 number of extra gaps= 0 total=347 Will force an alignment to be made, even if fragment is small # request to SCWRL produces command: ulimit -t 204 ; scwrl3 -i /var/tmp/to_scwrl_1549495353.pdb -s /var/tmp/to_scwrl_1549495353.seq -o /var/tmp/from_scwrl_1549495353.pdb > /var/tmp/scwrl_1549495353.log # Trying to read SCWRLed conformation from /var/tmp/from_scwrl_1549495353.pdb Number of alignments=40 # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0365//projects/compbio/experiments/protein-predict/casp7/constraints/T0365/manyalignments.under or /projects/compbio/experiments/protein-predict/casp7/T0365//projects/compbio/experiments/protein-predict/casp7/constraints/T0365/manyalignments.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints/T0365/manyalignments.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints/T0365/manyalignments.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vljA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1vljA/merged-a2m # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 1 :MPV 1vljA 1 :MEN T0365 4 :NSILGVFAKS 1vljA 32 :RKVLFLYGGG T0365 14 :PIKPLQEHMDKV 1vljA 48 :VYDQVVDSLKKH T0365 26 :YDCASLLVPFFE 1vljA 102 :VDSAKAVAAGAL T0365 38 :ATITG 1vljA 138 :LTISA T0365 44 :WDDAVQIRKQISLAEKQGDSLK 1vljA 143 :TGTEMNGNAVITNEKTKEKYGV T0365 66 :REIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVG 1vljA 187 :EQTVYGAVDAISHILEYYFDGSSPEISNEIAEGTIRTIMKMTERLIEKPDDYEARANLAWSATIALNG T0365 134 :LAQQVINE 1vljA 308 :FAKKIFGF T0365 144 :DLLEAGFRGREVDFVAKMINELD 1vljA 316 :EGEGEELILKGIEAFKNWLKKVG T0365 168 :IEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1vljA 339 :APVSLKDAGIPEEDIDKIVDNVMLLVEKNLKPKGASLGRIMVLEREDVREILKLAA Number of specific fragments extracted= 10 number of extra gaps= 0 total=357 Number of alignments=41 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 1 :MPVNSI 1vljA 1 :MENFVF T0365 7 :LGVFAKS 1vljA 35 :LFLYGGG T0365 14 :PIKPLQEHMDKV 1vljA 48 :VYDQVVDSLKKH T0365 27 :DCAS 1vljA 60 :GIEW T0365 33 :VPFFEATITGNWDDAVQIRKQI 1vljA 64 :VEVSGVKPNPVLSKVHEAVEVA T0365 55 :SLAEKQG 1vljA 109 :AAGALYE T0365 62 :DSLKRE 1vljA 158 :TKEKYG T0365 68 :IRLTLPSGLFM 1vljA 180 :VQFTLPKEQTV T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQV 1vljA 200 :ILEYYFDGSSPEISNEIAEGTIRTIMKMTERLIEKPDDYEA T0365 120 :PFIAYLQ 1vljA 245 :AWSATIA T0365 127 :RCIDAVGLA 1vljA 256 :MAVGRRGGE T0365 136 :QQVI 1vljA 288 :IVFP T0365 140 :NELDDLLE 1vljA 303 :AQFERFAK T0365 148 :AGFRGREVDFVAKMINELDI 1vljA 320 :EELILKGIEAFKNWLKKVGA T0365 169 :EEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1vljA 340 :PVSLKDAGIPEEDIDKIVDNVMLLVEKNLKPKGASLGRIMVLEREDVREILKLAA Number of specific fragments extracted= 15 number of extra gaps= 0 total=372 Number of alignments=42 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 141 :ELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRR 1vljA 352 :DIDKIVDNVMLLVEKNLKPKGASLGRIMVLEREDVREILKL Number of specific fragments extracted= 1 number of extra gaps= 0 total=373 Number of alignments=43 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 117 :LQVPFIAYLQRCIDAVGLAQQV 1vljA 322 :LILKGIEAFKNWLKKVGAPVSL T0365 139 :INELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDL 1vljA 350 :EEDIDKIVDNVMLLVEKNLKPKGASLGRIMVLEREDV Number of specific fragments extracted= 2 number of extra gaps= 0 total=375 Number of alignments=44 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVY 1vljA 5 :VFHNPTKIVFGRGTIPKIGEEIKNAG T0365 27 :DCASLLVPFFEATITGNWDDAVQIRKQI 1vljA 32 :RKVLFLYGGGSIKKNGVYDQVVDSLKKH T0365 55 :SLAEKQGDSL 1vljA 155 :NEKTKEKYGV T0365 65 :KREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLL 1vljA 186 :KEQTVYGAVDAISHILEYYFDGSSPEISNEIAEGTIRTIMKMTERLIE T0365 113 :IPQALQVPFIAYLQ 1vljA 238 :YEARANLAWSATIA T0365 127 :RCIDAVG 1vljA 256 :MAVGRRG T0365 135 :AQQVINELDDLLEAGF 1vljA 263 :GEWACHRIEHSLSALY T0365 151 :RGREVDFVAKMI 1vljA 298 :YRKNPAQFERFA T0365 163 :NELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKT 1vljA 325 :KGIEAFKNWLKKVGAPVSLKDAGIPEEDIDKIVDNVMLL T0365 202 :IEWVGGLADLAERVGSRLELMLAR 1vljA 370 :PKGASLGRIMVLEREDVREILKLA Number of specific fragments extracted= 10 number of extra gaps= 0 total=385 Number of alignments=45 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 1 :MPVNSI 1vljA 1 :MENFVF T0365 7 :LGVFAKSPIKPLQEHMDKVY 1vljA 11 :KIVFGRGTIPKIGEEIKNAG T0365 27 :DCASLLVPFFEATITGNWDDA 1vljA 32 :RKVLFLYGGGSIKKNGVYDQV T0365 48 :VQIRKQISLAEKQGDSLKRE 1vljA 69 :VKPNPVLSKVHEAVEVAKKE T0365 68 :IRLTLPSGL 1vljA 108 :VAAGALYEG T0365 77 :FMPVERTDLLELLTQ 1vljA 126 :YQIEKALPIFDVLTI T0365 93 :DKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQR 1vljA 144 :GTEMNGNAVITNEKTKEKYGVSSKALYPKVSIIDP T0365 128 :CIDA 1vljA 193 :AVDA T0365 132 :VGLAQQVINELDDLLEAGFR 1vljA 214 :NEIAEGTIRTIMKMTERLIE T0365 152 :GREVDFVAKMINE 1vljA 235 :PDDYEARANLAWS T0365 165 :LDIIEEDTDDLQIQLRRQLFALESELNPV 1vljA 294 :MKYVYRKNPAQFERFAKKIFGFEGEGEEL T0365 195 :VMFLYKTIEWVGGLADL 1vljA 330 :FKNWLKKVGAPVSLKDA T0365 212 :A 1vljA 360 :V T0365 213 :ERVGSRLELMLAR 1vljA 381 :LEREDVREILKLA Number of specific fragments extracted= 14 number of extra gaps= 0 total=399 Number of alignments=46 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 120 :PFIAYLQRCIDAVGLAQQVINELDDL 1vljA 34 :VLFLYGGGSIKKNGVYDQVVDSLKKH Number of specific fragments extracted= 1 number of extra gaps= 0 total=400 Number of alignments=47 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 105 :RVIGRQLLIPQA 1vljA 311 :KIFGFEGEGEEL T0365 118 :QVPFIAYLQRCIDAVGLAQQ 1vljA 323 :ILKGIEAFKNWLKKVGAPVS T0365 145 :LLEAGFRGREVDFVAKMINEL 1vljA 343 :LKDAGIPEEDIDKIVDNVMLL Number of specific fragments extracted= 3 number of extra gaps= 0 total=403 Number of alignments=48 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 1 :MPVNSILGVFAKS 1vljA 29 :AGIRKVLFLYGGG T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQ 1vljA 48 :VYDQVVDSLKKHGIEWVEVSGVKPNPVLSKVHEAVEVAKK T0365 54 :ISLAEKQGDSLKREIRLTLPSGLFMPV 1vljA 108 :VAAGALYEGDIWDAFIGKYQIEKALPI T0365 81 :ERTDLLELLTQQDKIANKAKDIS 1vljA 146 :EMNGNAVITNEKTKEKYGVSSKA T0365 104 :GRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRG 1vljA 203 :YYFDGSSPEISNEIAEGTIRTIMKMTERLIEKPDDYEARANLAWSATIA T0365 153 :REVDFVA 1vljA 255 :TMAVGRR T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFAL 1vljA 289 :VFPAWMKYVYRKNPAQFERFAKKIFGF T0365 194 :DVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1vljA 316 :EGEGEELILKGIEAFKNWLKKVGAPVSLKDAGI Number of specific fragments extracted= 8 number of extra gaps= 0 total=411 Number of alignments=49 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDK 1vljA 8 :NPTKIVFGRGTIPKIGEEIKNAGI T0365 27 :DCASLLVPFFEATITGNWDDAVQIRKQ 1vljA 32 :RKVLFLYGGGSIKKNGVYDQVVDSLKK T0365 54 :ISLAEKQGDSLKREI 1vljA 108 :VAAGALYEGDIWDAF T0365 74 :SGLFMPVERTDLLELLTQ 1vljA 123 :IGKYQIEKALPIFDVLTI T0365 94 :KIANKAKDISGRVIGRQ 1vljA 152 :VITNEKTKEKYGVSSKA T0365 112 :LIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRG 1vljA 211 :EISNEIAEGTIRTIMKMTERLIEKPDDYEARANLAWSATIA T0365 153 :REVDFVA 1vljA 255 :TMAVGRR T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFAL 1vljA 289 :VFPAWMKYVYRKNPAQFERFAKKIFGF T0365 194 :DVMFLYKTIEWVGGLADLAERVGSRLE 1vljA 316 :EGEGEELILKGIEAFKNWLKKVGAPVS T0365 221 :LML 1vljA 389 :ILK Number of specific fragments extracted= 10 number of extra gaps= 0 total=421 Number of alignments=50 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 87 :ELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1vljA 11 :KIVFGRGTIPKIGEEIKNAGIRKVLFLYGGGSIKKNGVYDQVVDSLKKHGIEWVEVSG Number of specific fragments extracted= 1 number of extra gaps= 0 total=422 Number of alignments=51 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=422 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 75 :GLFMPVERTDLLELL 1vljA 376 :GRIMVLEREDVREIL Number of specific fragments extracted= 1 number of extra gaps= 0 total=423 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=423 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 1 :MPVNSILGVFAKS 1vljA 13 :VFGRGTIPKIGEE T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQI 1vljA 31 :IRKVLFLYGGGSIKKNGVYDQVVDSLKKHGIEWVEVS T0365 51 :RKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1vljA 75 :LSKVHEAVEVAKKEKVEAVLGVGGGSVVDSAKA T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFV 1vljA 139 :TISATGTEMNGNAVITNEKTKEKYGVSSKALYPKVSIIDPSVQFTLPKEQTVYGAVDAISHILEYYFDGSSPEIS T0365 166 :DIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTI 1vljA 214 :NEIAEGTIRTIMKMTERLIEKPDDYEARANLAWSATI T0365 203 :EWVGGLADLAERVGSRLELMLAR 1vljA 268 :HRIEHSLSALYDIAHGAGLAIVF Number of specific fragments extracted= 6 number of extra gaps= 0 total=429 Number of alignments=52 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 3 :VNSILG 1vljA 1 :MENFVF T0365 9 :VFAKSPIKPLQEHMDKV 1vljA 13 :VFGRGTIPKIGEEIKNA T0365 26 :YDCASLLV 1vljA 31 :IRKVLFLY T0365 34 :PFFEATITGNWDDA 1vljA 51 :QVVDSLKKHGIEWV T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVER 1vljA 72 :NPVLSKVHEAVEVAKKEKVEAVLGVGGGSVVDSAK T0365 83 :TDL 1vljA 116 :GDI T0365 91 :QQDKIAN 1vljA 127 :QIEKALP T0365 98 :KAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDI 1vljA 153 :ITNEKTKEKYGVSSKALYPKVSIIDPSVQFTLPKEQTVYGAVDAISHILEYYFDGSSPEISNEIAEGTIR T0365 175 :LQIQLRRQLFALESELNPVDVMFLYKTI 1vljA 223 :TIMKMTERLIEKPDDYEARANLAWSATI T0365 203 :EWVGGLADLAERVGSRLELML 1vljA 272 :HSLSALYDIAHGAGLAIVFPA T0365 224 :AR 1vljA 294 :MK Number of specific fragments extracted= 11 number of extra gaps= 0 total=440 Number of alignments=53 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)F10 because first residue in template chain is (1vljA)H-2 Warning: unaligning (T0365)R225 because last residue in template chain is (1vljA)K395 T0365 11 :AKS 1vljA -1 :HHM T0365 14 :P 1vljA 9 :P T0365 16 :KPLQE 1vljA 24 :EEIKN T0365 21 :HMDKVYDCAS 1vljA 48 :VYDQVVDSLK T0365 31 :LLVPFFEATITGNW 1vljA 77 :KVHEAVEVAKKEKV T0365 68 :IRLTLPS 1vljA 109 :AAGALYE T0365 75 :GLF 1vljA 121 :AFI T0365 78 :MPV 1vljA 132 :LPI T0365 91 :QQDKIANKAKDISGRVIGR 1vljA 186 :KEQTVYGAVDAISHILEYY T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQ 1vljA 206 :DGSSPEISNEIAEGTIRTIMKMTERLIE T0365 141 :ELDDLL 1vljA 273 :SLSALY T0365 147 :EAGF 1vljA 295 :KYVY T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1vljA 299 :RKNPAQFERFAKKIFGFEGEGEELILKGIEAFKNW T0365 187 :ESELN 1vljA 350 :EEDID T0365 200 :KTIEWVGGLADL 1vljA 355 :KIVDNVMLLVEK T0365 213 :ERVGS 1vljA 384 :EDVRE T0365 219 :LELMLA 1vljA 389 :ILKLAA Number of specific fragments extracted= 17 number of extra gaps= 0 total=457 Number of alignments=54 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)F10 because first residue in template chain is (1vljA)H-2 Warning: unaligning (T0365)R225 because last residue in template chain is (1vljA)K395 T0365 11 :AKS 1vljA -1 :HHM T0365 16 :KP 1vljA 20 :PK T0365 21 :HMDKVYD 1vljA 22 :IGEEIKN T0365 42 :GN 1vljA 40 :GG T0365 46 :DAVQ 1vljA 42 :SIKK T0365 50 :IRKQISLAEKQ 1vljA 48 :VYDQVVDSLKK T0365 72 :LPSGL 1vljA 69 :VKPNP T0365 81 :ERTDLLELLTQQDK 1vljA 74 :VLSKVHEAVEVAKK T0365 95 :IANKAKDISGRV 1vljA 101 :VVDSAKAVAAGA T0365 108 :GR 1vljA 113 :LY T0365 110 :QLLIPQ 1vljA 125 :KYQIEK T0365 116 :ALQVP 1vljA 183 :TLPKE T0365 121 :FIA 1vljA 189 :TVY T0365 126 :QRCIDAVGLAQQVINELDD 1vljA 215 :EIAEGTIRTIMKMTERLIE T0365 151 :RGREVDFVAKMINEL 1vljA 234 :KPDDYEARANLAWSA T0365 173 :DDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGG 1vljA 302 :PAQFERFAKKIFGFEGEGEELILKGIEAFKNWLKK T0365 208 :LADLAERVGS 1vljA 356 :IVDNVMLLVE T0365 218 :RLELMLA 1vljA 388 :EILKLAA Number of specific fragments extracted= 18 number of extra gaps= 0 total=475 Number of alignments=55 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 29 :ASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1vljA 287 :AIVFPAWMKYVYRKNPAQFERFAKKIFGFEGEGEELILKGIEAFKN T0365 75 :GLFMPVERTDLLELLTQQDKIANKA 1vljA 336 :KVGAPVSLKDAGIPEEDIDKIVDNV Number of specific fragments extracted= 2 number of extra gaps= 0 total=477 Number of alignments=56 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1vljA 286 :LAIVFPAWMKYVYRKNPAQFERFAKKIFGFEGEGEELILKGIEAFKN T0365 98 :KAKDISGRVIGRQLLIPQALQVPFIAYLQRC 1vljA 333 :WLKKVGAPVSLKDAGIPEEDIDKIVDNVMLL Number of specific fragments extracted= 2 number of extra gaps= 0 total=479 Number of alignments=57 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 32 :LVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRL 1vljA 290 :FPAWMKYVYRKNPAQFERFAKKIFGFEGEGEELILKGIE T0365 87 :ELLTQQ 1vljA 329 :AFKNWL T0365 100 :KDISGRVIGRQLLIPQALQVPFIAYLQRCID 1vljA 335 :KKVGAPVSLKDAGIPEEDIDKIVDNVMLLVE Number of specific fragments extracted= 3 number of extra gaps= 0 total=482 Number of alignments=58 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 11 :AKSPIKP 1vljA 206 :DGSSPEI T0365 21 :HMDKVYDCASLLVPFFEATI 1vljA 213 :SNEIAEGTIRTIMKMTERLI T0365 41 :TGNWDDAVQIR 1vljA 235 :PDDYEARANLA T0365 66 :REIRLTLPS 1vljA 246 :WSATIALNG T0365 75 :GLFMPVE 1vljA 259 :GRRGGEW T0365 84 :DLLELLTQQDKIAN 1vljA 266 :ACHRIEHSLSALYD T0365 100 :KDISGRVIGRQLL 1vljA 283 :GAGLAIVFPAWMK T0365 113 :IPQALQVPFIAYLQRCI 1vljA 297 :VYRKNPAQFERFAKKIF T0365 133 :GLAQQVINELDDLLEA 1vljA 321 :ELILKGIEAFKNWLKK T0365 149 :GFRGREVDFVAKM 1vljA 347 :GIPEEDIDKIVDN T0365 176 :QIQLRRQLFALESEL 1vljA 360 :VMLLVEKNLKPKGAS T0365 191 :NP 1vljA 382 :ER T0365 203 :EWVGGLADL 1vljA 384 :EDVREILKL Number of specific fragments extracted= 13 number of extra gaps= 0 total=495 Number of alignments=59 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)L7 because first residue in template chain is (1vljA)H-2 T0365 8 :GVFAKSPI 1vljA -1 :HHMENFVF T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQ 1vljA 33 :KVLFLYGGGSIKKNGVYDQVVDSLKKHGIEWVEV T0365 50 :IRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1vljA 74 :VLSKVHEAVEVAKKEKVEAVLGVGGGSVVDSAKA T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRG 1vljA 139 :TISATGTEMNGNAVITNEKTKEKYGVSSKALYPKVSIIDPSVQFTLPKEQTVYGAVDAISHILEYYFDG T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 1vljA 219 :GTIRTIMKMTERLIEKPDDYEARANLAWSATIALNGTMAVGRR T0365 196 :MFLYKTIEWVGGLADLAERVGSRLELMLAR 1vljA 265 :WACHRIEHSLSALYDIAHGAGLAIVFPAWM Number of specific fragments extracted= 6 number of extra gaps= 0 total=501 Number of alignments=60 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)L7 because first residue in template chain is (1vljA)H-2 T0365 8 :GVFAKSPI 1vljA -1 :HHMENFVF T0365 18 :LQEHMDKVYDCA 1vljA 19 :IPKIGEEIKNAG T0365 30 :SLLVPFFEATITGNWDDAVQ 1vljA 35 :LFLYGGGSIKKNGVYDQVVD T0365 50 :IRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1vljA 74 :VLSKVHEAVEVAKKEKVEAVLGVGGGSVVDSAKA T0365 84 :DLLELLTQQDKIANK 1vljA 220 :TIRTIMKMTERLIEK T0365 114 :PQALQVPFIAYLQ 1vljA 235 :PDDYEARANLAWS T0365 131 :AVGLAQQVINELDDLLEAG 1vljA 266 :ACHRIEHSLSALYDIAHGA T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 1vljA 297 :VYRKNPAQFERFAKKIFGFEGEGEELILKGIEAFKNWLKKVGAPVS Number of specific fragments extracted= 8 number of extra gaps= 0 total=509 Number of alignments=61 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)L7 because first residue in template chain is (1vljA)H-2 Warning: unaligning (T0365)R225 because last residue in template chain is (1vljA)K395 T0365 8 :GVFAK 1vljA -1 :HHMEN T0365 16 :KPLQE 1vljA 24 :EEIKN T0365 21 :HMDKVYDC 1vljA 48 :VYDQVVDS T0365 29 :ASLLVPFFEATITGNW 1vljA 75 :LSKVHEAVEVAKKEKV T0365 71 :TLPSGLFM 1vljA 112 :ALYEGDIW T0365 92 :QDKIANKAKDISGRVIGR 1vljA 187 :EQTVYGAVDAISHILEYY T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQ 1vljA 206 :DGSSPEISNEIAEGTIRTIMKMTERLIE T0365 141 :ELDDLL 1vljA 273 :SLSALY T0365 147 :EAGF 1vljA 295 :KYVY T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1vljA 299 :RKNPAQFERFAKKIFGFEGEGEELILKGIEAFKNW T0365 187 :ESELN 1vljA 350 :EEDID T0365 200 :KTIEWVGGLADL 1vljA 355 :KIVDNVMLLVEK T0365 213 :ERV 1vljA 384 :EDV T0365 217 :SRLELMLA 1vljA 387 :REILKLAA Number of specific fragments extracted= 14 number of extra gaps= 0 total=523 Number of alignments=62 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)F10 because first residue in template chain is (1vljA)H-2 T0365 11 :AKSPIKPLQEH 1vljA 15 :GRGTIPKIGEE T0365 25 :VYD 1vljA 26 :IKN T0365 28 :CASLLVPFFEA 1vljA 48 :VYDQVVDSLKK T0365 42 :GN 1vljA 59 :HG T0365 44 :WDDAVQIRKQISL 1vljA 75 :LSKVHEAVEVAKK T0365 84 :DLL 1vljA 188 :QTV T0365 96 :ANKAKDISGRVIGR 1vljA 191 :YGAVDAISHILEYY T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQ 1vljA 206 :DGSSPEISNEIAEGTIRTIMKMTERLIE T0365 151 :RGREVDFVAKMINELDII 1vljA 234 :KPDDYEARANLAWSATIA T0365 173 :DDLQIQLRRQLFALESE 1vljA 302 :PAQFERFAKKIFGFEGE T0365 191 :NPVDVMFLYK 1vljA 319 :GEELILKGIE T0365 201 :TIEWVGG 1vljA 330 :FKNWLKK T0365 208 :LADLAERVGSR 1vljA 356 :IVDNVMLLVEK T0365 219 :LELMLAR 1vljA 386 :VREILKL Number of specific fragments extracted= 14 number of extra gaps= 0 total=537 Number of alignments=63 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 29 :ASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1vljA 287 :AIVFPAWMKYVYRKNPAQFERFAKKIFGFEGEGEELILKGIEAFKN T0365 75 :GLFMPVERTDLLELLTQQDKIANKA 1vljA 336 :KVGAPVSLKDAGIPEEDIDKIVDNV Number of specific fragments extracted= 2 number of extra gaps= 0 total=539 Number of alignments=64 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1vljA 286 :LAIVFPAWMKYVYRKNPAQFERFAKKIFGFEGEGEELILKGIEAFKN T0365 98 :KAKDISGRVIGRQLLIPQALQVPFIAYL 1vljA 333 :WLKKVGAPVSLKDAGIPEEDIDKIVDNV Number of specific fragments extracted= 2 number of extra gaps= 0 total=541 Number of alignments=65 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=541 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 21 :HMDKVYDCASLLVPFFEATI 1vljA 213 :SNEIAEGTIRTIMKMTERLI T0365 41 :TGNWDDAVQIRK 1vljA 235 :PDDYEARANLAW T0365 67 :EIRL 1vljA 247 :SATI T0365 71 :TLPSGLFMPVE 1vljA 255 :TMAVGRRGGEW T0365 84 :DLLELLTQQDKIAN 1vljA 266 :ACHRIEHSLSALYD T0365 98 :KAKDISGRVIGRQL 1vljA 285 :GLAIVFPAWMKYVY T0365 115 :QALQVPFIAYLQRCI 1vljA 299 :RKNPAQFERFAKKIF T0365 133 :GLAQQVINELDDLLEA 1vljA 321 :ELILKGIEAFKNWLKK T0365 149 :GFRGREVDFVAKMI 1vljA 347 :GIPEEDIDKIVDNV T0365 177 :IQLRRQLFALESE 1vljA 361 :MLLVEKNLKPKGA T0365 190 :LNPVDV 1vljA 381 :LEREDV T0365 199 :YKTIEW 1vljA 387 :REILKL Number of specific fragments extracted= 12 number of extra gaps= 0 total=553 Number of alignments=66 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)V33 because first residue in template chain is (1vljA)H-2 T0365 34 :PFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGL 1vljA -1 :HHMENFVFHNPTKIVFGRGTIPKIGEEIKNAGIRKVLFLYGGG T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1vljA 42 :SIKKNGVYDQVVDSLKKHGIEWVEVSGVKPNPVLSKVHEAVEVAKKEKVEAV T0365 137 :QVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLR 1vljA 100 :SVVDSAKAVAAGALYEGDIWDAFIGKYQIEKALPIFDVLTISAT T0365 181 :RQLFALESELNPVDVMFLYK 1vljA 167 :KALYPKVSIIDPSVQFTLPK T0365 201 :TIEWVGGLADLAE 1vljA 190 :VYGAVDAISHILE T0365 214 :RVGSRLELMLARV 1vljA 211 :EISNEIAEGTIRT Number of specific fragments extracted= 6 number of extra gaps= 0 total=559 Number of alignments=67 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)K12 because first residue in template chain is (1vljA)H-2 T0365 13 :SPIKPLQEHM 1vljA -1 :HHMENFVFHN T0365 23 :DKVYDCASLLVPFFEATITGNWDDAVQIR 1vljA 10 :TKIVFGRGTIPKIGEEIKNAGIRKVLFLY T0365 52 :KQISLAEKQGDSLKREIRLTLPSGLFMPVE 1vljA 44 :KKNGVYDQVVDSLKKHGIEWVEVSGVKPNP T0365 82 :RTDLLE 1vljA 86 :KKEKVE T0365 88 :LLTQQDKIANKAKDISG 1vljA 94 :LGVGGGSVVDSAKAVAA T0365 105 :RVIGRQLLIPQALQVP 1vljA 144 :GTEMNGNAVITNEKTK T0365 121 :FIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDF 1vljA 176 :IDPSVQFTLPKEQTVYGAVDAISHILEYYFDGSSPEI T0365 158 :VAKMINELDIIEEDTDDLQI 1vljA 228 :TERLIEKPDDYEARANLAWS T0365 179 :LRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSR 1vljA 248 :ATIALNGTMAVGRRGGEWACHRIEHSLSALYDIAHGAGLA Number of specific fragments extracted= 9 number of extra gaps= 0 total=568 Number of alignments=68 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)R225 because last residue in template chain is (1vljA)K395 T0365 2 :PVNSILGV 1vljA 0 :HMENFVFH T0365 11 :AKSPIKPLQE 1vljA 15 :GRGTIPKIGE T0365 21 :HMDKVYDC 1vljA 48 :VYDQVVDS T0365 29 :ASLLVPFFEATITGNWD 1vljA 75 :LSKVHEAVEVAKKEKVE T0365 71 :TLPSG 1vljA 112 :ALYEG T0365 78 :MPV 1vljA 132 :LPI T0365 91 :QQDKIANKAKDISGRVIGR 1vljA 186 :KEQTVYGAVDAISHILEYY T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQ 1vljA 206 :DGSSPEISNEIAEGTIRTIMKMTERLIE T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1vljA 299 :RKNPAQFERFAKKIFGFEGEGEELILKGIEAFKN T0365 186 :LESELNPVDVMFLYKTIEWVGG 1vljA 344 :KDAGIPEEDIDKIVDNVMLLVE T0365 212 :AERVGSRLEL 1vljA 383 :REDVREILKL T0365 223 :LA 1vljA 393 :AA Number of specific fragments extracted= 12 number of extra gaps= 0 total=580 Number of alignments=69 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set Warning: unaligning (T0365)F10 because first residue in template chain is (1vljA)H-2 Warning: unaligning (T0365)R225 because last residue in template chain is (1vljA)K395 T0365 11 :AKSPIKPLQEHMDK 1vljA 15 :GRGTIPKIGEEIKN T0365 25 :VYD 1vljA 43 :IKK T0365 28 :CASLLVPFFEAT 1vljA 48 :VYDQVVDSLKKH T0365 42 :G 1vljA 60 :G T0365 44 :WDDAVQIRKQISL 1vljA 75 :LSKVHEAVEVAKK T0365 74 :SGLFM 1vljA 149 :GNAVI T0365 80 :VERTDLLELL 1vljA 184 :LPKEQTVYGA T0365 99 :AKDISGRVIGR 1vljA 194 :VDAISHILEYY T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQ 1vljA 206 :DGSSPEISNEIAEGTIRTIMKMTERLIE T0365 138 :VINELDDLLE 1vljA 240 :ARANLAWSAT T0365 148 :AGFR 1vljA 258 :VGRR T0365 152 :GREVDFVAKMINEL 1vljA 299 :RKNPAQFERFAKKI T0365 184 :FALESELNPVDVMFLYKTIEWVGG 1vljA 313 :FGFEGEGEELILKGIEAFKNWLKK T0365 208 :LADLAERVGS 1vljA 356 :IVDNVMLLVE T0365 218 :RLELMLA 1vljA 388 :EILKLAA Number of specific fragments extracted= 15 number of extra gaps= 0 total=595 Number of alignments=70 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 31 :LLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1vljA 289 :VFPAWMKYVYRKNPAQFERFAKKIFGFEGEGEELILKGIEAFK T0365 97 :NKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1vljA 332 :NWLKKVGAPVSLKDAGIPEEDIDKIVDNVMLLVE Number of specific fragments extracted= 2 number of extra gaps= 0 total=597 Number of alignments=71 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 31 :LLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTL 1vljA 289 :VFPAWMKYVYRKNPAQFERFAKKIFGFEGEGEELILKGIEAF T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1vljA 331 :KNWLKKVGAPVSLKDAGIPEEDIDKIVDNVMLLVE Number of specific fragments extracted= 2 number of extra gaps= 0 total=599 Number of alignments=72 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 33 :VPFFEATITGNWDDAVQIRKQISLAEKQGDSLK 1vljA 291 :PAWMKYVYRKNPAQFERFAKKIFGFEGEGEELI T0365 89 :LTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDA 1vljA 324 :LKGIEAFKNWLKKVGAPVSLKDAGIPEEDIDKIVDNVMLLVEK Number of specific fragments extracted= 2 number of extra gaps= 0 total=601 Number of alignments=73 # 1vljA read from 1vljA/merged-a2m # found chain 1vljA in training set T0365 21 :HMDKVYDCASLLVPFFEATI 1vljA 213 :SNEIAEGTIRTIMKMTERLI T0365 41 :TGNWDDAVQIRKQ 1vljA 235 :PDDYEARANLAWS T0365 68 :IRLTLPSGL 1vljA 248 :ATIALNGTM T0365 84 :DLLELLTQQDKIA 1vljA 266 :ACHRIEHSLSALY T0365 97 :NKAKDISGRVIGRQLLIPQALQVPFIAYLQ 1vljA 284 :AGLAIVFPAWMKYVYRKNPAQFERFAKKIF T0365 127 :RCIDAVGLAQQVINEL 1vljA 322 :LILKGIEAFKNWLKKV T0365 148 :AGFRGREVDFVAKM 1vljA 346 :AGIPEEDIDKIVDN T0365 176 :QIQLRRQLFALES 1vljA 360 :VMLLVEKNLKPKG T0365 189 :ELNPVD 1vljA 380 :VLERED T0365 198 :LYKTIE 1vljA 386 :VREILK Number of specific fragments extracted= 10 number of extra gaps= 0 total=611 Number of alignments=74 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ohuA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ohuA expands to /projects/compbio/data/pdb/1ohu.pdb.gz 1ohuA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0365 read from 1ohuA/merged-a2m # 1ohuA read from 1ohuA/merged-a2m # adding 1ohuA to template set # found chain 1ohuA in template set T0365 1 :MPVNSILGVFAKSPIKPL 1ohuA 83 :FVVDYFTHRIRQNGMEWF T0365 131 :AVGLAQQVINELDDLLEAG 1ohuA 101 :GAPGLPSGVQPEHEMMRVM T0365 150 :FRGREVDFVAKMINELDIIEEDTDDL 1ohuA 123 :FEKKHAENFETFSEQLLAVPRISFSL T0365 176 :QIQLRRQLFALESELNPVDVMFLYKT 1ohuA 184 :KMMESVELQGQVRNLFVYTSLFIKTR T0365 202 :I 1ohuA 211 :R T0365 203 :EWV 1ohuA 213 :NWK T0365 206 :GGLADLAERVGSRLELMLARV 1ohuA 219 :RSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 7 number of extra gaps= 0 total=618 Number of alignments=75 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set T0365 1 :MPVNSILG 1ohuA 71 :NDWEEPRL T0365 9 :VFAKSPIKPL 1ohuA 91 :RIRQNGMEWF T0365 131 :AVGLAQQVINELDDLLEAG 1ohuA 101 :GAPGLPSGVQPEHEMMRVM T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQL 1ohuA 123 :FEKKHAENFETFSEQLLAVPRISFSLYQDVVRTV T0365 184 :FALESELNPVDVMFLYKTI 1ohuA 192 :QGQVRNLFVYTSLFIKTRI T0365 203 :EWV 1ohuA 213 :NWK T0365 206 :GGLADLAERVGSRLELML 1ohuA 219 :RSWDDFMTLGKQMKEDYE T0365 224 :ARV 1ohuA 239 :EAE Number of specific fragments extracted= 8 number of extra gaps= 0 total=626 Number of alignments=76 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set T0365 163 :NELDIIEEDTDDLQIQLRRQLFALESELNPVD 1ohuA 111 :PEHEMMRVMGTIFEKKHAENFETFSEQLLAVP Number of specific fragments extracted= 1 number of extra gaps= 0 total=627 Number of alignments=77 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=627 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)Q19 because first residue in template chain is (1ohuA)N71 T0365 20 :EHMDKVYDCASLLVPFFEATITGNWDDAVQ 1ohuA 72 :DWEEPRLDIEGFVVDYFTHRIRQNGMEWFG T0365 50 :IRKQISLAEKQGDSLKREIRLTL 1ohuA 109 :VQPEHEMMRVMGTIFEKKHAENF T0365 74 :SGLFMPVERTD 1ohuA 132 :ETFSEQLLAVP T0365 89 :LTQQDKIANKAKDI 1ohuA 143 :RISFSLYQDVVRTV T0365 104 :GRVIGRQLLIPQALQ 1ohuA 169 :GRLIGLISFGGFVAA T0365 176 :QIQLRRQLFALESELNPVDVMFLYKTIE 1ohuA 184 :KMMESVELQGQVRNLFVYTSLFIKTRIR T0365 204 :WV 1ohuA 214 :WK T0365 206 :GGLADLAERVGSRLELMLARV 1ohuA 219 :RSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 8 number of extra gaps= 0 total=635 Number of alignments=78 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)Q19 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)D101 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 20 :EHMDKVYDCASLLVPFFEATITGNWDDAVQ 1ohuA 72 :DWEEPRLDIEGFVVDYFTHRIRQNGMEWFG T0365 50 :IRKQISLAEKQGDSLKREIRLTLPSGL 1ohuA 109 :VQPEHEMMRVMGTIFEKKHAENFETFS T0365 77 :FMPVERTDLLELLTQ 1ohuA 137 :QLLAVPRISFSLYQD T0365 93 :DKI 1ohuA 154 :RTV T0365 102 :I 1ohuA 166 :M T0365 104 :GRVIGR 1ohuA 169 :GRLIGL T0365 110 :QLLI 1ohuA 180 :FVAA T0365 182 :QLFALESELNPVDVMFLYK 1ohuA 190 :ELQGQVRNLFVYTSLFIKT T0365 201 :TI 1ohuA 210 :IR T0365 203 :EWV 1ohuA 213 :NWK T0365 206 :GGLADLAERVGSRLELMLARV 1ohuA 219 :RSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 11 number of extra gaps= 0 total=646 Number of alignments=79 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set T0365 130 :DAVGLAQQVINEL 1ohuA 144 :ISFSLYQDVVRTV Number of specific fragments extracted= 1 number of extra gaps= 0 total=647 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=647 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 1 :MPVNSILGVFAKSPIKPLQ 1ohuA 83 :FVVDYFTHRIRQNGMEWFG T0365 129 :IDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 102 :APGLPSGVQPEHEMMRVMGTIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 186 :LESELNPVDVMFLYKTI 1ohuA 194 :QVRNLFVYTSLFIKTRI T0365 203 :EWV 1ohuA 213 :NWK T0365 206 :GGLADLAERVGSRLELMLA 1ohuA 222 :DDFMTLGKQMKEDYERAEA Number of specific fragments extracted= 5 number of extra gaps= 1 total=652 Number of alignments=80 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 1 :MPVNSILGVFAKSPIKPLQ 1ohuA 83 :FVVDYFTHRIRQNGMEWFG T0365 135 :AQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 108 :GVQPEHEMMRVMGTIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 188 :S 1ohuA 188 :S T0365 189 :E 1ohuA 190 :E T0365 190 :LNPVDVMFLYKTI 1ohuA 198 :LFVYTSLFIKTRI T0365 203 :EWV 1ohuA 213 :NWK T0365 206 :GGLADLAERVGSRLELMLA 1ohuA 222 :DDFMTLGKQMKEDYERAEA Number of specific fragments extracted= 7 number of extra gaps= 1 total=659 Number of alignments=81 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 122 :IFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG Number of specific fragments extracted= 1 number of extra gaps= 0 total=660 Number of alignments=82 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set T0365 148 :AGFRGREVDFVAKMINELDIIEEDTDDLQI 1ohuA 121 :TIFEKKHAENFETFSEQLLAVPRISFSLYQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=661 Number of alignments=83 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set T0365 43 :NWDDAVQIRKQI 1ohuA 220 :SWDDFMTLGKQM Number of specific fragments extracted= 1 number of extra gaps= 0 total=662 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=662 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)D45 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)A131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)V138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 46 :DAVQIRKQISLA 1ohuA 72 :DWEEPRLDIEGF T0365 60 :QGDSLKREIRLTLPSGLFMPVERTDL 1ohuA 84 :VVDYFTHRIRQNGMEWFGAPGLPSGV T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1ohuA 113 :HEMMRVMGTIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 139 :INELDDLLEAGFRGREVDFVAKMI 1ohuA 166 :MSYGRLIGLISFGGFVAAKMMESV T0365 174 :DLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1ohuA 190 :ELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEA Number of specific fragments extracted= 5 number of extra gaps= 1 total=667 Number of alignments=84 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 1 :MPVNSILGVFAKS 1ohuA 83 :FVVDYFTHRIRQN T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEA 1ohuA 101 :GAPGLPSGVQPEHEMMRVMGTIFEK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1ohuA 126 :KHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 80 :VERTDLLELLTQQDKIAN 1ohuA 166 :MSYGRLIGLISFGGFVAA T0365 104 :GRVIGRQLL 1ohuA 184 :KMMESVELQ T0365 116 :ALQVPFIAYLQRCIDAVG 1ohuA 193 :GQVRNLFVYTSLFIKTRI T0365 152 :GREVDFVAKM 1ohuA 211 :RNNWKEHNRS T0365 172 :TD 1ohuA 221 :WD T0365 191 :NPVDVM 1ohuA 223 :DFMTLG T0365 197 :FLYKTIEW 1ohuA 230 :QMKEDYER T0365 212 :AE 1ohuA 238 :AE T0365 224 :A 1ohuA 240 :A Number of specific fragments extracted= 12 number of extra gaps= 1 total=679 Number of alignments=85 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)E187 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 Warning: unaligning (T0365)S188 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ohuA)K242 T0365 9 :VFAKS 1ohuA 72 :DWEEP T0365 14 :PIKPLQEHMDK 1ohuA 84 :VVDYFTHRIRQ T0365 25 :VYDCASLLVPFFEA 1ohuA 112 :EHEMMRVMGTIFEK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1ohuA 126 :KHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 80 :VERTDLLELLT 1ohuA 166 :MSYGRLIGLIS T0365 103 :SGRVIGRQLLIPQALQVPFIAYLQRC 1ohuA 177 :FGGFVAAKMMESVELQGQVRNLFVYT T0365 132 :VGLAQQVIN 1ohuA 203 :SLFIKTRIR T0365 147 :EA 1ohuA 216 :EH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE T0365 186 :L 1ohuA 240 :A Number of specific fragments extracted= 10 number of extra gaps= 1 total=689 Number of alignments=86 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 3 :VNS 1ohuA 76 :PRL T0365 10 :FAKSPIK 1ohuA 105 :LPSGVQP T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 112 :EHEMMRVMGTIFEKKHAENFETFSEQL T0365 61 :GDSLKREIRLTLP 1ohuA 145 :SFSLYQDVVRTVG T0365 80 :VERTDLLELLT 1ohuA 166 :MSYGRLIGLIS T0365 102 :ISGRVIGRQLL 1ohuA 177 :FGGFVAAKMME T0365 114 :PQALQVPFIAYLQRCI 1ohuA 188 :SVELQGQVRNLFVYTS T0365 133 :GLAQQVIN 1ohuA 204 :LFIKTRIR T0365 142 :LDDL 1ohuA 214 :WKEH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE T0365 188 :S 1ohuA 240 :A Number of specific fragments extracted= 11 number of extra gaps= 1 total=700 Number of alignments=87 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)A185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P192 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 136 :QQVINELDDL 1ohuA 113 :HEMMRVMGTI T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 123 :FEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 193 :VDVMFLYKTIEW 1ohuA 166 :MSYGRLIGLISF Number of specific fragments extracted= 3 number of extra gaps= 0 total=703 Number of alignments=88 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)A185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P192 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 133 :GLAQQVINELDDL 1ohuA 110 :QPEHEMMRVMGTI T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 123 :FEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 193 :VDVMFLYKTIE 1ohuA 166 :MSYGRLIGLIS Number of specific fragments extracted= 3 number of extra gaps= 0 total=706 Number of alignments=89 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 9 :VFAKSPIK 1ohuA 104 :GLPSGVQP T0365 25 :VYDCASLLVPFFEA 1ohuA 112 :EHEMMRVMGTIFEK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1ohuA 126 :KHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 80 :VERTDLLELLT 1ohuA 166 :MSYGRLIGLIS T0365 103 :SGRVIGRQLLIPQALQVPFIAYLQRC 1ohuA 177 :FGGFVAAKMMESVELQGQVRNLFVYT T0365 132 :VGLAQQVIN 1ohuA 203 :SLFIKTRIR T0365 147 :EA 1ohuA 216 :EH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 8 number of extra gaps= 0 total=714 Number of alignments=90 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 10 :FAKSPIK 1ohuA 105 :LPSGVQP T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 112 :EHEMMRVMGTIFEKKHAENFETFSEQL T0365 61 :GDSLKREIRLTLP 1ohuA 145 :SFSLYQDVVRTVG T0365 80 :VERTDLLELLT 1ohuA 166 :MSYGRLIGLIS T0365 102 :ISGRVIGRQLL 1ohuA 177 :FGGFVAAKMME T0365 114 :PQALQVPFIAYLQRCI 1ohuA 188 :SVELQGQVRNLFVYTS T0365 133 :GLAQQVIN 1ohuA 204 :LFIKTRIR T0365 142 :LDDL 1ohuA 214 :WKEH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 9 number of extra gaps= 0 total=723 Number of alignments=91 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)D45 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)A131 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)V138 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 46 :DAVQIRKQISLA 1ohuA 72 :DWEEPRLDIEGF T0365 60 :QGDSLKREIRLTLPSGLFMPVERTDL 1ohuA 84 :VVDYFTHRIRQNGMEWFGAPGLPSGV T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1ohuA 113 :HEMMRVMGTIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 139 :INELDDLLEAGFRGREVDFVAKMI 1ohuA 166 :MSYGRLIGLISFGGFVAAKMMESV T0365 174 :DLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1ohuA 190 :ELQGQVRNLFVYTSLFIKTRIRNNWKEHNRSWDDFMTLGKQMKEDYERAEA Number of specific fragments extracted= 5 number of extra gaps= 1 total=728 Number of alignments=92 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 5 :SILGVFAKS 1ohuA 87 :YFTHRIRQN T0365 15 :IKP 1ohuA 100 :FGA T0365 18 :LQEHMDKVYDCASLLVPFFEA 1ohuA 105 :LPSGVQPEHEMMRVMGTIFEK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1ohuA 126 :KHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 80 :VERTDLLELLTQQDKIA 1ohuA 166 :MSYGRLIGLISFGGFVA T0365 103 :SGRVIGRQL 1ohuA 183 :AKMMESVEL T0365 115 :QALQVPFIAYLQRCIDAVG 1ohuA 192 :QGQVRNLFVYTSLFIKTRI T0365 152 :GREVDFVAKM 1ohuA 211 :RNNWKEHNRS T0365 172 :TDD 1ohuA 221 :WDD T0365 183 :LFALES 1ohuA 224 :FMTLGK T0365 197 :FLYKTIEWVG 1ohuA 230 :QMKEDYERAE T0365 224 :A 1ohuA 240 :A Number of specific fragments extracted= 12 number of extra gaps= 1 total=740 Number of alignments=93 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 T0365 9 :VFAKS 1ohuA 72 :DWEEP T0365 14 :PIKPLQEHMDK 1ohuA 84 :VVDYFTHRIRQ T0365 25 :VYDCASLLVPFFEA 1ohuA 112 :EHEMMRVMGTIFEK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1ohuA 126 :KHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 80 :VERTDLLELL 1ohuA 166 :MSYGRLIGLI T0365 102 :ISGRVIGRQLLIPQALQVPFIAYLQR 1ohuA 176 :SFGGFVAAKMMESVELQGQVRNLFVY T0365 131 :AVGLAQQVINE 1ohuA 202 :TSLFIKTRIRN T0365 145 :LLEA 1ohuA 214 :WKEH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE T0365 224 :A 1ohuA 240 :A Number of specific fragments extracted= 10 number of extra gaps= 1 total=750 Number of alignments=94 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 Warning: unaligning (T0365)V226 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ohuA)K242 T0365 9 :VFAKSPIKP 1ohuA 72 :DWEEPRLDI T0365 18 :LQEHMDK 1ohuA 88 :FTHRIRQ T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 112 :EHEMMRVMGTIFEKKHAENFETFSEQL T0365 62 :DSLKREIRLTLP 1ohuA 146 :FSLYQDVVRTVG T0365 80 :VERTDLLELLTQQDKIANKA 1ohuA 166 :MSYGRLIGLISFGGFVAAKM T0365 109 :RQL 1ohuA 186 :MES T0365 115 :QALQVPFIAYLQRCID 1ohuA 189 :VELQGQVRNLFVYTSL T0365 134 :LAQQVIN 1ohuA 205 :FIKTRIR T0365 142 :LDDL 1ohuA 214 :WKEH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE T0365 224 :A 1ohuA 240 :A Number of specific fragments extracted= 11 number of extra gaps= 1 total=761 Number of alignments=95 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)A185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P192 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 136 :QQVINELDDL 1ohuA 113 :HEMMRVMGTI T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 123 :FEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 193 :VDVMFLYKTIEW 1ohuA 166 :MSYGRLIGLISF Number of specific fragments extracted= 3 number of extra gaps= 0 total=764 Number of alignments=96 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)A185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P192 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 134 :LAQQVINELDDL 1ohuA 111 :PEHEMMRVMGTI T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 123 :FEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 193 :VDVMFLYKTI 1ohuA 166 :MSYGRLIGLI Number of specific fragments extracted= 3 number of extra gaps= 0 total=767 Number of alignments=97 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 1 :MPVNSI 1ohuA 97 :MEWFGA T0365 8 :GVFAKSPIK 1ohuA 103 :PGLPSGVQP T0365 25 :VYDCASLLVPFFEA 1ohuA 112 :EHEMMRVMGTIFEK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1ohuA 126 :KHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 80 :VERTDLLELL 1ohuA 166 :MSYGRLIGLI T0365 102 :ISGRVIGRQLLIPQALQVPFIAYLQR 1ohuA 176 :SFGGFVAAKMMESVELQGQVRNLFVY T0365 131 :AVGLAQQVINE 1ohuA 202 :TSLFIKTRIRN T0365 145 :LLEA 1ohuA 214 :WKEH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 9 number of extra gaps= 0 total=776 Number of alignments=98 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 8 :GVFAKSPIK 1ohuA 103 :PGLPSGVQP T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 112 :EHEMMRVMGTIFEKKHAENFETFSEQL T0365 62 :DSLKREIRLTLP 1ohuA 146 :FSLYQDVVRTVG T0365 80 :VERTDLLELLTQQDKIANKA 1ohuA 166 :MSYGRLIGLISFGGFVAAKM T0365 109 :RQL 1ohuA 186 :MES T0365 115 :QALQVPFIAYLQRCID 1ohuA 189 :VELQGQVRNLFVYTSL T0365 134 :LAQQVIN 1ohuA 205 :FIKTRIR T0365 142 :LDDL 1ohuA 214 :WKEH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 9 number of extra gaps= 0 total=785 Number of alignments=99 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)Q19 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)Q126 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)G133 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)A212 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 Warning: unaligning (T0365)E213 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ohuA)K242 T0365 20 :EHMDKVYDCASLLVPFFE 1ohuA 72 :DWEEPRLDIEGFVVDYFT T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDKI 1ohuA 90 :HRIRQNGMEWFGAPGLPSGVQPEHEMMRVMGTI T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYL 1ohuA 128 :AENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 134 :LAQQVINEL 1ohuA 166 :MSYGRLIGL T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1ohuA 175 :ISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKTRIRNNWKEHN T0365 190 :LNPVDVMFLYKTIEWVGGLADL 1ohuA 219 :RSWDDFMTLGKQMKEDYERAEA Number of specific fragments extracted= 6 number of extra gaps= 1 total=791 Number of alignments=100 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)N97 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)G104 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)R225 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 Warning: unaligning (T0365)V226 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ohuA)K242 T0365 5 :SILGVF 1ohuA 72 :DWEEPR T0365 11 :AKSPIKPLQEHMDK 1ohuA 81 :EGFVVDYFTHRIRQ T0365 31 :LLVPFFEATITGNWDDAVQIRKQISL 1ohuA 95 :NGMEWFGAPGLPSGVQPEHEMMRVMG T0365 60 :QGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIA 1ohuA 121 :TIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 105 :RVIGRQLLI 1ohuA 166 :MSYGRLIGL T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLLEA 1ohuA 175 :ISFGGFVAAKMMESVELQGQVRNLFVYTSLFIKT T0365 180 :RRQLFALESELNPVDVMFLYKTIEWVGGLAD 1ohuA 209 :RIRNNWKEHNRSWDDFMTLGKQMKEDYERAE T0365 224 :A 1ohuA 240 :A Number of specific fragments extracted= 8 number of extra gaps= 1 total=799 Number of alignments=101 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)E187 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 Warning: unaligning (T0365)S188 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ohuA)K242 T0365 5 :SILGVF 1ohuA 72 :DWEEPR T0365 14 :PIKPLQEHMDK 1ohuA 84 :VVDYFTHRIRQ T0365 27 :DCASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 111 :PEHEMMRVMGTIFEKKHAENFETFSEQL T0365 63 :SLKREIRLTLP 1ohuA 147 :SLYQDVVRTVG T0365 80 :VERTDLLELLTQQDKI 1ohuA 166 :MSYGRLIGLISFGGFV T0365 103 :S 1ohuA 182 :A T0365 106 :VIGRQLLIPQALQVPFIAYLQRCID 1ohuA 183 :AKMMESVELQGQVRNLFVYTSLFIK T0365 137 :QVINELDDL 1ohuA 208 :TRIRNNWKE T0365 151 :RGREVDFVAKMINELDIIEEDTD 1ohuA 217 :HNRSWDDFMTLGKQMKEDYERAE T0365 186 :L 1ohuA 240 :A Number of specific fragments extracted= 10 number of extra gaps= 1 total=809 Number of alignments=102 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1ohuA)N71 Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 Warning: unaligning (T0365)E187 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ohuA)K242 Warning: unaligning (T0365)S188 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ohuA)K242 T0365 5 :SILGVFA 1ohuA 72 :DWEEPRL T0365 14 :PIKPLQEHM 1ohuA 79 :DIEGFVVDY T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 112 :EHEMMRVMGTIFEKKHAENFETFSEQL T0365 62 :DSLKREIRLTLP 1ohuA 146 :FSLYQDVVRTVG T0365 80 :VERTDLLELLTQQD 1ohuA 166 :MSYGRLIGLISFGG T0365 101 :DISGRVIGR 1ohuA 180 :FVAAKMMES T0365 113 :IPQALQVPFIAYLQR 1ohuA 190 :ELQGQVRNLFVYTSL T0365 134 :LAQQVIN 1ohuA 205 :FIKTRIR T0365 141 :EL 1ohuA 216 :EH T0365 152 :GREVDFVAKMINELDIIEEDTDD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAEA Number of specific fragments extracted= 10 number of extra gaps= 1 total=819 Number of alignments=103 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)A185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P192 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 141 :ELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 114 :EMMRVMGTIFEKKHAENFETFSEQLLAVPRISFSLYQDVVRTVG T0365 193 :VDVMFLYKTIEWVGGLA 1ohuA 166 :MSYGRLIGLISFGGFVA Number of specific fragments extracted= 2 number of extra gaps= 0 total=821 Number of alignments=104 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)A185 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLF 1ohuA 132 :ETFSEQLLAVPRISFSLYQDVVRTVG Number of specific fragments extracted= 1 number of extra gaps= 0 total=822 Number of alignments=105 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 2 :PVNSILGVFAKSP 1ohuA 98 :EWFGAPGLPSGVQ T0365 27 :DCASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 111 :PEHEMMRVMGTIFEKKHAENFETFSEQL T0365 63 :SLKREIRLTLP 1ohuA 147 :SLYQDVVRTVG T0365 80 :VERTDLLELLTQQDKI 1ohuA 166 :MSYGRLIGLISFGGFV T0365 103 :S 1ohuA 182 :A T0365 106 :VIGRQLLIPQALQVPFIAYLQRCID 1ohuA 183 :AKMMESVELQGQVRNLFVYTSLFIK T0365 137 :QVINELDDL 1ohuA 208 :TRIRNNWKE T0365 151 :RGREVDFVAKMINELDIIEEDTD 1ohuA 217 :HNRSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 8 number of extra gaps= 0 total=830 Number of alignments=106 # 1ohuA read from 1ohuA/merged-a2m # found chain 1ohuA in template set Warning: unaligning (T0365)S74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ohuA)P165 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ohuA)P165 T0365 11 :AKSPIKP 1ohuA 106 :PSGVQPE T0365 29 :ASLLVPFFEATITGNWDDAVQIRKQI 1ohuA 113 :HEMMRVMGTIFEKKHAENFETFSEQL T0365 62 :DSLKREIRLTLP 1ohuA 146 :FSLYQDVVRTVG T0365 80 :VERTDLLELLTQQD 1ohuA 166 :MSYGRLIGLISFGG T0365 101 :DISGRVIGR 1ohuA 180 :FVAAKMMES T0365 113 :IPQALQVPFIAYLQR 1ohuA 190 :ELQGQVRNLFVYTSL T0365 134 :LAQQVIN 1ohuA 205 :FIKTRIR T0365 141 :EL 1ohuA 216 :EH T0365 152 :GREVDFVAKMINELDIIEEDTD 1ohuA 218 :NRSWDDFMTLGKQMKEDYERAE Number of specific fragments extracted= 9 number of extra gaps= 0 total=839 Number of alignments=107 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n81A/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1n81A/merged-a2m # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set Warning: unaligning (T0365)G206 because last residue in template chain is (1n81A)P206 T0365 1 :MP 1n81A 21 :YH T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDA 1n81A 23 :YEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDP T0365 52 :KQISLAEKQGDSLKREIRLTLPSGLFMPVER 1n81A 61 :EKFNYALKDRVSIRRYVRKNQNRYNYFLIEE T0365 90 :TQQDKIANK 1n81A 92 :RVQDNIVNR T0365 107 :IGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLE 1n81A 101 :ISDRLISYCTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVD T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQI 1n81A 142 :HAREVKEKKRIMNDKKLIRMLFDTYEY T0365 178 :QLRRQLFALESELNPVDVMFLYKTIEWV 1n81A 178 :QYKDAAARISQFLIDVVDSYIIKPIPAL Number of specific fragments extracted= 7 number of extra gaps= 0 total=846 Number of alignments=108 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :MP 1n81A 21 :YH T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDD 1n81A 23 :YEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKD T0365 51 :RKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1n81A 60 :PEKFNYALKDRVSIRRYVRKNQNRYNYFLIEER T0365 91 :QQDKIANK 1n81A 93 :VQDNIVNR T0365 102 :ISGRVIGR 1n81A 101 :ISDRLISY T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLLE 1n81A 109 :CTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVD T0365 151 :RGREVDFVAKMINELDII 1n81A 142 :HAREVKEKKRIMNDKKLI T0365 181 :RQLFALESELN 1n81A 160 :RMLFDTYEYVK T0365 194 :DVMFLY 1n81A 171 :DVKFTD T0365 200 :KTIEWVGGLA 1n81A 182 :AAARISQFLI Number of specific fragments extracted= 10 number of extra gaps= 0 total=856 Number of alignments=109 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 124 :YLQRCIDAVGLAQQVINELD 1n81A 118 :YIKKIDDYLWVEQRVIEEVS Number of specific fragments extracted= 1 number of extra gaps= 0 total=857 Number of alignments=110 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 130 :DAVGLAQQVINEL 1n81A 124 :DYLWVEQRVIEEV Number of specific fragments extracted= 1 number of extra gaps= 0 total=858 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set Warning: unaligning (T0365)G206 because last residue in template chain is (1n81A)P206 T0365 1 :MP 1n81A 21 :YH T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDA 1n81A 23 :YEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDP T0365 52 :KQISLAEKQGDSLKREIRLTLPSGLFMPVER 1n81A 61 :EKFNYALKDRVSIRRYVRKNQNRYNYFLIEE T0365 90 :TQQDKIANK 1n81A 92 :RVQDNIVNR T0365 107 :IGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLE 1n81A 101 :ISDRLISYCTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVD T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQI 1n81A 142 :HAREVKEKKRIMNDKKLIRMLFDTYEY T0365 178 :QLRRQLFALESELNPVDVMFLYKTIEWV 1n81A 178 :QYKDAAARISQFLIDVVDSYIIKPIPAL Number of specific fragments extracted= 7 number of extra gaps= 0 total=865 Number of alignments=111 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :MP 1n81A 21 :YH T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDD 1n81A 23 :YEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKD T0365 51 :RKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1n81A 60 :PEKFNYALKDRVSIRRYVRKNQNRYNYFLIEER T0365 91 :QQDKIANK 1n81A 93 :VQDNIVNR T0365 102 :ISGRVIGR 1n81A 101 :ISDRLISY T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLLE 1n81A 109 :CTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVD T0365 151 :RGREVDFVAKMINELDII 1n81A 142 :HAREVKEKKRIMNDKKLI T0365 181 :RQLFALESELN 1n81A 160 :RMLFDTYEYVK T0365 194 :DVMFLY 1n81A 171 :DVKFTD T0365 200 :KTIEWVGGLA 1n81A 182 :AAARISQFLI Number of specific fragments extracted= 10 number of extra gaps= 0 total=875 Number of alignments=112 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 124 :YLQRCIDAVGLAQQVINELD 1n81A 118 :YIKKIDDYLWVEQRVIEEVS Number of specific fragments extracted= 1 number of extra gaps= 0 total=876 Number of alignments=113 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 130 :DAVGLAQQVINEL 1n81A 124 :DYLWVEQRVIEEV Number of specific fragments extracted= 1 number of extra gaps= 0 total=877 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set Warning: unaligning (T0365)G206 because last residue in template chain is (1n81A)P206 T0365 1 :MPVNSILGVFAKSPIKPLQE 1n81A 21 :YHYEHETHAPLSPRIRKVGD T0365 21 :HMDKVYDCASLLVPFFEATITGN 1n81A 42 :EFHACSDYIYLLMTLSKDPEKFN T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMP 1n81A 67 :LKDRVSIRRYVRKNQNRYNYFLIEERVQDNIVNRIS T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQ 1n81A 103 :DRLISYCTDKEVTEDYIKKIDDYLWVEQRVIEE T0365 122 :IAYLQRCIDAVGLAQQVINELDDL 1n81A 136 :VSINVDHAREVKEKKRIMNDKKLI T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWV 1n81A 160 :RMLFDTYEYVKDVKFTDDQYKDAAARISQFLIDVVDSYIIKPIPAL Number of specific fragments extracted= 6 number of extra gaps= 0 total=883 Number of alignments=114 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :MPVNSI 1n81A 21 :YHYEHE T0365 14 :PIKPLQEHMDKVYD 1n81A 27 :THAPLSPRIRKVGD T0365 36 :FEATITGNWDDAVQI 1n81A 41 :IEFHACSDYIYLLMT T0365 51 :RKQISLAEKQGDSLKREIRLT 1n81A 60 :PEKFNYALKDRVSIRRYVRKN T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIG 1n81A 81 :QNRYNYFLIEERVQDNIVNRISDRLIS T0365 111 :LLIPQALQV 1n81A 108 :YCTDKEVTE T0365 123 :AYLQRCIDAVGLAQQVINELDDLLE 1n81A 117 :DYIKKIDDYLWVEQRVIEEVSINVD T0365 151 :RGREVDFVAKMINELDIIE 1n81A 142 :HAREVKEKKRIMNDKKLIR T0365 184 :FALESELNPVDVMFLYKTIEWV 1n81A 161 :MLFDTYEYVKDVKFTDDQYKDA T0365 206 :GGLADLAE 1n81A 188 :QFLIDVVD T0365 216 :GSRLELMLARV 1n81A 196 :SYIIKPIPALP Number of specific fragments extracted= 11 number of extra gaps= 0 total=894 Number of alignments=115 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 124 :YLQRCIDAVGLAQQVINEL 1n81A 118 :YIKKIDDYLWVEQRVIEEV Number of specific fragments extracted= 1 number of extra gaps= 0 total=895 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 111 :LLIPQALQVPFIA 1n81A 87 :FLIEERVQDNIVN T0365 124 :YLQRCIDAVGLAQQVINELD 1n81A 118 :YIKKIDDYLWVEQRVIEEVS Number of specific fragments extracted= 2 number of extra gaps= 0 total=897 Number of alignments=116 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 124 :YLQRCIDAVGLAQQVINEL 1n81A 118 :YIKKIDDYLWVEQRVIEEV Number of specific fragments extracted= 1 number of extra gaps= 0 total=898 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 92 :QDKIANK 1n81A 94 :QDNIVNR T0365 102 :ISGRVIGRQL 1n81A 101 :ISDRLISYCT T0365 117 :LQVPFIAYLQRCIDAVGLAQQVINELD 1n81A 111 :DKEVTEDYIKKIDDYLWVEQRVIEEVS Number of specific fragments extracted= 3 number of extra gaps= 0 total=901 Number of alignments=117 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1n81A)Y21 T0365 9 :VFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISL 1n81A 22 :HYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDPEKFNYALKD T0365 65 :KREIRLTLPSGL 1n81A 70 :RVSIRRYVRKNQ T0365 81 :ERTDLLEL 1n81A 82 :NRYNYFLI T0365 89 :LTQQDKIANKAKDISGRVIGRQLL 1n81A 91 :ERVQDNIVNRISDRLISYCTDKEV T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 115 :TEDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKM 1n81A 147 :KEKKRIMND T0365 177 :IQLRRQLFA 1n81A 156 :KKLIRMLFD T0365 198 :LYKTIEWVGGLADLAERVGSRLELMLARV 1n81A 165 :TYEYVKDVKFTDDQYKDAAARISQFLIDV Number of specific fragments extracted= 8 number of extra gaps= 0 total=909 Number of alignments=118 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :M 1n81A 21 :Y T0365 9 :VFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISL 1n81A 22 :HYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDPEKFNYALKD T0365 65 :KREIRLTLPSG 1n81A 70 :RVSIRRYVRKN T0365 80 :VERTDLLEL 1n81A 81 :QNRYNYFLI T0365 89 :LTQQDKIANKAKDISGRVIG 1n81A 91 :ERVQDNIVNRISDRLISYCT T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 111 :DKEVTEDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKM 1n81A 147 :KEKKRIMND T0365 177 :IQLRRQLFALES 1n81A 156 :KKLIRMLFDTYE T0365 201 :TIEWVGGLADLAERVGSRLELMLAR 1n81A 168 :YVKDVKFTDDQYKDAAARISQFLID Number of specific fragments extracted= 9 number of extra gaps= 0 total=918 Number of alignments=119 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :MPVN 1n81A 21 :YHYE T0365 8 :GVFA 1n81A 25 :HETH T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1n81A 31 :LSPRIRKVGDIEFHACSDYIYLL T0365 38 :ATITGNWDDAVQIRKQ 1n81A 54 :MTLSKDPEKFNYALKD T0365 58 :EKQGDSLKREIRLT 1n81A 70 :RVSIRRYVRKNQNR T0365 74 :SGLFMPVE 1n81A 84 :YNYFLIEE T0365 90 :TQQDKIANKAKDISGRVIG 1n81A 92 :RVQDNIVNRISDRLISYCT T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 111 :DKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALESELN 1n81A 155 :DKKLIRMLFDTYEYVKDVK T0365 210 :DLAERVGSRLELMLAR 1n81A 177 :DQYKDAAARISQFLID Number of specific fragments extracted= 11 number of extra gaps= 0 total=929 Number of alignments=120 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :MPV 1n81A 21 :YHY T0365 10 :FAKS 1n81A 24 :EHET T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1n81A 31 :LSPRIRKVGDIEFHACSDYIYLL T0365 38 :ATITGNWDDAVQIR 1n81A 54 :MTLSKDPEKFNYAL T0365 81 :ERTDLLELLTQ 1n81A 69 :DRVSIRRYVRK T0365 92 :QDKIANKAKDISGRVI 1n81A 94 :QDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 164 :ELDIIEEDTDDLQ 1n81A 158 :LIRMLFDTYEYVK T0365 188 :S 1n81A 171 :D T0365 190 :LN 1n81A 172 :VK T0365 210 :DLAERVGSRLELMLAR 1n81A 177 :DQYKDAAARISQFLID Number of specific fragments extracted= 12 number of extra gaps= 0 total=941 Number of alignments=121 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 90 :TQQDKIANKAKDISGRVIGRQLL 1n81A 92 :RVQDNIVNRISDRLISYCTDKEV T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 115 :TEDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKMINELDII 1n81A 147 :KEKKRIMNDKKLIRML Number of specific fragments extracted= 3 number of extra gaps= 0 total=944 Number of alignments=122 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 90 :TQQDKIANKAKDISGRVIG 1n81A 92 :RVQDNIVNRISDRLISYCT T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 111 :DKEVTEDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKM 1n81A 147 :KEKKRIMND T0365 177 :IQLRRQLFALES 1n81A 156 :KKLIRMLFDTYE T0365 201 :TIEWVGGLADLAERVGSRLELMLAR 1n81A 168 :YVKDVKFTDDQYKDAAARISQFLID Number of specific fragments extracted= 5 number of extra gaps= 0 total=949 Number of alignments=123 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 10 :FA 1n81A 27 :TH T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1n81A 31 :LSPRIRKVGDIEFHACSDYIYLL T0365 38 :ATITGNWDDAVQIRKQ 1n81A 54 :MTLSKDPEKFNYALKD T0365 58 :EKQGDSLKREIRLT 1n81A 70 :RVSIRRYVRKNQNR T0365 74 :SGLFMPVE 1n81A 84 :YNYFLIEE T0365 90 :TQQDKIANKAKDISGRVIG 1n81A 92 :RVQDNIVNRISDRLISYCT T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 111 :DKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALESELN 1n81A 155 :DKKLIRMLFDTYEYVKDVK T0365 210 :DLAERVGSRLELMLAR 1n81A 177 :DQYKDAAARISQFLID Number of specific fragments extracted= 10 number of extra gaps= 0 total=959 Number of alignments=124 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1n81A 31 :LSPRIRKVGDIEFHACSDYIYLL T0365 38 :ATITGNWDDAVQIR 1n81A 54 :MTLSKDPEKFNYAL T0365 81 :ERTDLLELLTQ 1n81A 69 :DRVSIRRYVRK T0365 92 :QDKIANKAKDISGRVI 1n81A 94 :QDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 164 :ELDIIEEDTDDLQ 1n81A 158 :LIRMLFDTYEYVK T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 8 number of extra gaps= 0 total=967 Number of alignments=125 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 9 :VFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISL 1n81A 22 :HYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDPEKFNYALKD T0365 65 :KREIRLTLPSGL 1n81A 70 :RVSIRRYVRKNQ T0365 81 :ERTDLLEL 1n81A 82 :NRYNYFLI T0365 89 :LTQQDKIANKAKDISGRVIGRQLLI 1n81A 91 :ERVQDNIVNRISDRLISYCTDKEVT T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 116 :EDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKMI 1n81A 147 :KEKKRIMNDK T0365 178 :QLRRQLFA 1n81A 157 :KLIRMLFD T0365 198 :LYKTIEWVGGLADLAERVGSRLELMLARV 1n81A 165 :TYEYVKDVKFTDDQYKDAAARISQFLIDV Number of specific fragments extracted= 8 number of extra gaps= 0 total=975 Number of alignments=126 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 9 :VFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISL 1n81A 22 :HYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDPEKFNYALKD T0365 65 :KREIRLTLPSGL 1n81A 70 :RVSIRRYVRKNQ T0365 81 :ERTDLLEL 1n81A 82 :NRYNYFLI T0365 89 :LTQQDKIANKAKDISGRVIGRQ 1n81A 91 :ERVQDNIVNRISDRLISYCTDK T0365 112 :LIPQALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 113 :EVTEDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKM 1n81A 147 :KEKKRIMND T0365 177 :IQLRRQLFALES 1n81A 156 :KKLIRMLFDTYE T0365 191 :NPVDVMF 1n81A 168 :YVKDVKF T0365 208 :LADLAERVGSRLELMLAR 1n81A 175 :TDDQYKDAAARISQFLID Number of specific fragments extracted= 9 number of extra gaps= 0 total=984 Number of alignments=127 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :M 1n81A 21 :Y T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCASLLVPFF 1n81A 22 :HYEHETHAPLSPRIRKVGDIEFHACSDYIYLL T0365 38 :ATITGNWDDAVQIRKQ 1n81A 54 :MTLSKDPEKFNYALKD T0365 58 :EKQGDSLKREIRLT 1n81A 70 :RVSIRRYVRKNQNR T0365 75 :GLFM 1n81A 85 :NYFL T0365 80 :VER 1n81A 89 :IEE T0365 90 :TQQDKIANKAKDISGRVIG 1n81A 92 :RVQDNIVNRISDRLISYCT T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 111 :DKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMI 1n81A 143 :AREVKEKKRIM T0365 172 :TDDLQIQLRRQLFALESELN 1n81A 154 :NDKKLIRMLFDTYEYVKDVK T0365 210 :DLAERVGSRLELMLAR 1n81A 177 :DQYKDAAARISQFLID Number of specific fragments extracted= 11 number of extra gaps= 0 total=995 Number of alignments=128 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :MP 1n81A 21 :YH T0365 6 :ILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEA 1n81A 23 :YEHETHAPLSPRIRKVGDIEFHACSDYIYLLMT T0365 40 :ITGNWDDAVQIR 1n81A 56 :LSKDPEKFNYAL T0365 59 :KQGDSLKREIRLTLPS 1n81A 71 :VSIRRYVRKNQNRYNY T0365 78 :MPVERT 1n81A 87 :FLIEER T0365 91 :QQDKIANKAKDISGRVI 1n81A 93 :VQDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALESE 1n81A 156 :KKLIRMLFDTYEYVKDV T0365 210 :DLAERVGSRLELMLAR 1n81A 177 :DQYKDAAARISQFLID Number of specific fragments extracted= 10 number of extra gaps= 0 total=1005 Number of alignments=129 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 90 :TQQDKIANKAKDISGRVIGRQLLI 1n81A 92 :RVQDNIVNRISDRLISYCTDKEVT T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 116 :EDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKMINELDIIEEDTDDLQI 1n81A 147 :KEKKRIMNDKKLIRMLFDTYEYVKD Number of specific fragments extracted= 3 number of extra gaps= 0 total=1008 Number of alignments=130 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 91 :QQDKIANKAKDISGRVIGRQ 1n81A 93 :VQDNIVNRISDRLISYCTDK T0365 112 :LIPQALQVPFIAYLQRCIDAVGLAQQVINELDDL 1n81A 113 :EVTEDYIKKIDDYLWVEQRVIEEVSINVDHAREV T0365 153 :REVDFVAKM 1n81A 147 :KEKKRIMND T0365 177 :IQLRRQLFALES 1n81A 156 :KKLIRMLFDTYE T0365 201 :TIEWVGGLADLAERVGSRLELMLA 1n81A 168 :YVKDVKFTDDQYKDAAARISQFLI Number of specific fragments extracted= 5 number of extra gaps= 0 total=1013 Number of alignments=131 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 9 :VFAKSPIKPLQEHMDKVYDCASLLVPFF 1n81A 26 :ETHAPLSPRIRKVGDIEFHACSDYIYLL T0365 38 :ATITGNWDDAVQIRKQ 1n81A 54 :MTLSKDPEKFNYALKD T0365 58 :EKQGDSLKREIRLT 1n81A 70 :RVSIRRYVRKNQNR T0365 75 :GLFM 1n81A 85 :NYFL T0365 80 :VER 1n81A 89 :IEE T0365 90 :TQQDKIANKAKDISGRVIG 1n81A 92 :RVQDNIVNRISDRLISYCT T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 111 :DKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMI 1n81A 143 :AREVKEKKRIM T0365 172 :TDDLQIQLRRQLFALESELN 1n81A 154 :NDKKLIRMLFDTYEYVKDVK T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 10 number of extra gaps= 0 total=1023 Number of alignments=132 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEA 1n81A 25 :HETHAPLSPRIRKVGDIEFHACSDYIYLLMT T0365 40 :ITGNWDDAVQIR 1n81A 56 :LSKDPEKFNYAL T0365 59 :KQGDSLKREIRLTLPS 1n81A 71 :VSIRRYVRKNQNRYNY T0365 78 :MPVERT 1n81A 87 :FLIEER T0365 91 :QQDKIANKAKDISGRVI 1n81A 93 :VQDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALESE 1n81A 156 :KKLIRMLFDTYEYVKDV T0365 191 :N 1n81A 173 :K T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 10 number of extra gaps= 0 total=1033 Number of alignments=133 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1n81A)Y21 T0365 9 :VFAKSPIKPLQEHMDKV 1n81A 22 :HYEHETHAPLSPRIRKV T0365 26 :YDCASLLVPFFE 1n81A 44 :HACSDYIYLLMT T0365 40 :ITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGL 1n81A 56 :LSKDPEKFNYALKDRVSIRRYVRKNQNRYNYFLIEER T0365 91 :QQDKIANKAKDISGRVIGRQL 1n81A 93 :VQDNIVNRISDRLISYCTDKE T0365 113 :IPQALQVPFIAYLQRCIDAV 1n81A 114 :VTEDYIKKIDDYLWVEQRVI T0365 153 :REVDFVAKMINELDIIEEDTDD 1n81A 134 :EEVSINVDHAREVKEKKRIMND T0365 177 :IQLRRQLFALES 1n81A 156 :KKLIRMLFDTYE T0365 191 :NPVDVMFLY 1n81A 168 :YVKDVKFTD T0365 210 :DLAERVGSRLELMLARV 1n81A 177 :DQYKDAAARISQFLIDV Number of specific fragments extracted= 9 number of extra gaps= 0 total=1042 Number of alignments=134 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1n81A)Y21 T0365 9 :VFAKSPIKPLQEHMDKV 1n81A 22 :HYEHETHAPLSPRIRKV T0365 26 :YDCASLLVPFFE 1n81A 44 :HACSDYIYLLMT T0365 40 :ITGNWDDAVQIRKQISLAEKQGDSLKREIRL 1n81A 56 :LSKDPEKFNYALKDRVSIRRYVRKNQNRYNY T0365 85 :LLELLTQQDKIANKAKDISGRVI 1n81A 87 :FLIEERVQDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAV 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVI T0365 153 :REVDFVAKMINELDIIEEDTD 1n81A 134 :EEVSINVDHAREVKEKKRIMN T0365 176 :QIQLRRQLFALES 1n81A 155 :DKKLIRMLFDTYE T0365 191 :NPVDVMF 1n81A 168 :YVKDVKF T0365 208 :LADLAERVGSRLELMLARV 1n81A 175 :TDDQYKDAAARISQFLIDV Number of specific fragments extracted= 9 number of extra gaps= 0 total=1051 Number of alignments=135 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :M 1n81A 21 :Y T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCASLLVPFFE 1n81A 22 :HYEHETHAPLSPRIRKVGDIEFHACSDYIYLLM T0365 39 :TITGNWDDAVQIRKQISLAE 1n81A 55 :TLSKDPEKFNYALKDRVSIR T0365 63 :SLKREIRLTLPSGLF 1n81A 75 :RYVRKNQNRYNYFLI T0365 89 :LTQQDKIANKAKDISGRVI 1n81A 91 :ERVQDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :D 1n81A 155 :D T0365 177 :IQLRRQLFALE 1n81A 156 :KKLIRMLFDTY T0365 188 :SELNP 1n81A 170 :KDVKF T0365 210 :DLAERVGSRLELMLAR 1n81A 177 :DQYKDAAARISQFLID Number of specific fragments extracted= 11 number of extra gaps= 0 total=1062 Number of alignments=136 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 1 :MPVN 1n81A 21 :YHYE T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEATI 1n81A 25 :HETHAPLSPRIRKVGDIEFHACSDYIYLLMTLS T0365 42 :GNWDDAVQIR 1n81A 58 :KDPEKFNYAL T0365 53 :QISLAEK 1n81A 72 :SIRRYVR T0365 67 :EIRLTLPSGL 1n81A 79 :KNQNRYNYFL T0365 80 :VERT 1n81A 89 :IEER T0365 91 :QQDKIANKAKDISGRV 1n81A 93 :VQDNIVNRISDRLISY T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 109 :CTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALES 1n81A 156 :KKLIRMLFDTYEYVKD T0365 190 :LN 1n81A 172 :VK T0365 210 :DLAERVGSRLELMLAR 1n81A 177 :DQYKDAAARISQFLID Number of specific fragments extracted= 12 number of extra gaps= 0 total=1074 Number of alignments=137 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 90 :TQQDKIANKAKD 1n81A 92 :RVQDNIVNRISD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1075 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 90 :TQQDKIANKAKDISGRVI 1n81A 92 :RVQDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAV 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVI T0365 153 :REVDFVAKMINELDIIEEDTD 1n81A 134 :EEVSINVDHAREVKEKKRIMN T0365 176 :QIQLRRQLFALES 1n81A 155 :DKKLIRMLFDTYE T0365 191 :NPVDVMF 1n81A 168 :YVKDVKF T0365 208 :LADLAERVGSRLELML 1n81A 175 :TDDQYKDAAARISQFL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1081 Number of alignments=138 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCASLLVPFFE 1n81A 22 :HYEHETHAPLSPRIRKVGDIEFHACSDYIYLLM T0365 39 :TITGNWDDAVQIRKQISLAE 1n81A 55 :TLSKDPEKFNYALKDRVSIR T0365 63 :SLKREIRLTLPSGLF 1n81A 75 :RYVRKNQNRYNYFLI T0365 89 :LTQQDKIANKAKDISGRVI 1n81A 91 :ERVQDNIVNRISDRLISYC T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 110 :TDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :D 1n81A 155 :D T0365 177 :IQLRRQLFALE 1n81A 156 :KKLIRMLFDTY T0365 188 :SELNP 1n81A 170 :KDVKF T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 10 number of extra gaps= 0 total=1091 Number of alignments=139 # 1n81A read from 1n81A/merged-a2m # found chain 1n81A in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEATI 1n81A 25 :HETHAPLSPRIRKVGDIEFHACSDYIYLLMTLS T0365 42 :GNWDDAVQIR 1n81A 58 :KDPEKFNYAL T0365 53 :QISLAEK 1n81A 72 :SIRRYVR T0365 67 :EIRLTLPSGL 1n81A 79 :KNQNRYNYFL T0365 80 :VERT 1n81A 89 :IEER T0365 91 :QQDKIANKAKDISGRV 1n81A 93 :VQDNIVNRISDRLISY T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1n81A 109 :CTDKEVTEDYIKKIDDYLWVEQRVIEEVSINVDH T0365 152 :GREVDFVAKMIN 1n81A 143 :AREVKEKKRIMN T0365 173 :DDLQIQLRRQLFALES 1n81A 156 :KKLIRMLFDTYEYVKD T0365 190 :LN 1n81A 172 :VK T0365 210 :DLAERVGSRLELMLA 1n81A 177 :DQYKDAAARISQFLI Number of specific fragments extracted= 11 number of extra gaps= 0 total=1102 Number of alignments=140 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f6hX/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f6hX expands to /projects/compbio/data/pdb/2f6h.pdb.gz 2f6hX:# T0365 read from 2f6hX/merged-a2m # 2f6hX read from 2f6hX/merged-a2m # adding 2f6hX to template set # found chain 2f6hX in template set Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)S390 Warning: unaligning (T0365)D173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)S390 Warning: unaligning (T0365)L223 because last residue in template chain is (2f6hX)V440 T0365 1 :MPVNSILGVFAKSPIKPLQ 2f6hX 35 :EDTEILNQEITEGLLKGFE T0365 20 :EHMDKVYDCASLLVPF 2f6hX 55 :PDAGVAIQLSKRDVVY T0365 36 :FEATITGNWDDAVQIRKQISLAEKQGDSLKREI 2f6hX 87 :LTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGV T0365 69 :RLTLPSGLFMPVERTDLL 2f6hX 125 :VRELYSFVVFALNSILTE T0365 87 :ELLTQQDKIANKAKDISGRVIG 2f6hX 156 :EYVSLVTELKDDFEALSYNIYN T0365 109 :RQLLIPQALQVPFI 2f6hX 183 :LQKQLQKKAINAVV T0365 123 :AYLQRCIDAVGLAQQVINELDDL 2f6hX 304 :ECLQHLIQTAKLLQVRKYTIEDI T0365 146 :LEAGFRGREVDFVAKMINELDIIEED 2f6hX 353 :YESPIPQEILRYVADIVKKEAALSSS T0365 174 :DLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 2f6hX 391 :IFITPETGPFTDPFSLIKTRKFDQVEAYIPAWLSLPSTKRIVDLVAQQV Number of specific fragments extracted= 9 number of extra gaps= 0 total=1111 Number of alignments=141 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)P2 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)L223 because last residue in template chain is (2f6hX)V440 T0365 3 :VNSIL 2f6hX 23 :ATQIN T0365 8 :GVFAKSPIKPLQEHMDKVYD 2f6hX 47 :GLLKGFEVPDAGVAIQLSKR T0365 28 :CASL 2f6hX 78 :VLSE T0365 32 :LVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 2f6hX 83 :WRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGV T0365 69 :RLTLPSGL 2f6hX 125 :VRELYSFV T0365 77 :FMPVE 2f6hX 138 :SILTE T0365 82 :RTDLLELLTQQDKIANK 2f6hX 158 :VSLVTELKDDFEALSYN T0365 102 :ISG 2f6hX 175 :IYN T0365 105 :RV 2f6hX 189 :KK T0365 107 :IGRQLLIPQALQVPFIAYLQRCIDAVGL 2f6hX 238 :CMKSFHIENEVFHAVVTTLLNYVDAICF T0365 135 :AQQVINELDDLLEAGFRGREVDFVAK 2f6hX 283 :LNYNVTRLEEWCKTHGLTDGTECLQH T0365 161 :MINELDIIEEDTDDLQIQL 2f6hX 322 :TIEDIDILRGICYSLTPAQ T0365 180 :RRQLFAL 2f6hX 362 :LRYVADI T0365 187 :ESE 2f6hX 372 :EAA T0365 190 :LNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 2f6hX 407 :IKTRKFDQVEAYIPAWLSLPSTKRIVDLVAQQV Number of specific fragments extracted= 15 number of extra gaps= 0 total=1126 Number of alignments=142 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 43 :NWDDAVQIRKQISLAEK 2f6hX 276 :SWKRGLQLNYNVTRLEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1127 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)A159 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)E222 T0365 36 :FEATITGNWDDAVQIRKQISLAEKQGDSLKREI 2f6hX 87 :LTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGV T0365 69 :RLTLPS 2f6hX 125 :VRELYS T0365 134 :LAQQVINELDDLLEAGFRGRE 2f6hX 179 :WLKKLQKQLQKKAINAVVISE T0365 155 :VDFV 2f6hX 202 :PGFS T0365 175 :LQIQL 2f6hX 248 :VFHAV Number of specific fragments extracted= 5 number of extra gaps= 0 total=1132 Number of alignments=143 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)T90 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)E222 Warning: unaligning (T0365)A96 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 Warning: unaligning (T0365)D194 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)S390 Warning: unaligning (T0365)A224 because last residue in template chain is (2f6hX)V440 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVP 2f6hX 44 :ITEGLLKGFEVPDAGVAIQLSKRDVVYPARILII T0365 35 :FFEATITGNWDDAVQIRKQISLAEKQGDS 2f6hX 86 :GLTKQSESFLAQVLTTIQKVVTQLKGNDL T0365 64 :LKREIRLTLPSGL 2f6hX 179 :WLKKLQKQLQKKA T0365 77 :FMPVERTDLLELL 2f6hX 193 :NAVVISESLPGFS T0365 97 :NKAKDISG 2f6hX 223 :YTMDDILT T0365 105 :RVIGRQLLIPQALQVPFIAYLQRCIDAVGL 2f6hX 236 :YWCMKSFHIENEVFHAVVTTLLNYVDAICF T0365 135 :AQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDD 2f6hX 283 :LNYNVTRLEEWCKTHGLTDGTECLQHLIQTAKLLQVRKYT T0365 175 :LQIQLRRQLFAL 2f6hX 324 :EDIDILRGICYS T0365 187 :ESELNPV 2f6hX 372 :EAALSSS T0365 196 :MFLY 2f6hX 391 :IFIT T0365 200 :KTIEWVG 2f6hX 418 :YIPAWLS T0365 209 :ADLAERVGSRLELML 2f6hX 425 :LPSTKRIVDLVAQQV Number of specific fragments extracted= 12 number of extra gaps= 0 total=1144 Number of alignments=144 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)P73 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 Warning: unaligning (T0365)A96 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 Warning: unaligning (T0365)D194 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)S390 Warning: unaligning (T0365)A224 because last residue in template chain is (2f6hX)V440 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLV 2f6hX 44 :ITEGLLKGFEVPDAGVAIQLSKRDVVYPARILI T0365 34 :PFFEATITGNWDDAVQIRKQISLAEKQGDSLKR 2f6hX 85 :FGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPS T0365 67 :EIRLTL 2f6hX 127 :ELYSFV T0365 74 :SGLFMPVERTDLLELLT 2f6hX 150 :TDEEYKEYVSLVTELKD T0365 97 :NKAKDISG 2f6hX 223 :YTMDDILT T0365 105 :RVIGRQLLIPQALQVPFIAYLQRCIDAVGL 2f6hX 236 :YWCMKSFHIENEVFHAVVTTLLNYVDAICF T0365 135 :AQQVINELDDLLEAGFRGREVDFVA 2f6hX 283 :LNYNVTRLEEWCKTHGLTDGTECLQ T0365 160 :KMINELDIIEEDTDDLQIQ 2f6hX 321 :YTIEDIDILRGICYSLTPA T0365 179 :LRRQLF 2f6hX 361 :ILRYVA T0365 185 :ALESELNPV 2f6hX 370 :KKEAALSSS T0365 196 :MFLYKT 2f6hX 391 :IFITPE T0365 202 :IEWVGGL 2f6hX 417 :AYIPAWL T0365 209 :ADLAERVGSRLELML 2f6hX 425 :LPSTKRIVDLVAQQV Number of specific fragments extracted= 13 number of extra gaps= 0 total=1157 Number of alignments=145 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 43 :NWDDAVQIRKQISL 2f6hX 276 :SWKRGLQLNYNVTR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1158 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 125 :LQRCIDAVGLAQQVINELD 2f6hX 306 :LQHLIQTAKLLQVRKYTIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1159 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)E87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)E222 Warning: unaligning (T0365)I129 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 Warning: unaligning (T0365)R218 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)S390 Warning: unaligning (T0365)L219 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)S390 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFF 2f6hX 32 :RLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKRD T0365 37 :EATITGNWDDAVQIRKQISLAEKQG 2f6hX 88 :TKQSESFLAQVLTTIQKVVTQLKGN T0365 62 :DSLKREIRLTLPSGLFMPVERTDLL 2f6hX 181 :KKLQKQLQKKAINAVVISESLPGFS T0365 130 :DAVGLAQQVINELDDLLEAGF 2f6hX 223 :YTMDDILTFFNSIYWCMKSFH T0365 151 :RGREVDF 2f6hX 279 :RGLQLNY T0365 158 :VAKMINELDIIEEDTDDLQIQ 2f6hX 319 :RKYTIEDIDILRGICYSLTPA T0365 182 :QLFALESELNP 2f6hX 340 :QLQKLISQYQV T0365 194 :DVMFLYKTIEWVGGLADLAER 2f6hX 351 :ADYESPIPQEILRYVADIVKK T0365 215 :VGS 2f6hX 376 :SSS T0365 220 :ELMLARV 2f6hX 391 :IFITPET Number of specific fragments extracted= 10 number of extra gaps= 0 total=1169 Number of alignments=146 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)T71 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)M149 Warning: unaligning (T0365)I122 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)E222 Warning: unaligning (T0365)I129 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 Warning: unaligning (T0365)R218 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)S390 Warning: unaligning (T0365)L219 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)S390 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVP 2f6hX 32 :RLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSK T0365 35 :FFEATITGNWDDAVQIRKQISLAEKQGD 2f6hX 86 :GLTKQSESFLAQVLTTIQKVVTQLKGND T0365 64 :LKREIRL 2f6hX 132 :VVFALNS T0365 76 :LFMPVERTDLLELLTQQDKIAN 2f6hX 152 :EEYKEYVSLVTELKDDFEALSY T0365 98 :KAKDISGRVIGRQLLIPQALQVPF 2f6hX 182 :KLQKQLQKKAINAVVISESLPGFS T0365 130 :DAVG 2f6hX 223 :YTMD T0365 134 :LAQQVINELDD 2f6hX 248 :VFHAVVTTLLN T0365 145 :LLEAGFRGREV 2f6hX 289 :RLEEWCKTHGL T0365 156 :DF 2f6hX 304 :EC T0365 158 :VAKMINELDIIEEDTDDLQIQ 2f6hX 319 :RKYTIEDIDILRGICYSLTPA T0365 182 :QLFALESELNP 2f6hX 340 :QLQKLISQYQV T0365 194 :DVMFLYKTIEWVGGLADLAER 2f6hX 351 :ADYESPIPQEILRYVADIVKK T0365 216 :GS 2f6hX 377 :SS T0365 220 :ELMLAR 2f6hX 391 :IFITPE T0365 226 :V 2f6hX 431 :I Number of specific fragments extracted= 15 number of extra gaps= 0 total=1184 Number of alignments=147 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 43 :NWDDAVQIRKQISLAEK 2f6hX 276 :SWKRGLQLNYNVTRLEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1185 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1185 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)E189 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 T0365 190 :LNPVDVMFLYKTIEWV 2f6hX 223 :YTMDDILTFFNSIYWC Number of specific fragments extracted= 1 number of extra gaps= 0 total=1186 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1186 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)D46 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)S188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)M149 Warning: unaligning (T0365)V193 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELL 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSK T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMIN 2f6hX 66 :RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELYSFVV T0365 178 :QLRRQLFALE 2f6hX 134 :FALNSILTEE T0365 194 :DVMFLYKTIEWVGGLADLAERVGSRLELMLAR 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIYNIWLK T0365 226 :V 2f6hX 183 :L Number of specific fragments extracted= 5 number of extra gaps= 0 total=1191 Number of alignments=148 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)W44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 2 :PVNSILGVFAKS 2f6hX 80 :SEMWRFGLTKQS T0365 14 :PIKPLQEHMDKVYDCAS 2f6hX 94 :FLAQVLTTIQKVVTQLK T0365 31 :LLVPFFEATI 2f6hX 127 :ELYSFVVFAL T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDL 2f6hX 152 :EEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQKQLQKKAI T0365 92 :QDKIANKAKDISGRVIGRQLL 2f6hX 225 :MDDILTFFNSIYWCMKSFHIE T0365 122 :IAYLQRCIDAVGLAQQVINELDDLLEAGFR 2f6hX 246 :NEVFHAVVTTLLNYVDAICFNELIMKRNFL T0365 154 :EVDFVAKMINELDIIEEDTDDLQ 2f6hX 276 :SWKRGLQLNYNVTRLEEWCKTHG T0365 177 :IQLRRQLFALESEL 2f6hX 303 :TECLQHLIQTAKLL T0365 191 :NPVDVMFLYKTIE 2f6hX 337 :TPAQLQKLISQYQ T0365 208 :LADLAERVGSRLELMLAR 2f6hX 350 :VADYESPIPQEILRYVAD Number of specific fragments extracted= 10 number of extra gaps= 0 total=1201 Number of alignments=149 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)N43 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)I113 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPV 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPD T0365 81 :ERTDL 2f6hX 64 :SKRDV T0365 86 :LELLTQQDKIAN 2f6hX 96 :AQVLTTIQKVVT T0365 98 :KAKDISGRVIGR 2f6hX 114 :LIPSGVFWLANV T0365 114 :PQ 2f6hX 150 :TD T0365 116 :ALQVPFIAYLQRCID 2f6hX 156 :EYVSLVTELKDDFEA T0365 131 :AVGLAQQVINELDDLLEA 2f6hX 172 :SYNIYNIWLKKLQKQLQK T0365 149 :GFR 2f6hX 203 :GFS T0365 154 :EVDFVAKMINELDII 2f6hX 224 :TMDDILTFFNSIYWC T0365 169 :EEDTDDLQIQL 2f6hX 245 :ENEVFHAVVTT T0365 180 :RRQLFALESELNPVDVMFLYKTIEWVGG 2f6hX 265 :FNELIMKRNFLSWKRGLQLNYNVTRLEE T0365 209 :ADLAERVGSRLELMLAR 2f6hX 303 :TECLQHLIQTAKLLQVR Number of specific fragments extracted= 12 number of extra gaps= 0 total=1213 Number of alignments=150 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 1 :MPVN 2f6hX 22 :NATQ T0365 6 :ILGVFAKS 2f6hX 48 :LLKGFEVP T0365 16 :KP 2f6hX 89 :KQ T0365 18 :LQEHMDKVYDCAS 2f6hX 95 :LAQVLTTIQKVVT T0365 31 :LLVPFFEATIT 2f6hX 127 :ELYSFVVFALN T0365 43 :NWDDAVQIRKQISLAEKQGDSLK 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALS T0365 66 :REIRLTLPS 2f6hX 189 :KKAINAVVI T0365 80 :VERTDLLELLTQQDKIANKA 2f6hX 223 :YTMDDILTFFNSIYWCMKSF T0365 100 :KDISGRVIGRQL 2f6hX 246 :NEVFHAVVTTLL T0365 119 :VPFIA 2f6hX 258 :NYVDA T0365 124 :YLQRCI 2f6hX 264 :CFNELI T0365 130 :DAVGLAQQVINELDDLLEAG 2f6hX 278 :KRGLQLNYNVTRLEEWCKTH T0365 150 :FRG 2f6hX 299 :LTD T0365 155 :VDFVAKMINELDII 2f6hX 302 :GTECLQHLIQTAKL T0365 180 :RRQLFALESELNPVDVMFLY 2f6hX 326 :IDILRGICYSLTPAQLQKLI T0365 200 :KTIEWVGGLAD 2f6hX 360 :EILRYVADIVK T0365 211 :LAE 2f6hX 427 :STK T0365 218 :RLELMLAR 2f6hX 430 :RIVDLVAQ Number of specific fragments extracted= 18 number of extra gaps= 0 total=1231 Number of alignments=151 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 92 :QDKIANKAKDISGRVIGRQLL 2f6hX 225 :MDDILTFFNSIYWCMKSFHIE T0365 122 :IAYLQRCIDAVGLAQQVINELDDLLEAGF 2f6hX 246 :NEVFHAVVTTLLNYVDAICFNELIMKRNF T0365 153 :REVDFVAKMINELDIIEEDT 2f6hX 275 :LSWKRGLQLNYNVTRLEEWC Number of specific fragments extracted= 3 number of extra gaps= 0 total=1234 Number of alignments=152 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 91 :QQDKIANKAKDISGRVIGRQL 2f6hX 224 :TMDDILTFFNSIYWCMKSFHI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1235 Number of alignments=153 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)R153 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPV 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPD T0365 81 :ERT 2f6hX 64 :SKR T0365 97 :NKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQ 2f6hX 67 :DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVT T0365 138 :VINELDDLLEAG 2f6hX 132 :VVFALNSILTEE T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRR 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIYN T0365 196 :MFLYKTIEWVGGLA 2f6hX 178 :IWLKKLQKQLQKKA Number of specific fragments extracted= 6 number of extra gaps= 0 total=1241 Number of alignments=154 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)N43 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)R153 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 44 :WDDA 2f6hX 23 :ATQI T0365 51 :RKQISLAEKQGDSLKREIRLTLPSGLFMP 2f6hX 27 :NEELYRLLEDTEILNQEITEGLLKGFEVP T0365 80 :VERTDL 2f6hX 63 :LSKRDV T0365 86 :LELLTQQ 2f6hX 92 :ESFLAQV T0365 96 :ANKAKDISG 2f6hX 99 :LTTIQKVVT T0365 110 :QLL 2f6hX 108 :QLK T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDD 2f6hX 111 :GNDLIPSGVFWLANVRELYSFVVFALNSILT T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQ 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIYNI T0365 197 :FLYKTIEWVGGLA 2f6hX 179 :WLKKLQKQLQKKA Number of specific fragments extracted= 9 number of extra gaps= 0 total=1250 Number of alignments=155 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)D46 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)S188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)M149 Warning: unaligning (T0365)V193 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDL 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAI T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMI 2f6hX 66 :RDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELYSFV T0365 177 :IQLRRQLFALE 2f6hX 133 :VFALNSILTEE T0365 194 :DVMFLYKTIEWVGGLADLAERVGSRLELMLAR 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIYNIWLK Number of specific fragments extracted= 4 number of extra gaps= 0 total=1254 Number of alignments=156 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)W44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 Warning: unaligning (T0365)L89 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 T0365 1 :M 2f6hX 82 :M T0365 5 :SILGVFAKS 2f6hX 83 :WRFGLTKQS T0365 14 :PIKPLQEHMDKVYDCAS 2f6hX 94 :FLAQVLTTIQKVVTQLK T0365 31 :LLVPFFEATI 2f6hX 127 :ELYSFVVFAL T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 2f6hX 152 :EEYKEYVSLVTELKDDFEALSYNIYNIWLKKLQKQLQKK T0365 90 :TQQDKIANKAKDISGRVIGRQL 2f6hX 223 :YTMDDILTFFNSIYWCMKSFHI T0365 115 :QA 2f6hX 245 :EN T0365 123 :AYLQRCIDAVGLAQQVINELDDLLEAGFRG 2f6hX 247 :EVFHAVVTTLLNYVDAICFNELIMKRNFLS T0365 155 :VDFVAKMINELDIIEE 2f6hX 277 :WKRGLQLNYNVTRLEE T0365 171 :DTDDLQIQLRRQLFA 2f6hX 304 :ECLQHLIQTAKLLQV T0365 188 :SELNPVDVMFLYKTIEWV 2f6hX 319 :RKYTIEDIDILRGICYSL T0365 206 :G 2f6hX 342 :Q T0365 207 :GLADLAERVGSRLELMLAR 2f6hX 349 :QVADYESPIPQEILRYVAD Number of specific fragments extracted= 13 number of extra gaps= 0 total=1267 Number of alignments=157 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)N43 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)G152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPDA T0365 82 :RT 2f6hX 66 :RD T0365 84 :DLLELLTQQDKIAN 2f6hX 94 :FLAQVLTTIQKVVT T0365 98 :KAKDISGRVI 2f6hX 114 :LIPSGVFWLA T0365 108 :GR 2f6hX 128 :LY T0365 114 :PQALQVPFIAYLQRCIDA 2f6hX 161 :VTELKDDFEALSYNIYNI T0365 134 :LAQQVINELDD 2f6hX 179 :WLKKLQKQLQK T0365 148 :AGFR 2f6hX 202 :PGFS T0365 153 :REVDFVAKMINELDII 2f6hX 223 :YTMDDILTFFNSIYWC T0365 169 :EEDTDDLQIQL 2f6hX 245 :ENEVFHAVVTT T0365 180 :RRQLFALESELNPVDVMFLYKTIEWVGG 2f6hX 265 :FNELIMKRNFLSWKRGLQLNYNVTRLEE T0365 208 :LADLAERVG 2f6hX 305 :CLQHLIQTA Number of specific fragments extracted= 12 number of extra gaps= 0 total=1279 Number of alignments=158 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)P2 because first residue in template chain is (2f6hX)N22 T0365 3 :VN 2f6hX 23 :AT T0365 6 :ILGVFA 2f6hX 48 :LLKGFE T0365 16 :KP 2f6hX 89 :KQ T0365 18 :LQEHMDKVYDCAS 2f6hX 95 :LAQVLTTIQKVVT T0365 31 :LLVPFFEATIT 2f6hX 127 :ELYSFVVFALN T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREI 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNI T0365 69 :RLTLPSGLFMP 2f6hX 192 :INAVVISESLP T0365 80 :VERTDLLELLTQQDKIANKA 2f6hX 223 :YTMDDILTFFNSIYWCMKSF T0365 100 :KDISGRVIGR 2f6hX 246 :NEVFHAVVTT T0365 117 :LQVPFIA 2f6hX 256 :LLNYVDA T0365 124 :YLQRCI 2f6hX 264 :CFNELI T0365 130 :DAVGLAQQVINELDDLLEA 2f6hX 278 :KRGLQLNYNVTRLEEWCKT T0365 149 :GFRG 2f6hX 298 :GLTD T0365 156 :DFVAKMINELDII 2f6hX 303 :TECLQHLIQTAKL T0365 177 :IQLRRQLFALESELNPVDVMFLYK 2f6hX 323 :IEDIDILRGICYSLTPAQLQKLIS T0365 201 :TIEWVGGLAD 2f6hX 361 :ILRYVADIVK T0365 211 :LA 2f6hX 427 :ST T0365 217 :SRLELMLAR 2f6hX 429 :KRIVDLVAQ Number of specific fragments extracted= 18 number of extra gaps= 0 total=1297 Number of alignments=159 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)D46 because first residue in template chain is (2f6hX)N22 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPV 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1298 Number of alignments=160 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 91 :QQDKIANKAKDISGRVIGRQL 2f6hX 224 :TMDDILTFFNSIYWCMKSFHI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1299 Number of alignments=161 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)R153 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPDA T0365 82 :RT 2f6hX 66 :RD T0365 86 :LELLTQQDKIANKAKDIS 2f6hX 89 :KQSESFLAQVLTTIQKVV T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVIN 2f6hX 107 :TQLKGNDLIPSGVFWLANVRELYSFVVFALN T0365 144 :DLLE 2f6hX 138 :SILT T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRR 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIYN T0365 196 :MFLYKTIEWVGGL 2f6hX 178 :IWLKKLQKQLQKK Number of specific fragments extracted= 7 number of extra gaps= 0 total=1306 Number of alignments=162 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)R153 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 Warning: unaligning (T0365)E189 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 T0365 44 :WD 2f6hX 23 :AT T0365 49 :QIRKQISLAEKQGDSLKREIRLTLPSGLFMP 2f6hX 25 :QINEELYRLLEDTEILNQEITEGLLKGFEVP T0365 80 :VERTDL 2f6hX 63 :LSKRDV T0365 87 :ELLTQQDKIANKA 2f6hX 70 :YPARILIIVLSEM T0365 100 :KDISGRVIGR 2f6hX 92 :ESFLAQVLTT T0365 110 :QLLI 2f6hX 108 :QLKG T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 2f6hX 112 :NDLIPSGVFWLANVRELYSFVVFALNSILT T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLR 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIY T0365 181 :RQLFAL 2f6hX 181 :KKLQKQ T0365 190 :LNPVD 2f6hX 223 :YTMDD T0365 198 :LYKTIEWVGGLADLA 2f6hX 228 :ILTFFNSIYWCMKSF T0365 213 :ERVGSRLELML 2f6hX 246 :NEVFHAVVTTL Number of specific fragments extracted= 12 number of extra gaps= 0 total=1318 Number of alignments=163 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)D46 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)S188 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)M149 Warning: unaligning (T0365)V193 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 47 :AVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLT 2f6hX 23 :ATQINEELYRLLEDTEILNQEITEGLLKGFEVPDAGVAIQLSKR T0365 97 :NKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMI 2f6hX 67 :DVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTTIQKVVTQLKGNDLIPSGVFWLANVRELYSFV T0365 177 :IQLRRQLFALE 2f6hX 133 :VFALNSILTEE T0365 194 :DVMFLYKTIEWVGGLADLAERVGSRLELMLARV 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIYNIWLKK Number of specific fragments extracted= 4 number of extra gaps= 0 total=1322 Number of alignments=164 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)D144 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)E222 Warning: unaligning (T0365)K160 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)E222 T0365 1 :M 2f6hX 22 :N T0365 2 :PVNSILGVFAKSPIKPLQE 2f6hX 32 :RLLEDTEILNQEITEGLLK T0365 21 :HMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 2f6hX 65 :KRDVVYPARILIIVLSEMWRFGLTKQSESFLAQVLTT T0365 65 :KREIRLTLPSGLFMPVE 2f6hX 102 :IQKVVTQLKGNDLIPSG T0365 82 :RTDLLELLTQQDKIA 2f6hX 126 :RELYSFVVFALNSIL T0365 98 :KAKDISGRVIGR 2f6hX 154 :YKEYVSLVTELK T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 2f6hX 172 :SYNIYNIWLKKLQKQLQKKAINAVVISESLPGFS T0365 161 :MINE 2f6hX 223 :YTMD T0365 165 :LDIIEEDTDDLQIQLR 2f6hX 241 :SFHIENEVFHAVVTTL T0365 181 :RQLFALESELNPVDVMFLYKTIEWVGG 2f6hX 266 :NELIMKRNFLSWKRGLQLNYNVTRLEE T0365 208 :LADLAERVGSRLEL 2f6hX 299 :LTDGTECLQHLIQT Number of specific fragments extracted= 11 number of extra gaps= 0 total=1333 Number of alignments=165 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)I6 because first residue in template chain is (2f6hX)N22 Warning: unaligning (T0365)V80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 Warning: unaligning (T0365)G152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2f6hX)E222 T0365 7 :LGVFAKSPIKPLQ 2f6hX 23 :ATQINEELYRLLE T0365 20 :EHMDKVYD 2f6hX 39 :ILNQEITE T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQISLA 2f6hX 72 :ARILIIVLSEMWRFGLTKQSESFLAQVLTT T0365 65 :KREIRLTLPSG 2f6hX 102 :IQKVVTQLKGN T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVI 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIY T0365 122 :IAYLQRCIDAV 2f6hX 177 :NIWLKKLQKQL T0365 133 :GLAQQVI 2f6hX 189 :KKAINAV T0365 148 :AGFR 2f6hX 202 :PGFS T0365 155 :VDFVAKMINEL 2f6hX 225 :MDDILTFFNSI T0365 169 :EEDTDDLQI 2f6hX 245 :ENEVFHAVV T0365 180 :RRQLFALESELNPVDVMFLYKTIEWVGGLA 2f6hX 265 :FNELIMKRNFLSWKRGLQLNYNVTRLEEWC Number of specific fragments extracted= 11 number of extra gaps= 0 total=1344 Number of alignments=166 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)G42 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 1 :MPVN 2f6hX 22 :NATQ T0365 14 :PIKPLQEHMDKVYD 2f6hX 87 :LTKQSESFLAQVLT T0365 28 :CAS 2f6hX 105 :VVT T0365 31 :LLVPFFEATIT 2f6hX 127 :ELYSFVVFALN T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLT 2f6hX 150 :TDEEYKEYVSLVTELKDDFEALSYNIYNI T0365 73 :PSG 2f6hX 196 :VIS T0365 80 :VERTDLLELLTQQDK 2f6hX 223 :YTMDDILTFFNSIYW T0365 95 :IANKAKDIS 2f6hX 256 :LLNYVDAIC T0365 104 :GRVIGRQLLIPQALQVPFIAYLQRCIDAVGL 2f6hX 266 :NELIMKRNFLSWKRGLQLNYNVTRLEEWCKT T0365 137 :QVINELDDLLEAGF 2f6hX 307 :QHLIQTAKLLQVRK T0365 153 :REVDFV 2f6hX 321 :YTIEDI T0365 181 :RQLFALESELNPVDVMFLYK 2f6hX 327 :DILRGICYSLTPAQLQKLIS T0365 201 :TIEWVGGLAD 2f6hX 361 :ILRYVADIVK T0365 211 :LAERVGSRLELML 2f6hX 427 :STKRIVDLVAQQV Number of specific fragments extracted= 14 number of extra gaps= 0 total=1358 Number of alignments=167 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set T0365 91 :QQDKIANKAKDISGRVIGRQLL 2f6hX 224 :TMDDILTFFNSIYWCMKSFHIE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1359 Number of alignments=168 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1359 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)F150 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMP 2f6hX 24 :TQINEELYRLLEDTEILNQEITEGLLKGFEVP T0365 80 :VERTDLLELLTQQ 2f6hX 63 :LSKRDVVYPARIL T0365 102 :ISGRVIGRQLLIPQALQVPFIAYLQRCIDAVG 2f6hX 76 :IIVLSEMWRFGLTKQSESFLAQVLTTIQKVVT T0365 135 :AQQVINELDDLLEA 2f6hX 129 :YSFVVFALNSILTE T0365 151 :RGREVDFVAKMINELDI 2f6hX 150 :TDEEYKEYVSLVTELKD T0365 171 :DTDDLQIQLR 2f6hX 167 :DFEALSYNIY T0365 195 :VMFLYKTIEWVGGLA 2f6hX 177 :NIWLKKLQKQLQKKA Number of specific fragments extracted= 7 number of extra gaps= 0 total=1366 Number of alignments=169 # 2f6hX read from 2f6hX/merged-a2m # found chain 2f6hX in template set Warning: unaligning (T0365)F10 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2f6hX)M149 T0365 11 :AKSPIKPLQEHMDKVYDCAS 2f6hX 150 :TDEEYKEYVSLVTELKDDFE T0365 31 :LLVPFFEAT 2f6hX 171 :LSYNIYNIW T0365 47 :AVQIRKQISLA 2f6hX 180 :LKKLQKQLQKK T0365 68 :IRLTLPSG 2f6hX 191 :AINAVVIS T0365 80 :VERTDLLELLTQQDK 2f6hX 223 :YTMDDILTFFNSIYW T0365 95 :IANKAKDIS 2f6hX 256 :LLNYVDAIC T0365 104 :GRVIGRQLLIPQALQVPFIAYLQRCIDAVGL 2f6hX 266 :NELIMKRNFLSWKRGLQLNYNVTRLEEWCKT T0365 137 :QVINELDDLLEAGFR 2f6hX 307 :QHLIQTAKLLQVRKY T0365 154 :EVDFV 2f6hX 322 :TIEDI T0365 181 :RQLFALESELNPVDVMFLYK 2f6hX 327 :DILRGICYSLTPAQLQKLIS T0365 201 :TIEWVGGLADLAER 2f6hX 361 :ILRYVADIVKKEAA Number of specific fragments extracted= 11 number of extra gaps= 0 total=1377 Number of alignments=170 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vctA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1vctA/merged-a2m # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)E220 because last residue in template chain is (1vctA)G201 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLEL T0365 49 :QIR 1vctA 51 :EER T0365 53 :QISL 1vctA 54 :IDLL T0365 61 :GDSLKREIRLTLPS 1vctA 58 :NYQLMMHSVLAARN T0365 75 :GLFMPV 1vctA 74 :EAEQVI T0365 84 :DLLELLTQQDKIANKAKDI 1vctA 80 :TILQIANAIEDISNAAGDL T0365 104 :GRVIGRQLLIPQALQVP 1vctA 99 :AKMVLEGVELHPVIKET T0365 145 :LLEAGFRGREV 1vctA 116 :ILEGEEIIGKI T0365 156 :DFVAKMINELDIIEE 1vctA 133 :VIVGKTLGELDLATN T0365 171 :DTDDLQIQLRRQLFAL 1vctA 149 :GVWIIAVRRGKRWIFG T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 168 :NFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 11 number of extra gaps= 0 total=1388 Number of alignments=171 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)E220 because last residue in template chain is (1vctA)G201 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDD 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLE T0365 47 :AVQI 1vctA 60 :QLMM T0365 84 :DLLELLTQQDKIANKAKDI 1vctA 80 :TILQIANAIEDISNAAGDL T0365 104 :GRVIGRQLLIPQALQVP 1vctA 99 :AKMVLEGVELHPVIKET T0365 145 :LLEAGFRGREV 1vctA 116 :ILEGEEIIGKI T0365 156 :DFVAKMINELD 1vctA 133 :VIVGKTLGELD T0365 168 :IEEDTDDLQIQLRRQ 1vctA 144 :LATNTGVWIIAVRRG T0365 183 :LF 1vctA 161 :WI T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 166 :NENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1397 Number of alignments=172 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 84 :DLLELLTQQDKIANKAKDI 1vctA 80 :TILQIANAIEDISNAAGDL T0365 104 :GRVIGRQLLIPQALQV 1vctA 99 :AKMVLEGVELHPVIKE Number of specific fragments extracted= 2 number of extra gaps= 0 total=1399 Number of alignments=173 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 84 :DLLELLTQQDKIANKAKDI 1vctA 80 :TILQIANAIEDISNAAGDL T0365 104 :GRVIGRQLLIPQALQVPFI 1vctA 99 :AKMVLEGVELHPVIKETIL Number of specific fragments extracted= 2 number of extra gaps= 0 total=1401 Number of alignments=174 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)E220 because last residue in template chain is (1vctA)G201 T0365 1 :M 1vctA 92 :S T0365 2 :PVNSILGVFAKSPIKP 1vctA 94 :AAGDLAKMVLEGVELH T0365 138 :VINELDDL 1vctA 110 :PVIKETIL T0365 147 :EAGFRGREV 1vctA 118 :EGEEIIGKI T0365 156 :DFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1vctA 133 :VIVGKTLGELDLATNTGVWIIAVRRGKRWIF T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 168 :NFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 6 number of extra gaps= 0 total=1407 Number of alignments=175 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)E220 because last residue in template chain is (1vctA)G201 T0365 3 :V 1vctA 11 :P T0365 12 :KSPIKPLQEHM 1vctA 12 :KSVKEIFIEMK T0365 23 :DKVYDCASLLVP 1vctA 69 :ARNVKEAEQVIT T0365 140 :NELDDL 1vctA 112 :IKETIL T0365 147 :EAGFRGREV 1vctA 118 :EGEEIIGKI T0365 156 :DFVAKMINELDIIEEDT 1vctA 133 :VIVGKTLGELDLATNTG T0365 174 :DLQIQLRR 1vctA 150 :VWIIAVRR T0365 182 :QL 1vctA 160 :RW T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 165 :PNENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1416 Number of alignments=176 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 52 :KQISLAEKQGDSLKREIRLTLPSGL 1vctA 13 :SVKEIFIEMKDTVELMVDLAYASLL T0365 78 :MPVERTDLLELLTQ 1vctA 38 :FGDKEIAEEVLELE T0365 93 :D 1vctA 52 :E T0365 95 :IAN 1vctA 53 :RID T0365 99 :AKDISGRVIGRQLLIP 1vctA 94 :AAGDLAKMVLEGVELH T0365 207 :GLADLAER 1vctA 110 :PVIKETIL T0365 216 :GSRLELMLARV 1vctA 118 :EGEEIIGKIQV Number of specific fragments extracted= 7 number of extra gaps= 0 total=1423 Number of alignments=177 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 53 :QISLAEKQGDSLKREIRLTLPSGL 1vctA 14 :VKEIFIEMKDTVELMVDLAYASLL T0365 78 :MPVERTDLLELLTQ 1vctA 38 :FGDKEIAEEVLELE T0365 93 :D 1vctA 52 :E T0365 95 :IAN 1vctA 53 :RID T0365 99 :AKDISGRVIGRQLLIP 1vctA 94 :AAGDLAKMVLEGVELH T0365 207 :GLADLAER 1vctA 110 :PVIKETIL T0365 216 :GSRL 1vctA 118 :EGEE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1430 Number of alignments=178 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFF 1vctA 67 :LAARNVKEAEQVITILQIANAIEDISNAAGDLAKMV T0365 146 :LEAGFRGREVDFV 1vctA 103 :LEGVELHPVIKET T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFALES 1vctA 116 :ILEGEEIIGKIQVYPESVIVGKTLGELDL T0365 189 :ELNPVDVMFLYKTIEWVG 1vctA 146 :TNTGVWIIAVRRGKRWIF T0365 207 :GLADLAERVGSRLELM 1vctA 165 :PNENFKIRAGDVLIGR T0365 223 :LARV 1vctA 186 :IDHL Number of specific fragments extracted= 6 number of extra gaps= 0 total=1436 Number of alignments=179 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)L223 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLL T0365 140 :NELDDLLEAGFRG 1vctA 109 :HPVIKETILEGEE T0365 153 :REV 1vctA 124 :GKI T0365 156 :DFVAKMINELDIIEE 1vctA 133 :VIVGKTLGELDLATN T0365 171 :DTDDLQIQLRRQLFA 1vctA 149 :GVWIIAVRRGKRWIF T0365 186 :LESELNPVDVMFLYKTIE 1vctA 167 :ENFKIRAGDVLIGRGTRT T0365 207 :GLADLAERVGSRLELM 1vctA 185 :SIDHLKEIARGAIRVI Number of specific fragments extracted= 7 number of extra gaps= 0 total=1443 Number of alignments=180 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 135 :AQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1vctA 14 :VKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMVLE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1444 Number of alignments=181 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 135 :AQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADL 1vctA 14 :VKEIFIEMKDTVELMVDLAYASLLFGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQVITILQIANAIED Number of specific fragments extracted= 1 number of extra gaps= 0 total=1445 Number of alignments=182 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 94 :KIANKAKDIS 1vctA 83 :QIANAIEDIS Number of specific fragments extracted= 1 number of extra gaps= 0 total=1446 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1446 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)A224 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 108 :GRQLL 1vctA 105 :GVELH T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDL 1vctA 110 :PVIKETILEGEEIIGKIQVYPESVIVGKTL T0365 153 :REVDFVAKMINELDII 1vctA 140 :GELDLATNTGVWIIAV T0365 177 :IQLRRQLFALES 1vctA 156 :RRGKRWIFGPNE T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1vctA 168 :NFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1455 Number of alignments=183 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)A224 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAARNVKE T0365 84 :DLLELLTQQDKIANKAKDISGRV 1vctA 80 :TILQIANAIEDISNAAGDLAKMV T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVI 1vctA 103 :LEGVELHPVIKETILEGEEIIGKIQVYPESVI T0365 141 :ELDDL 1vctA 135 :VGKTL T0365 153 :REVDFVAKMINELD 1vctA 140 :GELDLATNTGVWII T0365 175 :LQIQLRRQLFALESELNPVDVM 1vctA 154 :AVRRGKRWIFGPNENFKIRAGD T0365 199 :YKTIEWVGGLADLAERVGSRLELML 1vctA 176 :VLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1464 Number of alignments=184 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)R225 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMH T0365 81 :ERT 1vctA 72 :VKE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIA 1vctA 104 :EGVELHPVIKETILE T0365 147 :EAGFRGREVDFV 1vctA 131 :ESVIVGKTLGEL T0365 160 :KMINEL 1vctA 143 :DLATNT T0365 186 :LESE 1vctA 166 :NENF T0365 191 :NPVDVMFLYKTIE 1vctA 182 :TRTSIDHLKEIAR T0365 224 :A 1vctA 200 :I Number of specific fragments extracted= 11 number of extra gaps= 0 total=1475 Number of alignments=185 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 T0365 10 :FAKS 1vctA 10 :EPKS T0365 19 :QEHMDKVYDCASLLVPFFEATI 1vctA 15 :KEIFIEMKDTVELMVDLAYASL T0365 41 :TGN 1vctA 38 :FGD T0365 48 :VQIRKQISLAEKQGDSLKREIRLT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMH T0365 83 :T 1vctA 73 :K T0365 84 :DLLELLTQQDKIANKAKDISGRVIG 1vctA 80 :TILQIANAIEDISNAAGDLAKMVLE T0365 110 :QLLIPQALQVPFIA 1vctA 105 :GVELHPVIKETILE T0365 149 :GFRGREVDFV 1vctA 133 :VIVGKTLGEL T0365 160 :KMINEL 1vctA 143 :DLATNT T0365 191 :NP 1vctA 182 :TR T0365 200 :KTIEWVGGLAD 1vctA 184 :TSIDHLKEIAR T0365 224 :AR 1vctA 197 :IR Number of specific fragments extracted= 12 number of extra gaps= 0 total=1487 Number of alignments=186 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)A123 because first residue in template chain is (1vctA)Y9 T0365 124 :YLQRCIDAVGLAQQVINELDDLLEAGFRGRE 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLFGD T0365 159 :AKMINELDIIEEDTDDLQIQLRR 1vctA 41 :KEIAEEVLELEERIDLLNYQLMM T0365 182 :QLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 65 :SVLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1490 Number of alignments=187 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAARNVKE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQ 1vctA 104 :EGVELHPVIKETILEGEEIIGKIQVYPES Number of specific fragments extracted= 5 number of extra gaps= 0 total=1495 Number of alignments=188 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMH T0365 81 :ERT 1vctA 72 :VKE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL Number of specific fragments extracted= 5 number of extra gaps= 0 total=1500 Number of alignments=189 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 13 :SPIK 1vctA 10 :EPKS T0365 18 :LQEHMDKVYDCASLLVPFFEATI 1vctA 14 :VKEIFIEMKDTVELMVDLAYASL T0365 41 :TGN 1vctA 38 :FGD T0365 48 :VQIRKQISLAEKQGDSLKREIRLT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMH T0365 83 :T 1vctA 73 :K T0365 84 :DLLELLTQQDKIANKAKDISGRVIG 1vctA 80 :TILQIANAIEDISNAAGDLAKMVLE T0365 110 :QLLIPQALQVPFIA 1vctA 105 :GVELHPVIKETILE Number of specific fragments extracted= 7 number of extra gaps= 0 total=1507 Number of alignments=190 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)A224 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 108 :GRQL 1vctA 105 :GVEL T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1vctA 109 :HPVIKETILEGEEIIGKIQVYPESVIVGKTL T0365 153 :REVDFVAKMINELDII 1vctA 140 :GELDLATNTGVWIIAV T0365 177 :IQLRRQLFALES 1vctA 156 :RRGKRWIFGPNE T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1vctA 168 :NFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1516 Number of alignments=191 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)A224 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 46 :DAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1vctA 39 :GDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVI 1vctA 104 :EGVELHPVIKETILEGEEIIGKIQVYPESVI T0365 141 :ELDDL 1vctA 135 :VGKTL T0365 153 :REVDFVAKMINEL 1vctA 140 :GELDLATNTGVWI T0365 174 :DLQIQLRRQLFALESEL 1vctA 153 :IAVRRGKRWIFGPNENF T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELML 1vctA 170 :KIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 8 number of extra gaps= 0 total=1524 Number of alignments=192 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)R225 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAARN T0365 81 :ERT 1vctA 72 :VKE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIA 1vctA 104 :EGVELHPVIKETILE T0365 147 :EAGFRGREVDFV 1vctA 131 :ESVIVGKTLGEL T0365 160 :KMINEL 1vctA 143 :DLATNT T0365 186 :LESEL 1vctA 165 :PNENF T0365 191 :NPVDVMFLYKTIE 1vctA 182 :TRTSIDHLKEIAR T0365 222 :MLA 1vctA 198 :RVI Number of specific fragments extracted= 11 number of extra gaps= 0 total=1535 Number of alignments=193 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)R225 because last residue in template chain is (1vctA)G201 T0365 10 :FAKS 1vctA 10 :EPKS T0365 19 :QEHMDKVYDCASLLVPFFEATI 1vctA 15 :KEIFIEMKDTVELMVDLAYASL T0365 41 :TGN 1vctA 38 :FGD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLF 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAAR T0365 81 :ERT 1vctA 71 :NVK T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIA 1vctA 104 :EGVELHPVIKETILE T0365 149 :GFRGREVDFV 1vctA 133 :VIVGKTLGEL T0365 160 :K 1vctA 143 :D T0365 168 :IEEDT 1vctA 144 :LATNT T0365 191 :NPVDVMFLYKTIE 1vctA 182 :TRTSIDHLKEIAR Number of specific fragments extracted= 11 number of extra gaps= 0 total=1546 Number of alignments=194 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAE T0365 84 :DLLELLTQQDKIANKAKDIS 1vctA 80 :TILQIANAIEDISNAAGDLA T0365 105 :RVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVI 1vctA 100 :KMVLEGVELHPVIKETILEGEEIIGKIQVYPESVI Number of specific fragments extracted= 5 number of extra gaps= 0 total=1551 Number of alignments=195 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 46 :DAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1vctA 39 :GDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQ 1vctA 104 :EGVELHPVIKETILEGEEIIGKIQVYPES Number of specific fragments extracted= 4 number of extra gaps= 0 total=1555 Number of alignments=196 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLLF T0365 42 :GN 1vctA 39 :GD T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAARN T0365 81 :ERT 1vctA 72 :VKE T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1vctA 80 :TILQIANAIEDISNAAGDLAKMVL Number of specific fragments extracted= 5 number of extra gaps= 0 total=1560 Number of alignments=197 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 114 :PQALQVPFIAYLQRCIDAVGLAQ 1vctA 14 :VKEIFIEMKDTVELMVDLAYASL T0365 142 :LDD 1vctA 37 :LFG T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALES 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVLAAR T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1vctA 71 :NVKEAEQVITILQIANAIEDISNAAGDLAKMVLEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=1564 Number of alignments=198 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)E220 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFE 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLL T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTD 1vctA 38 :FGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQ T0365 85 :LLELLTQQDKIANKAKDISGRVI 1vctA 81 :ILQIANAIEDISNAAGDLAKMVL T0365 117 :LQVPFIAYLQRCIDAVGLAQQVINEL 1vctA 104 :EGVELHPVIKETILEGEEIIGKIQVY T0365 153 :REVDFVAKMINELDIIEEDTDDLQ 1vctA 130 :PESVIVGKTLGELDLATNTGVWII T0365 177 :IQLRRQLFA 1vctA 156 :RRGKRWIFG T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 167 :ENFKIRAGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 7 number of extra gaps= 0 total=1571 Number of alignments=199 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 Warning: unaligning (T0365)E220 because last residue in template chain is (1vctA)G201 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFE 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLL T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTD 1vctA 38 :FGDKEIAEEVLELEERIDLLNYQLMMHSVLAARNVKEAEQ T0365 85 :LLELLTQQDKIANKAKDISGRVIG 1vctA 81 :ILQIANAIEDISNAAGDLAKMVLE T0365 110 :Q 1vctA 105 :G T0365 119 :VPFIAYLQRCIDAVGLAQQVINEL 1vctA 106 :VELHPVIKETILEGEEIIGKIQVY T0365 153 :REVDFVAKMINELDIIEEDTD 1vctA 130 :PESVIVGKTLGELDLATNTGV T0365 174 :DLQIQLRRQLFALESELN 1vctA 153 :IAVRRGKRWIFGPNENFK T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 173 :AGDVLIGRGTRTSIDHLKEIARGAIRVI Number of specific fragments extracted= 8 number of extra gaps= 0 total=1579 Number of alignments=200 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1vctA)Y9 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFE 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASLL T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1vctA 38 :FGDKEIAEEVLELEERIDLLNYQLMMH T0365 85 :LLELLTQQDKIANKAKDISGRVI 1vctA 81 :ILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIA 1vctA 104 :EGVELHPVIKETILE T0365 139 :INELDDLLEAGF 1vctA 139 :LGELDLATNTGV T0365 186 :LES 1vctA 166 :NEN T0365 190 :L 1vctA 169 :F T0365 191 :NPVDVMFLYKTIE 1vctA 182 :TRTSIDHLKEIAR Number of specific fragments extracted= 8 number of extra gaps= 0 total=1587 Number of alignments=201 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)F10 because first residue in template chain is (1vctA)Y9 T0365 11 :AKSPIK 1vctA 10 :EPKSVK T0365 20 :EHMDKVYDCASLLVPFFEATI 1vctA 16 :EIFIEMKDTVELMVDLAYASL T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1vctA 38 :FGDKEIAEEVLELEERIDLLNYQLMMH T0365 85 :LLELLTQQDKIANKAKDISGRVI 1vctA 81 :ILQIANAIEDISNAAGDLAKMVL T0365 109 :RQLLIPQALQVPFIA 1vctA 104 :EGVELHPVIKETILE T0365 147 :EAGFRGREVDFV 1vctA 131 :ESVIVGKTLGEL T0365 188 :SEL 1vctA 167 :ENF T0365 192 :PVDVMFLYKTIE 1vctA 183 :RTSIDHLKEIAR Number of specific fragments extracted= 8 number of extra gaps= 0 total=1595 Number of alignments=202 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 160 :KMINELDIIEEDTDDLQIQLRRQ 1vctA 42 :EIAEEVLELEERIDLLNYQLMMH T0365 183 :LFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 66 :VLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMV Number of specific fragments extracted= 2 number of extra gaps= 0 total=1597 Number of alignments=203 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 117 :LQVPFIAYLQRCIDAVGLAQQVINE 1vctA 14 :VKEIFIEMKDTVELMVDLAYASLLF T0365 151 :RG 1vctA 39 :GD T0365 159 :AKMINELDIIEEDTDDLQIQLRRQ 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMH T0365 183 :LFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 66 :VLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMV Number of specific fragments extracted= 4 number of extra gaps= 0 total=1601 Number of alignments=204 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set Warning: unaligning (T0365)R109 because first residue in template chain is (1vctA)Y9 T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQ 1vctA 10 :EPKSVKEIFIEMKDTVELMVDLAYASL T0365 139 :INE 1vctA 37 :LFG T0365 159 :AKMINELDIIEEDTDDLQIQLRRQ 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMH T0365 183 :LFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1vctA 66 :VLAARNVKEAEQVITILQIANAIEDISNAAGDLAKMV Number of specific fragments extracted= 4 number of extra gaps= 0 total=1605 Number of alignments=205 # 1vctA read from 1vctA/merged-a2m # found chain 1vctA in template set T0365 87 :ELLTQQDKIANKAKDISGRVIGRQL 1vctA 16 :EIFIEMKDTVELMVDLAYASLLFGD T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINE 1vctA 41 :KEIAEEVLELEERIDLLNYQLMMHSVL T0365 148 :AGFRGREVDFVAKMINELDIIEEDTDDLQ 1vctA 68 :AARNVKEAEQVITILQIANAIEDISNAAG T0365 178 :QLRRQLFALES 1vctA 97 :DLAKMVLEGVE T0365 190 :LNPVDVMFLYK 1vctA 108 :LHPVIKETILE Number of specific fragments extracted= 5 number of extra gaps= 0 total=1610 Number of alignments=206 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ouvA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1ouvA/merged-a2m # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)D27 because first residue in template chain is (1ouvA)D28 Warning: unaligning (T0365)R225 because last residue in template chain is (1ouvA)H292 T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQIS 1ouvA 29 :PKELVGLGAKSYKEKDFTQAKKYFEKAC T0365 59 :KQGD 1ouvA 57 :DLKE T0365 66 :REIRLTLPSGLFM 1ouvA 61 :NSGCFNLGVLYYQ T0365 79 :PVERTDLLELLTQQDK 1ouvA 78 :EKNLKKAASFYAKACD T0365 99 :AKDISGRVIGRQLLIP 1ouvA 94 :LNYSNGCHLLGNLYYS T0365 115 :QALQVPFIAYLQRCID 1ouvA 114 :SQNTNKALQYYSKACD T0365 133 :GLAQQVINELDDLLEAG 1ouvA 130 :LKYAEGCASLGGIYHDG T0365 151 :RGREVDF 1ouvA 147 :KVVTRDF T0365 159 :AKMINELDIIE 1ouvA 154 :KKAVEYFTKAC T0365 171 :DTDDLQIQLRRQLFALE 1ouvA 165 :DLNDGDGCTILGSLYDA T0365 188 :SELNP 1ouvA 236 :CELEN T0365 202 :IEWVGGLADLAER 1ouvA 241 :GGGCFNLGAMQYN T0365 216 :G 1ouvA 254 :G T0365 217 :SRLELMLA 1ouvA 284 :KQLKIKVH Number of specific fragments extracted= 14 number of extra gaps= 0 total=1624 Number of alignments=207 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)D27 because first residue in template chain is (1ouvA)D28 Warning: unaligning (T0365)R225 because last residue in template chain is (1ouvA)H292 T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQIS 1ouvA 29 :PKELVGLGAKSYKEKDFTQAKKYFEKAC T0365 59 :KQGD 1ouvA 57 :DLKE T0365 66 :REIRLTLPSGLFM 1ouvA 61 :NSGCFNLGVLYYQ T0365 79 :PVERTDLLELLTQQDK 1ouvA 78 :EKNLKKAASFYAKACD T0365 99 :AKDISGRVIGRQLLIP 1ouvA 94 :LNYSNGCHLLGNLYYS T0365 115 :QALQVPFIAYLQRCID 1ouvA 114 :SQNTNKALQYYSKACD T0365 133 :GLAQQVINELDDLLEAG 1ouvA 130 :LKYAEGCASLGGIYHDG T0365 151 :RGREVDF 1ouvA 147 :KVVTRDF T0365 159 :AKMINELD 1ouvA 154 :KKAVEYFT T0365 171 :DTDDLQIQLRRQLFALE 1ouvA 165 :DLNDGDGCTILGSLYDA T0365 188 :SELNPVDVMFLYKTIEWV 1ouvA 236 :CELENGGGCFNLGAMQYN T0365 207 :GLADLAER 1ouvA 254 :GEGVTRNE T0365 215 :VGSRLELMLA 1ouvA 282 :ILKQLKIKVH Number of specific fragments extracted= 13 number of extra gaps= 0 total=1637 Number of alignments=208 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 2 :P 1ouvA 130 :L T0365 200 :KTIEWVGGLADLAER 1ouvA 131 :KYAEGCASLGGIYHD T0365 215 :VG 1ouvA 147 :KV Number of specific fragments extracted= 3 number of extra gaps= 0 total=1640 Number of alignments=209 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 200 :KT 1ouvA 161 :TK T0365 202 :IE 1ouvA 250 :MQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=1642 Number of alignments=210 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 41 :TGNWDDAVQIRKQISL 1ouvA 78 :EKNLKKAASFYAKACD T0365 60 :QGDSLKREIRLTLPSG 1ouvA 94 :LNYSNGCHLLGNLYYS T0365 76 :LFMPVERTDLLELLTQQD 1ouvA 114 :SQNTNKALQYYSKACDLK T0365 174 :DLQIQLRRQLFALE 1ouvA 132 :YAEGCASLGGIYHD T0365 188 :SELNPVDVMFLYKTIE 1ouvA 150 :TRDFKKAVEYFTKACD T0365 206 :GGLADLAERVGSRLEL 1ouvA 166 :LNDGDGCTILGSLYDA T0365 222 :MLARV 1ouvA 213 :NMYHH Number of specific fragments extracted= 7 number of extra gaps= 0 total=1649 Number of alignments=211 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)D27 because first residue in template chain is (1ouvA)D28 T0365 28 :CASLLVPFFEATI 1ouvA 29 :PKELVGLGAKSYK T0365 41 :TGNWDDAVQIRKQISL 1ouvA 78 :EKNLKKAASFYAKACD T0365 60 :QGDS 1ouvA 94 :LNYS T0365 113 :IPQALQVPFIAYLQ 1ouvA 132 :YAEGCASLGGIYHD T0365 127 :RCIDAVGLAQQVIN 1ouvA 152 :DFKKAVEYFTKACD T0365 142 :LDDLL 1ouvA 166 :LNDGD T0365 173 :DDLQIQLRRQLFALE 1ouvA 203 :KDSPGCFNAGNMYHH T0365 188 :SELNPVDVMFLYKTIEWV 1ouvA 236 :CELENGGGCFNLGAMQYN T0365 206 :GGLADLA 1ouvA 258 :TRNEKQA T0365 221 :L 1ouvA 277 :K T0365 222 :MLARV 1ouvA 288 :IKVHH Number of specific fragments extracted= 11 number of extra gaps= 0 total=1660 Number of alignments=212 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 2 :P 1ouvA 202 :L T0365 207 :GLADLAERVG 1ouvA 203 :KDSPGCFNAG Number of specific fragments extracted= 2 number of extra gaps= 0 total=1662 Number of alignments=213 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 39 :TITGNWDDAVQIRKQISL 1ouvA 112 :GVSQNTNKALQYYSKACD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1663 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 1 :MPVNSILGVFAKSPI 1ouvA 61 :NSGCFNLGVLYYQGQ T0365 17 :PLQEHMDKVYDCASLLVPF 1ouvA 76 :GVEKNLKKAASFYAKACDL T0365 41 :TGNWDDAVQIRKQ 1ouvA 114 :SQNTNKALQYYSK T0365 139 :INELDDLLEAGFRGREVD 1ouvA 150 :TRDFKKAVEYFTKACDLN T0365 158 :VAKMINELDIIEED 1ouvA 168 :DGDGCTILGSLYDA T0365 172 :TDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1ouvA 186 :PKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEALARYSKACE Number of specific fragments extracted= 6 number of extra gaps= 0 total=1669 Number of alignments=214 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 1 :MPVNSILGVFAKSPI 1ouvA 61 :NSGCFNLGVLYYQGQ T0365 17 :PLQEHMDKVYDCASLLVPF 1ouvA 76 :GVEKNLKKAASFYAKACDL T0365 38 :ATITGNWDDAVQIRKQ 1ouvA 111 :QGVSQNTNKALQYYSK T0365 167 :IIEED 1ouvA 177 :SLYDA T0365 172 :TDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLAD 1ouvA 186 :PKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKN T0365 211 :LAERVGSRLEL 1ouvA 243 :GCFNLGAMQYN T0365 222 :MLA 1ouvA 269 :KKG T0365 225 :RV 1ouvA 285 :QL Number of specific fragments extracted= 8 number of extra gaps= 0 total=1677 Number of alignments=215 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 40 :ITGNWDDAVQIRKQ 1ouvA 113 :VSQNTNKALQYYSK T0365 185 :ALE 1ouvA 127 :ACD T0365 190 :LNPVDVMF 1ouvA 130 :LKYAEGCA Number of specific fragments extracted= 3 number of extra gaps= 0 total=1680 Number of alignments=216 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 40 :ITGNWDDAVQIRKQ 1ouvA 113 :VSQNTNKALQYYSK T0365 191 :NPVDVMF 1ouvA 205 :SPGCFNA Number of specific fragments extracted= 2 number of extra gaps= 0 total=1682 Number of alignments=217 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 89 :LTQQDKIANKAKDI 1ouvA 45 :FTQAKKYFEKACDL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1683 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1683 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1ouvA)D28 T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITG 1ouvA 29 :PKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLG T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1ouvA 73 :QGQGVEKNLKKAASFYAKACDLNYSNGCHLLGNLYYSGQ T0365 82 :RTDLLELLTQQD 1ouvA 118 :NKALQYYSKACD T0365 96 :ANKAKDISGRVIGR 1ouvA 130 :LKYAEGCASLGGIY T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1ouvA 171 :GCTILGSLYDAGRGTPKDLKKALASYDKACDLKDS T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1ouvA 209 :FNAGNMYHHGEGATKNFKEALARYSKACELENGGGCFNLGAMQYNGEGVTRNEKQAIENFKKGCKLGAKGACDILKQLKIK Number of specific fragments extracted= 6 number of extra gaps= 0 total=1689 Number of alignments=218 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1ouvA)D28 T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITG 1ouvA 29 :PKELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLG T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPV 1ouvA 73 :QGQGVEKNLKKAASFYAKACDLNYSNGCHLLGNLYYSG T0365 81 :ERTDLLELLTQQD 1ouvA 117 :TNKALQYYSKACD T0365 96 :ANKAKDISGRVIGRQLL 1ouvA 130 :LKYAEGCASLGGIYHDG T0365 115 :QALQVPFIAYLQRCIDAVGLAQ 1ouvA 147 :KVVTRDFKKAVEYFTKACDLND T0365 137 :QVINELDDLLEAGFR 1ouvA 170 :DGCTILGSLYDAGRG T0365 152 :GREVDFVAKMINELDIIEE 1ouvA 186 :PKDLKKALASYDKACDLKD T0365 171 :DTDDLQIQLRRQLFALESEL 1ouvA 217 :HGEGATKNFKEALARYSKAC T0365 191 :NPVDVMFL 1ouvA 243 :GCFNLGAM T0365 199 :YKTIEWVGGLADL 1ouvA 259 :RNEKQAIENFKKG T0365 212 :AERVGSRLELMLAR 1ouvA 276 :AKGACDILKQLKIK Number of specific fragments extracted= 11 number of extra gaps= 0 total=1700 Number of alignments=219 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ouvA)D28 T0365 14 :PIKPLQEHM 1ouvA 29 :PKELVGLGA T0365 37 :EATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLF 1ouvA 38 :KSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVE T0365 79 :P 1ouvA 79 :K T0365 84 :DLLELLTQQDKIAN 1ouvA 80 :NLKKAASFYAKACD T0365 99 :AKDISGRVIGR 1ouvA 97 :SNGCHLLGNLY T0365 110 :QLLIPQALQVPFIAYLQRCID 1ouvA 109 :SGQGVSQNTNKALQYYSKACD T0365 136 :QQVINELDDLLEAG 1ouvA 133 :AEGCASLGGIYHDG T0365 150 :FRGREVDFVAKMINELDII 1ouvA 148 :VVTRDFKKAVEYFTKACDL T0365 170 :EDTDDL 1ouvA 167 :NDGDGC T0365 178 :QLRRQLF 1ouvA 173 :TILGSLY T0365 185 :ALESELNPVDVMFLYKTI 1ouvA 182 :GRGTPKDLKKALASYDKA T0365 203 :EWVGGLADLAE 1ouvA 227 :EALARYSKACE T0365 216 :GSRLELMLAR 1ouvA 242 :GGCFNLGAMQ Number of specific fragments extracted= 13 number of extra gaps= 0 total=1713 Number of alignments=220 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ouvA)D28 T0365 14 :PIKPLQEHMDK 1ouvA 29 :PKELVGLGAKS T0365 39 :TITGNWDDAVQIRKQISLA 1ouvA 40 :YKEKDFTQAKKYFEKACDL T0365 59 :KQGDSLKREIRLT 1ouvA 82 :KKAASFYAKACDL T0365 72 :LPSGLFMPVERTDLLELLTQQDKI 1ouvA 107 :YYSGQGVSQNTNKALQYYSKACDL T0365 100 :KDISGRVIGR 1ouvA 134 :EGCASLGGIY T0365 110 :QLLIPQALQVPFIAYLQRCID 1ouvA 145 :DGKVVTRDFKKAVEYFTKACD T0365 131 :AVGLAQQVIN 1ouvA 192 :ALASYDKACD T0365 141 :ELDDLLEAG 1ouvA 210 :NAGNMYHHG T0365 150 :FRGREVDFVAKMINELDII 1ouvA 220 :GATKNFKEALARYSKACEL T0365 173 :DDLQIQLRRQLFALE 1ouvA 241 :GGGCFNLGAMQYNGE T0365 190 :L 1ouvA 256 :G T0365 198 :LYKTIEWVGGL 1ouvA 264 :AIENFKKGCKL T0365 213 :ERVGSRLELMLAR 1ouvA 277 :KGACDILKQLKIK Number of specific fragments extracted= 13 number of extra gaps= 0 total=1726 Number of alignments=221 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 37 :EATITGNWDDAVQIRKQISLAEK 1ouvA 38 :KSYKEKDFTQAKKYFEKACDLKE Number of specific fragments extracted= 1 number of extra gaps= 0 total=1727 Number of alignments=222 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 118 :QVPFIAYLQRCIDAVG 1ouvA 150 :TRDFKKAVEYFTKACD Number of specific fragments extracted= 1 number of extra gaps= 0 total=1728 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 36 :FEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLF 1ouvA 37 :AKSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVE T0365 79 :P 1ouvA 79 :K T0365 84 :DLLELLTQQDKIAN 1ouvA 80 :NLKKAASFYAKACD T0365 99 :AKDISGRVIGR 1ouvA 97 :SNGCHLLGNLY T0365 110 :QLLIPQALQVPFIAYLQRCID 1ouvA 109 :SGQGVSQNTNKALQYYSKACD T0365 136 :QQVINELDDLLEAG 1ouvA 133 :AEGCASLGGIYHDG T0365 150 :FRGREVDFVAKMINELDII 1ouvA 148 :VVTRDFKKAVEYFTKACDL T0365 170 :EDTDDL 1ouvA 167 :NDGDGC T0365 178 :QLRRQLF 1ouvA 173 :TILGSLY T0365 185 :ALESELNPVDVMFLYKTI 1ouvA 182 :GRGTPKDLKKALASYDKA T0365 209 :ADLAERVGSR 1ouvA 205 :SPGCFNAGNM Number of specific fragments extracted= 11 number of extra gaps= 0 total=1739 Number of alignments=223 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 11 :AKSPIKPLQEHMDKVYDCASL 1ouvA 74 :GQGVEKNLKKAASFYAKACDL T0365 32 :LVPFFEATITG 1ouvA 100 :CHLLGNLYYSG T0365 76 :LFMPVERTDLLELLTQQDKI 1ouvA 111 :QGVSQNTNKALQYYSKACDL T0365 100 :KDISGRVIGR 1ouvA 134 :EGCASLGGIY T0365 110 :QLLIPQALQVPFIA 1ouvA 145 :DGKVVTRDFKKAVE T0365 179 :LRRQLFAL 1ouvA 159 :YFTKACDL T0365 188 :S 1ouvA 167 :N T0365 191 :NPVDVMFLYKTI 1ouvA 168 :DGDGCTILGSLY T0365 205 :VGGLADLAERVGS 1ouvA 189 :LKKALASYDKACD Number of specific fragments extracted= 9 number of extra gaps= 0 total=1748 Number of alignments=224 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1ouvA)D28 T0365 3 :VNSILGVFAKS 1ouvA 29 :PKELVGLGAKS T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1ouvA 44 :DFTQAKKYFEKACDLKENSGCFNLGVLYYQGQGVEKNLKKAASFYAKACDLNYSNGCHLLGNLYYSGQGV T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1ouvA 145 :DGKVVTRDFKKAVEYFTKACDLNDGDGCTILGSLYDAGRGTPKDLKKALASYDKACDLKDS T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1ouvA 209 :FNAGNMYHHGEGATKNFKEALARYSKACELENGGGCFNLGAMQYNGEGVTRNEKQAIENFKKGCKLGAKGACDILKQLKIK Number of specific fragments extracted= 4 number of extra gaps= 0 total=1752 Number of alignments=225 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 3 :VNSILGVFAKSPIKP 1ouvA 29 :PKELVGLGAKSYKEK T0365 18 :LQEHMDKVYDCASLLVPF 1ouvA 45 :FTQAKKYFEKACDLKENS T0365 36 :FEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1ouvA 66 :NLGVLYYQGQGVEKNLKKAASFYAKACDLNYSNGCHLLGNLYYSGQ T0365 84 :DLLELLTQQD 1ouvA 120 :ALQYYSKACD T0365 96 :ANKAKDISGRVIGRQLL 1ouvA 130 :LKYAEGCASLGGIYHDG T0365 115 :QALQVPFIAYLQRCIDAVGLAQ 1ouvA 147 :KVVTRDFKKAVEYFTKACDLND T0365 137 :QVINELDDLLEAGFR 1ouvA 170 :DGCTILGSLYDAGRG T0365 157 :FVAKMINELDIIEEDTD 1ouvA 185 :TPKDLKKALASYDKACD T0365 174 :DLQIQLRRQLFALESEL 1ouvA 220 :GATKNFKEALARYSKAC T0365 191 :NPVDV 1ouvA 243 :GCFNL T0365 196 :MFLYKTIEWVGGLAD 1ouvA 256 :GVTRNEKQAIENFKK T0365 211 :LAERVGSRLELMLAR 1ouvA 275 :GAKGACDILKQLKIK Number of specific fragments extracted= 12 number of extra gaps= 0 total=1764 Number of alignments=226 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ouvA)D28 T0365 14 :PIKPLQEHM 1ouvA 29 :PKELVGLGA T0365 37 :EATITGNWDDAVQIRKQISLAE 1ouvA 38 :KSYKEKDFTQAKKYFEKACDLK T0365 59 :KQGDSLKREI 1ouvA 82 :KKAASFYAKA T0365 69 :RLTLPSGLFMPVERTDLLELLTQQDK 1ouvA 104 :GNLYYSGQGVSQNTNKALQYYSKACD T0365 96 :ANKAKDISGRVIGRQLL 1ouvA 130 :LKYAEGCASLGGIYHDG T0365 115 :QALQVPFIAYLQRCIDAVGL 1ouvA 147 :KVVTRDFKKAVEYFTKACDL T0365 136 :QQVINELDDLLEAGFRG 1ouvA 169 :GDGCTILGSLYDAGRGT T0365 153 :REVDFVAKMINELDIIE 1ouvA 187 :KDLKKALASYDKACDLK T0365 191 :NPVDVMFLYKTI 1ouvA 204 :DSPGCFNAGNMY T0365 203 :EWVGGLADLAE 1ouvA 227 :EALARYSKACE T0365 214 :RVGSRLELMLAR 1ouvA 242 :GGCFNLGAMQYN Number of specific fragments extracted= 11 number of extra gaps= 0 total=1775 Number of alignments=227 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ouvA)D28 T0365 14 :PIKPLQEHMDKV 1ouvA 29 :PKELVGLGAKSY T0365 40 :ITGNWDDAVQIRKQISLA 1ouvA 41 :KEKDFTQAKKYFEKACDL T0365 59 :KQGDSLKREI 1ouvA 82 :KKAASFYAKA T0365 74 :SGLFMPVERTDLLELLTQQDKI 1ouvA 109 :SGQGVSQNTNKALQYYSKACDL T0365 100 :KDISGRVIGR 1ouvA 134 :EGCASLGGIY T0365 110 :QLLIPQALQVPFIAYLQRCI 1ouvA 145 :DGKVVTRDFKKAVEYFTKAC T0365 130 :DAVGLAQQVINE 1ouvA 191 :KALASYDKACDL T0365 142 :LDDL 1ouvA 211 :AGNM T0365 146 :LEAGFRGREVDFVAKMINELDIIE 1ouvA 216 :HHGEGATKNFKEALARYSKACELE T0365 173 :DDLQIQLRRQLFAL 1ouvA 241 :GGGCFNLGAMQYNG T0365 187 :ESELN 1ouvA 256 :GVTRN T0365 198 :LYKTIEWVGGL 1ouvA 264 :AIENFKKGCKL T0365 212 :AERVGSRLELMLAR 1ouvA 276 :AKGACDILKQLKIK Number of specific fragments extracted= 13 number of extra gaps= 0 total=1788 Number of alignments=228 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 140 :NELDDLLEAGFRGREVDFVAKMINELDIIEED 1ouvA 30 :KELVGLGAKSYKEKDFTQAKKYFEKACDLKEN Number of specific fragments extracted= 1 number of extra gaps= 0 total=1789 Number of alignments=229 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 169 :EEDTDDLQIQLRRQLFALESELNPVDV 1ouvA 125 :SKACDLKYAEGCASLGGIYHDGKVVTR T0365 197 :FLYKTIEWVGGLAD 1ouvA 152 :DFKKAVEYFTKACD Number of specific fragments extracted= 2 number of extra gaps= 0 total=1791 Number of alignments=230 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 37 :EATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTL 1ouvA 38 :KSYKEKDFTQAKKYFEKACDLKENSGCFNLGVLYYQ T0365 74 :SGLFMPVERTDLLELLTQQD 1ouvA 74 :GQGVEKNLKKAASFYAKACD T0365 96 :ANKAKDISGRVIGR 1ouvA 94 :LNYSNGCHLLGNLY T0365 110 :QLLI 1ouvA 110 :GQGV T0365 115 :QALQVPFIAYLQRCID 1ouvA 114 :SQNTNKALQYYSKACD T0365 136 :QQVINELDDLLEAG 1ouvA 133 :AEGCASLGGIYHDG T0365 150 :FRGREVDFVAKMINELDIIE 1ouvA 148 :VVTRDFKKAVEYFTKACDLN T0365 173 :DDLQIQLRRQLF 1ouvA 168 :DGDGCTILGSLY T0365 185 :ALESELNPVDVMFLYKT 1ouvA 182 :GRGTPKDLKKALASYDK T0365 208 :LAD 1ouvA 199 :ACD Number of specific fragments extracted= 10 number of extra gaps= 0 total=1801 Number of alignments=231 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 11 :AKSPIKPLQEHMDKVYDCASL 1ouvA 74 :GQGVEKNLKKAASFYAKACDL T0365 32 :LVPFFEATI 1ouvA 100 :CHLLGNLYY T0365 74 :SGLFMPVERTDLLELLTQQDKI 1ouvA 109 :SGQGVSQNTNKALQYYSKACDL T0365 100 :KDISGRVIGR 1ouvA 134 :EGCASLGGIY T0365 110 :QLLIPQALQVPFIAYLQRCI 1ouvA 145 :DGKVVTRDFKKAVEYFTKAC T0365 130 :DAVGLAQQVINE 1ouvA 191 :KALASYDKACDL T0365 142 :LDDL 1ouvA 211 :AGNM T0365 146 :LEAGFRGREVDFVAKMINELDIIE 1ouvA 216 :HHGEGATKNFKEALARYSKACELE Number of specific fragments extracted= 8 number of extra gaps= 0 total=1809 Number of alignments=232 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASL 1ouvA 66 :NLGVLYYQGQGVEKNLKKAASFYAKACDL T0365 32 :LVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGL 1ouvA 99 :GCHLLGNLYYSGQGVSQNTNKALQYYSKACDLKYAEGCASLGGIY T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVP 1ouvA 144 :HDGKVVTRDFKKAVEYFTKACDLNDGDGCTILGSLYDA T0365 121 :FIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1ouvA 185 :TPKDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEALARYSKACELENGGGCFNLGAMQYNGEGVTRNEKQAIENFKKGCKLGAKGACDILKQLKIKV Number of specific fragments extracted= 4 number of extra gaps= 0 total=1813 Number of alignments=233 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITG 1ouvA 31 :ELVGLGAKSYKEKDFTQAKKYFEKACDLKENSGCFNLG T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLF 1ouvA 73 :QGQGVEKNLKKAASFYAKACDLNYSNGCHLLGNLY T0365 78 :MPVERTD 1ouvA 113 :VSQNTNK T0365 85 :LLELLTQQD 1ouvA 121 :LQYYSKACD T0365 96 :ANKAKDISGRVIGRQLL 1ouvA 130 :LKYAEGCASLGGIYHDG T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1ouvA 149 :VTRDFKKAVEYFTKACDLNDGDGCTILGSLYDAGRGT T0365 152 :GREVDFVAKMINELDIIEED 1ouvA 186 :PKDLKKALASYDKACDLKDS T0365 172 :TDDLQIQLRRQLFA 1ouvA 218 :GEGATKNFKEALAR T0365 186 :LESELNPVDVMFL 1ouvA 238 :LENGGGCFNLGAM T0365 199 :YKTIEWVGG 1ouvA 262 :KQAIENFKK T0365 208 :LADLAERVGSRLELMLARV 1ouvA 272 :CKLGAKGACDILKQLKIKV Number of specific fragments extracted= 11 number of extra gaps= 0 total=1824 Number of alignments=234 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)S5 because first residue in template chain is (1ouvA)D28 T0365 6 :ILGVFAKSP 1ouvA 37 :AKSYKEKDF T0365 15 :IKPLQEHMD 1ouvA 49 :KKYFEKACD T0365 26 :YDCASLLVPFFE 1ouvA 62 :SGCFNLGVLYYQ T0365 40 :ITGNWDDAVQIRKQISLA 1ouvA 77 :VEKNLKKAASFYAKACDL T0365 68 :IRLTLPSGLFMPVERTDLLELLTQ 1ouvA 103 :LGNLYYSGQGVSQNTNKALQYYSK T0365 95 :IAN 1ouvA 127 :ACD T0365 99 :AKDISGRVIGR 1ouvA 133 :AEGCASLGGIY T0365 110 :QLLIPQALQVPFIAYLQRCID 1ouvA 145 :DGKVVTRDFKKAVEYFTKACD T0365 133 :GLAQQVINEL 1ouvA 169 :GDGCTILGSL T0365 146 :LEAGFR 1ouvA 179 :YDAGRG T0365 152 :GREVDFVAKMINELDIIE 1ouvA 186 :PKDLKKALASYDKACDLK T0365 175 :LQIQLRRQLFALE 1ouvA 207 :GCFNAGNMYHHGE T0365 188 :SELNPVDVMFLYKTI 1ouvA 221 :ATKNFKEALARYSKA T0365 215 :VGSRLELMLAR 1ouvA 241 :GGGCFNLGAMQ Number of specific fragments extracted= 14 number of extra gaps= 0 total=1838 Number of alignments=235 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ouvA)D28 T0365 14 :PIKPLQEHMD 1ouvA 29 :PKELVGLGAK T0365 38 :ATITGNWDDAVQIRKQISL 1ouvA 39 :SYKEKDFTQAKKYFEKACD T0365 59 :KQGDSLKREIRLT 1ouvA 82 :KKAASFYAKACDL T0365 74 :SGLFMPVERTDLLELLTQQDK 1ouvA 109 :SGQGVSQNTNKALQYYSKACD T0365 99 :AKDISGRVIGR 1ouvA 133 :AEGCASLGGIY T0365 110 :QLLIPQALQVPFIAYLQRCID 1ouvA 145 :DGKVVTRDFKKAVEYFTKACD T0365 132 :VGLAQ 1ouvA 175 :LGSLY T0365 137 :QVINELDDLLE 1ouvA 191 :KALASYDKACD T0365 148 :AGFRGREVDFVAKMINELDII 1ouvA 218 :GEGATKNFKEALARYSKACEL T0365 173 :DDLQIQLRRQLFALE 1ouvA 241 :GGGCFNLGAMQYNGE T0365 188 :SELN 1ouvA 257 :VTRN T0365 198 :LYKTIEWVGGL 1ouvA 264 :AIENFKKGCKL T0365 212 :AERVGSRLE 1ouvA 276 :AKGACDILK Number of specific fragments extracted= 13 number of extra gaps= 0 total=1851 Number of alignments=236 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGL 1ouvA 187 :KDLKKALASYDKACDLKDSPGCFNAGNMYHHGEGATKNFKEALARYSKACEL Number of specific fragments extracted= 1 number of extra gaps= 0 total=1852 Number of alignments=237 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 83 :TDLLELLTQQDKIANKAKDI 1ouvA 187 :KDLKKALASYDKACDLKDSP Number of specific fragments extracted= 1 number of extra gaps= 0 total=1853 Number of alignments=238 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set T0365 12 :KSPIKPLQEHMDKVYD 1ouvA 150 :TRDFKKAVEYFTKACD T0365 28 :CASLLVPFFE 1ouvA 171 :GCTILGSLYD T0365 39 :TITGNWDD 1ouvA 181 :AGRGTPKD T0365 85 :LLELLTQQDKIAN 1ouvA 189 :LKKALASYDKACD T0365 99 :AKDISGRVIGRQLLIPQALQVPFIAYLQR 1ouvA 207 :GCFNAGNMYHHGEGATKNFKEALARYSKA Number of specific fragments extracted= 5 number of extra gaps= 0 total=1858 Number of alignments=239 # 1ouvA read from 1ouvA/merged-a2m # found chain 1ouvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ouvA)D28 T0365 14 :PIKPLQEHMD 1ouvA 29 :PKELVGLGAK T0365 38 :ATITGNWDDAVQIRKQISL 1ouvA 39 :SYKEKDFTQAKKYFEKACD T0365 81 :ERTDLLELLTQ 1ouvA 60 :ENSGCFNLGVL T0365 105 :RVIG 1ouvA 71 :YYQG T0365 112 :LIPQALQVPFIAYLQRCID 1ouvA 75 :QGVEKNLKKAASFYAKACD T0365 131 :AV 1ouvA 100 :CH T0365 138 :VINEL 1ouvA 102 :LLGNL T0365 145 :LLEAGFRGREVDFVAKMINELDI 1ouvA 107 :YYSGQGVSQNTNKALQYYSKACD T0365 173 :DDLQIQLRRQLFALE 1ouvA 153 :FKKAVEYFTKACDLN T0365 191 :NPVDVMFLYKTI 1ouvA 168 :DGDGCTILGSLY T0365 205 :VGGLADLAERVGS 1ouvA 189 :LKKALASYDKACD Number of specific fragments extracted= 11 number of extra gaps= 0 total=1869 Number of alignments=240 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oq9A/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1oq9A/merged-a2m # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MP 1oq9A 32 :MP T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASLLV 1oq9A 39 :IFKSLDNWAEENILVHLKPVEKCWQPQDFLP T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLF 1oq9A 70 :DPASDGFDEQVRELRERAKEIPDDYFVVLVGDMI T0365 78 :MPVERTDLLELLTQQDKIANKAKDIS 1oq9A 108 :LPTYQTMLNTLDGVRDETGASPTSWA T0365 104 :GRVIGRQLLIPQA 1oq9A 147 :GDLLNKYLYLSGR T0365 119 :VPFIAYLQRCIDAVGLAQQV 1oq9A 160 :VDMRQIEKTIQYLIGSGMDP T0365 139 :INELDDLLEAGFRGREV 1oq9A 183 :NSPYLGFIYTSFQERAT T0365 156 :DFVAKMINELDIIEE 1oq9A 215 :DIKLAQICGTIAADE T0365 171 :DTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVG 1oq9A 245 :EIDPDGTVLAFADMMRKKISMPAHLMYDGRDDNLFDHFSAVAQRLG T0365 217 :SRLELMLARV 1oq9A 299 :DILEFLVGRW Number of specific fragments extracted= 10 number of extra gaps= 0 total=1879 Number of alignments=241 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MPVN 1oq9A 32 :MPPQ T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCASL 1oq9A 41 :KSLDNWAEENILVHLKPVEKCWQPQDF T0365 33 :VP 1oq9A 68 :LP T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLF 1oq9A 70 :DPASDGFDEQVRELRERAKEIPDDYFVVLVGDMI T0365 78 :MPVERTDLLELLTQQDKIANKAKDIS 1oq9A 108 :LPTYQTMLNTLDGVRDETGASPTSWA T0365 104 :GRVIGRQLLIPQA 1oq9A 147 :GDLLNKYLYLSGR T0365 119 :VPFIAYLQRCIDAVGLAQQVI 1oq9A 160 :VDMRQIEKTIQYLIGSGMDPR T0365 140 :NELDDLLEAGFRGRE 1oq9A 184 :SPYLGFIYTSFQERA T0365 155 :VDFVAKMINELDIIEEDT 1oq9A 214 :GDIKLAQICGTIAADEKR T0365 173 :DDLQIQLRRQLFALE 1oq9A 242 :KLFEIDPDGTVLAFA T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVG 1oq9A 262 :KISMPAHLMYDGRDDNLFDHFSAVAQRLG T0365 217 :SRLELMLARV 1oq9A 299 :DILEFLVGRW Number of specific fragments extracted= 12 number of extra gaps= 0 total=1891 Number of alignments=242 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 62 :DSLKREIRLTLPSGLFMPVERTDLLELL 1oq9A 163 :RQIEKTIQYLIGSGMDPRTENSPYLGFI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1892 Number of alignments=243 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1892 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLL 1oq9A 37 :IEIFKSLDNWAEENILVHLKPVEKCWQPQDFL T0365 34 :PFFEAT 1oq9A 69 :PDPASD T0365 43 :NW 1oq9A 75 :GF T0365 50 :IRKQISLAEKQGD 1oq9A 77 :DEQVRELRERAKE T0365 64 :LKREIRLTLPSGLFMPVERTDLLELLTQQDKIAN 1oq9A 90 :IPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRD T0365 98 :KAKDISGRVIGRQLLIPQALQVPF 1oq9A 158 :GRVDMRQIEKTIQYLIGSGMDPRT T0365 122 :IAYLQRCIDAVGLAQQV 1oq9A 197 :RATFISHGNTARQAKEH T0365 139 :INELDDLLEAGFRGREVDFVAKMINELDIIEEDTDD 1oq9A 237 :TKIVEKLFEIDPDGTVLAFADMMRKKISMPAHLMYD T0365 175 :LQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1oq9A 283 :SAVAQRLGVYTAKDYADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPPRI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1901 Number of alignments=244 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLL 1oq9A 37 :IEIFKSLDNWAEENILVHLKPVEKCWQPQDFL T0365 34 :PFFEAT 1oq9A 69 :PDPASD T0365 43 :NW 1oq9A 75 :GF T0365 50 :IRKQISLAEKQGD 1oq9A 77 :DEQVRELRERAKE T0365 64 :LKREIRLTLPSGLFMPVERTDLLELLTQQDKIANK 1oq9A 90 :IPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDE T0365 99 :AKDISGR 1oq9A 153 :YLYLSGR T0365 106 :VIGRQLLIPQALQVP 1oq9A 166 :EKTIQYLIGSGMDPR T0365 121 :FIAYLQRCIDAVGLA 1oq9A 186 :YLGFIYTSFQERATF T0365 136 :QQVINELDDLLEA 1oq9A 215 :DIKLAQICGTIAA T0365 149 :GF 1oq9A 243 :LF T0365 151 :RGREVDFVAKMINE 1oq9A 248 :PDGTVLAFADMMRK T0365 165 :L 1oq9A 263 :I T0365 166 :DIIEEDTD 1oq9A 269 :LMYDGRDD T0365 174 :DLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1oq9A 282 :FSAVAQRLGVYTAKDYADILEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPPRI Number of specific fragments extracted= 14 number of extra gaps= 0 total=1915 Number of alignments=245 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1oq9A 301 :LEFLVGRWKVDKLTGLSAEGQKAQDYVCRLPPR Number of specific fragments extracted= 1 number of extra gaps= 0 total=1916 Number of alignments=246 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1916 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Warning: unaligning (T0365)V215 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1oq9A)K346 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLV 1oq9A 37 :IEIFKSLDNWAEENILVHLKPVEKCWQPQDFLP T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIAN 1oq9A 70 :DPASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRD T0365 98 :KAKDISGRVIGRQLLIPQALQVPF 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYL T0365 124 :YLQRCIDAVGLAQQVINELDDLLEAGFRGR 1oq9A 155 :YLSGRVDMRQIEKTIQYLIGSGMDPRTENS T0365 154 :EVDFVAKMINEL 1oq9A 186 :YLGFIYTSFQER T0365 166 :DIIEEDTDDLQIQLRRQLFALES 1oq9A 208 :RQAKEHGDIKLAQICGTIAADEK T0365 189 :ELNPVDVMFLYKTI 1oq9A 245 :EIDPDGTVLAFADM T0365 203 :EWVGGLADLAER 1oq9A 325 :DYVCRLPPRIRR T0365 221 :LMLARV 1oq9A 351 :MPFSWI Number of specific fragments extracted= 9 number of extra gaps= 0 total=1925 Number of alignments=247 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Warning: unaligning (T0365)V215 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1oq9A)K346 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLL 1oq9A 37 :IEIFKSLDNWAEENILVHLKPVEKCWQPQDFL T0365 34 :P 1oq9A 69 :P T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAK 1oq9A 70 :DPASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETG T0365 101 :DISGRVIGR 1oq9A 130 :TSWAIWTRA T0365 114 :PQALQ 1oq9A 147 :GDLLN T0365 120 :PFI 1oq9A 152 :KYL T0365 124 :YLQRCIDAVGLAQQVINELDDLLEAGFRGR 1oq9A 155 :YLSGRVDMRQIEKTIQYLIGSGMDPRTENS T0365 154 :EVDFVAKMINELD 1oq9A 186 :YLGFIYTSFQERA T0365 167 :IIEEDTDDLQIQLRRQLF 1oq9A 209 :QAKEHGDIKLAQICGTIA T0365 185 :ALESELNPVDVM 1oq9A 241 :EKLFEIDPDGTV T0365 197 :FLYKTI 1oq9A 305 :VGRWKV T0365 203 :EWVGGLADLAER 1oq9A 325 :DYVCRLPPRIRR T0365 221 :LMLARV 1oq9A 355 :WIFDRQ Number of specific fragments extracted= 13 number of extra gaps= 0 total=1938 Number of alignments=248 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Warning: unaligning (T0365)I168 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1oq9A)K346 T0365 139 :INELDDLLEAGFRGR 1oq9A 310 :VDKLTGLSAEGQKAQ T0365 156 :DFVAKMINELDI 1oq9A 325 :DYVCRLPPRIRR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1940 Number of alignments=249 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Warning: unaligning (T0365)I168 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1oq9A)K346 T0365 138 :VINELDDLLEAGFRGR 1oq9A 309 :KVDKLTGLSAEGQKAQ T0365 156 :DFVAKMINELDI 1oq9A 325 :DYVCRLPPRIRR Number of specific fragments extracted= 2 number of extra gaps= 0 total=1942 Number of alignments=250 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 91 :QQDKIANKAKDISGRVIGRQL 1oq9A 145 :RHGDLLNKYLYLSGRVDMRQI Number of specific fragments extracted= 1 number of extra gaps= 0 total=1943 Number of alignments=251 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=1943 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MPVNSILGVFAKS 1oq9A 24 :VHVQVTHSMPPQK T0365 14 :PIKPLQEH 1oq9A 39 :IFKSLDNW T0365 22 :MDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIAN 1oq9A 48 :EENILVHLKPVEKCWQPQDFLPDPASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRD T0365 98 :KAKDISGRVIGRQL 1oq9A 164 :QIEKTIQYLIGSGM T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1oq9A 178 :DPRTENSPYLGFIYTSFQERATFISHGNTARQAK T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWV 1oq9A 212 :EHGDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRKKISM T0365 206 :GGLADLAERVGSRLELMLAR 1oq9A 276 :DNLFDHFSAVAQRLGVYTAK Number of specific fragments extracted= 7 number of extra gaps= 0 total=1950 Number of alignments=252 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MPVNSILGVFAKS 1oq9A 24 :VHVQVTHSMPPQK T0365 14 :PIKPLQEHMDKVY 1oq9A 39 :IFKSLDNWAEENI T0365 29 :ASLLVPFFEATITGNW 1oq9A 52 :LVHLKPVEKCWQPQDF T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKA 1oq9A 71 :PASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDET T0365 100 :KDISGRVIGR 1oq9A 128 :SPTSWAIWTR T0365 110 :QLL 1oq9A 161 :DMR T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINEL 1oq9A 164 :QIEKTIQYLIGSGMDPRTENSPYLGFI T0365 147 :EAGFRGR 1oq9A 191 :YTSFQER T0365 154 :EVD 1oq9A 209 :QAK T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKT 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRK T0365 206 :GGLADLAERVGSRLELMLAR 1oq9A 276 :DNLFDHFSAVAQRLGVYTAK Number of specific fragments extracted= 11 number of extra gaps= 0 total=1961 Number of alignments=253 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MPVN 1oq9A 18 :FMPP T0365 12 :KS 1oq9A 22 :RE T0365 14 :PIKPLQEHMDKVYD 1oq9A 36 :KIEIFKSLDNWAEE T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLK 1oq9A 70 :DPASDGFDEQVRELRERAKEIPDDY T0365 66 :REIRLTLPS 1oq9A 112 :QTMLNTLDG T0365 75 :GLFMPV 1oq9A 125 :TGASPT T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYL 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYL T0365 126 :Q 1oq9A 174 :G T0365 128 :CIDAVGLAQQVINELDD 1oq9A 196 :ERATFISHGNTARQAKE T0365 152 :GREV 1oq9A 213 :HGDI T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR T0365 201 :TIEWVGGLADL 1oq9A 278 :LFDHFSAVAQR T0365 212 :AERVGSRLELMLAR 1oq9A 294 :AKDYADILEFLVGR Number of specific fragments extracted= 13 number of extra gaps= 0 total=1974 Number of alignments=254 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :MPVN 1oq9A 18 :FMPP T0365 5 :SILGVFAKSPIKPLQEHMDKVYD 1oq9A 27 :QVTHSMPPQKIEIFKSLDNWAEE T0365 41 :TGNWDD 1oq9A 73 :SDGFDE T0365 50 :IRKQISLAEKQ 1oq9A 79 :QVRELRERAKE T0365 61 :GDSLKREIRLTLPSGLFM 1oq9A 107 :ALPTYQTMLNTLDGVRDE T0365 79 :PV 1oq9A 129 :PT T0365 84 :DLLELLTQQDKIANKAKDISGRVIGR 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYLYL T0365 110 :QLL 1oq9A 159 :RVD T0365 118 :QVPFIAYLQRCID 1oq9A 162 :MRQIEKTIQYLIG T0365 131 :AVGLAQQVINELDDLLEAG 1oq9A 195 :QERATFISHGNTARQAKEH T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1oq9A 214 :GDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR T0365 207 :GLADLAERVG 1oq9A 277 :NLFDHFSAVA T0365 217 :SRLELMLAR 1oq9A 299 :DILEFLVGR Number of specific fragments extracted= 13 number of extra gaps= 0 total=1987 Number of alignments=255 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAF Number of specific fragments extracted= 1 number of extra gaps= 0 total=1988 Number of alignments=256 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 48 :VQIRKQISLAEKQGD 1oq9A 237 :TKIVEKLFEIDPDGT T0365 65 :KREIRLTLPSGLFMPV 1oq9A 252 :VLAFADMMRKKISMPA T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLL 1oq9A 268 :HLMYDGRDDNLFDHFSAVAQRLGVYTAK Number of specific fragments extracted= 3 number of extra gaps= 0 total=1991 Number of alignments=257 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 45 :DDAVQIRKQISLAEKQGDSLK 1oq9A 74 :DGFDEQVRELRERAKEIPDDY T0365 66 :REIRLTLPS 1oq9A 112 :QTMLNTLDG T0365 75 :GLFMPV 1oq9A 125 :TGASPT T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYL 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYL T0365 126 :Q 1oq9A 174 :G T0365 128 :CIDAVGLAQQVINELDD 1oq9A 196 :ERATFISHGNTARQAKE T0365 152 :GREV 1oq9A 213 :HGDI T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR T0365 201 :TIEWVGGLADL 1oq9A 278 :LFDHFSAVAQR T0365 212 :AERVGSRLELML 1oq9A 294 :AKDYADILEFLV Number of specific fragments extracted= 10 number of extra gaps= 0 total=2001 Number of alignments=258 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 42 :GNWDD 1oq9A 74 :DGFDE T0365 50 :IRKQISLAEKQ 1oq9A 79 :QVRELRERAKE T0365 61 :GDSLKREIRLTLPSGLFM 1oq9A 107 :ALPTYQTMLNTLDGVRDE T0365 79 :PV 1oq9A 129 :PT T0365 84 :DLLELLTQQDKIANKAKDISGRVIGR 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYLYL T0365 110 :QLL 1oq9A 159 :RVD T0365 118 :QVPFIAYLQRCID 1oq9A 162 :MRQIEKTIQYLIG T0365 131 :AVGLAQQVINELDDLLEAG 1oq9A 195 :QERATFISHGNTARQAKEH T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1oq9A 214 :GDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDP T0365 192 :PVDVMFLYKTIEW 1oq9A 249 :DGTVLAFADMMRK T0365 207 :GLADLAERVGSR 1oq9A 277 :NLFDHFSAVAQR Number of specific fragments extracted= 11 number of extra gaps= 0 total=2012 Number of alignments=259 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :M 1oq9A 19 :M T0365 2 :PVNSILGVFAKS 1oq9A 25 :HVQVTHSMPPQK T0365 14 :PIKPLQEHMDK 1oq9A 39 :IFKSLDNWAEE T0365 25 :VYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIAN 1oq9A 51 :ILVHLKPVEKCWQPQDFLPDPASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRD T0365 98 :KAKDISGRVIGRQL 1oq9A 149 :LLNKYLYLSGRVDM T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINEL 1oq9A 163 :RQIEKTIQYLIGSGMDPRTENSPYLGFI T0365 143 :DDLLEAGFRGREVDF 1oq9A 198 :ATFISHGNTARQAKE T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 1oq9A 218 :LAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAF T0365 196 :MFLYKT 1oq9A 258 :MMRKKI T0365 202 :IEWV 1oq9A 267 :AHLM T0365 206 :GGLADLAERVGSRLELMLAR 1oq9A 276 :DNLFDHFSAVAQRLGVYTAK Number of specific fragments extracted= 11 number of extra gaps= 0 total=2023 Number of alignments=260 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :M 1oq9A 19 :M T0365 2 :PVNSILGVFAKS 1oq9A 25 :HVQVTHSMPPQK T0365 14 :PIKPLQEHMDKVYDC 1oq9A 39 :IFKSLDNWAEENILV T0365 31 :LLVPFFEATITGNW 1oq9A 54 :HLKPVEKCWQPQDF T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGR 1oq9A 71 :PASDGFDEQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIW T0365 110 :QL 1oq9A 161 :DM T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINEL 1oq9A 163 :RQIEKTIQYLIGSGMDPRTENSPYLGFI T0365 147 :EAGFRG 1oq9A 191 :YTSFQE T0365 153 :REVD 1oq9A 208 :RQAK T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKT 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMRK T0365 202 :IEW 1oq9A 267 :AHL T0365 206 :GGLADLAERVGSRLELMLAR 1oq9A 276 :DNLFDHFSAVAQRLGVYTAK Number of specific fragments extracted= 12 number of extra gaps= 0 total=2035 Number of alignments=261 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1oq9A)F18 T0365 4 :NSILGVFAKSPIKPLQEHMDKVYD 1oq9A 26 :VQVTHSMPPQKIEIFKSLDNWAEE T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKR 1oq9A 70 :DPASDGFDEQVRELRERAKEIPDDYF T0365 67 :EIRLTLPS 1oq9A 113 :TMLNTLDG T0365 75 :GLFMPVERTDLLELLTQ 1oq9A 125 :TGASPTSWAIWTRAWTA T0365 92 :QDKIANKAKDISGRVIGRQL 1oq9A 143 :ENRHGDLLNKYLYLSGRVDM T0365 115 :QALQVPFIA 1oq9A 163 :RQIEKTIQY T0365 124 :YLQRCIDAVGLAQQVINE 1oq9A 186 :YLGFIYTSFQERATFISH T0365 142 :LDDLLE 1oq9A 207 :ARQAKE T0365 152 :GREV 1oq9A 213 :HGDI T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR T0365 201 :TIEWVGGLADL 1oq9A 278 :LFDHFSAVAQR T0365 212 :AERVGSRLELMLAR 1oq9A 294 :AKDYADILEFLVGR Number of specific fragments extracted= 12 number of extra gaps= 0 total=2047 Number of alignments=262 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 1 :M 1oq9A 18 :F T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYD 1oq9A 24 :VHVQVTHSMPPQKIEIFKSLDNWAEE T0365 42 :GNWDDAVQIRKQISLAEKQ 1oq9A 71 :PASDGFDEQVRELRERAKE T0365 61 :GDSLKREIRLTLPS 1oq9A 107 :ALPTYQTMLNTLDG T0365 75 :GLFMPVE 1oq9A 125 :TGASPTS T0365 82 :RTDLLELLTQQDKIAN 1oq9A 136 :TRAWTAEENRHGDLLN T0365 98 :KAKDISGRVIGRQLL 1oq9A 164 :QIEKTIQYLIGSGMD T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1oq9A 181 :TENSPYLGFIYTSFQERATFISHGNTARQAKE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1oq9A 213 :HGDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDP T0365 192 :PVDVMFLYKTIEW 1oq9A 249 :DGTVLAFADMMRK T0365 206 :GGLADLAERVG 1oq9A 276 :DNLFDHFSAVA T0365 217 :SRLELMLAR 1oq9A 299 :DILEFLVGR Number of specific fragments extracted= 12 number of extra gaps= 0 total=2059 Number of alignments=263 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAF Number of specific fragments extracted= 1 number of extra gaps= 0 total=2060 Number of alignments=264 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=2060 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 43 :NWDDAVQIRKQISLAEKQGDSLKR 1oq9A 72 :ASDGFDEQVRELRERAKEIPDDYF T0365 67 :EIRLTLPS 1oq9A 113 :TMLNTLDG T0365 75 :GLFMPVERTDLLELLTQ 1oq9A 125 :TGASPTSWAIWTRAWTA T0365 92 :QDKIANKAKDISGRVIGRQL 1oq9A 143 :ENRHGDLLNKYLYLSGRVDM T0365 115 :QALQVPFIA 1oq9A 163 :RQIEKTIQY T0365 124 :YLQRCIDAVGLAQQVINE 1oq9A 186 :YLGFIYTSFQERATFISH T0365 142 :LDDLLE 1oq9A 207 :ARQAKE T0365 152 :GREV 1oq9A 213 :HGDI T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR T0365 201 :TIEWVGGLADL 1oq9A 278 :LFDHFSAVAQR T0365 212 :AERVGSRLELML 1oq9A 294 :AKDYADILEFLV Number of specific fragments extracted= 11 number of extra gaps= 0 total=2071 Number of alignments=265 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYD 1oq9A 24 :VHVQVTHSMPPQKIEIFKSLDNWAEE T0365 42 :GNWDDAVQIRKQISLAEKQ 1oq9A 71 :PASDGFDEQVRELRERAKE T0365 61 :GDSLKREIRLTLPS 1oq9A 107 :ALPTYQTMLNTLDG T0365 75 :GLFMPVE 1oq9A 125 :TGASPTS T0365 82 :RTDLLELLTQQDKIAN 1oq9A 136 :TRAWTAEENRHGDLLN T0365 98 :KAKDISGRVIGRQLL 1oq9A 164 :QIEKTIQYLIGSGMD T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1oq9A 181 :TENSPYLGFIYTSFQERATFISHGNTARQAKE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1oq9A 213 :HGDIKLAQICGTIAADEKRHETAYTKIVEKLFEID T0365 191 :NPVDVMFLYKTIEW 1oq9A 248 :PDGTVLAFADMMRK T0365 206 :GGLADLAERVGSR 1oq9A 276 :DNLFDHFSAVAQR Number of specific fragments extracted= 10 number of extra gaps= 0 total=2081 Number of alignments=266 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Warning: unaligning (T0365)L18 because first residue in template chain is (1oq9A)F18 T0365 19 :Q 1oq9A 19 :M T0365 20 :EHMDKVYDCASLLVPFFEATITGNWDDAVQIRK 1oq9A 24 :VHVQVTHSMPPQKIEIFKSLDNWAEENILVHLK T0365 53 :QISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQD 1oq9A 79 :QVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLD T0365 94 :KIANKAKDISGRVIGRQLL 1oq9A 148 :DLLNKYLYLSGRVDMRQIE T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVD 1oq9A 168 :TIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGNTARQAK T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLY 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMM T0365 200 :KTIEWVGGLADL 1oq9A 277 :NLFDHFSAVAQR T0365 212 :AERVGSRLELMLARV 1oq9A 294 :AKDYADILEFLVGRW Number of specific fragments extracted= 8 number of extra gaps= 0 total=2089 Number of alignments=267 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set Warning: unaligning (T0365)L18 because first residue in template chain is (1oq9A)F18 T0365 19 :Q 1oq9A 19 :M T0365 20 :EHMDKVYDCASLLVPFFEATI 1oq9A 24 :VHVQVTHSMPPQKIEIFKSLD T0365 43 :NWDDAVQIR 1oq9A 45 :NWAEENILV T0365 52 :KQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIAN 1oq9A 78 :EQVRELRERAKEIPDDYFVVLVGDMITEEALPTYQTMLNTLDGVRD T0365 98 :KAKDISGRVIGRQLLIPQALQVPFI 1oq9A 126 :GASPTSWAIWTRAWTAEENRHGDLL T0365 123 :AYLQRC 1oq9A 152 :KYLYLS T0365 129 :IDAVGLAQQVINEL 1oq9A 162 :MRQIEKTIQYLIGS T0365 144 :DLLEAGFRGREV 1oq9A 188 :GFIYTSFQERAT T0365 156 :D 1oq9A 211 :K T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLY 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMM T0365 206 :GGLADLAERVGSRLELMLARV 1oq9A 276 :DNLFDHFSAVAQRLGVYTAKD Number of specific fragments extracted= 11 number of extra gaps= 0 total=2100 Number of alignments=268 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 2 :PVNSILGVFAKSPIKPLQEHMD 1oq9A 27 :QVTHSMPPQKIEIFKSLDNWAE T0365 41 :TGNWDDAVQIRKQISLAEKQ 1oq9A 70 :DPASDGFDEQVRELRERAKE T0365 63 :SLKREIRLTLPSGL 1oq9A 109 :PTYQTMLNTLDGVR T0365 78 :MPVERTD 1oq9A 125 :TGASPTS T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIA 1oq9A 136 :TRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIG T0365 124 :YLQRCIDAVGLAQQVINE 1oq9A 195 :QERATFISHGNTARQAKE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1oq9A 213 :HGDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR T0365 201 :TIEWVGGLADL 1oq9A 278 :LFDHFSAVAQR T0365 212 :AERVGSRLELMLAR 1oq9A 294 :AKDYADILEFLVGR Number of specific fragments extracted= 9 number of extra gaps= 0 total=2109 Number of alignments=269 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYD 1oq9A 24 :VHVQVTHSMPPQKIEIFKSLDNWAEE T0365 42 :GNWDDAVQIRKQISLAEKQ 1oq9A 71 :PASDGFDEQVRELRERAKE T0365 63 :SLKREIRLTLPSGL 1oq9A 109 :PTYQTMLNTLDGVR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRC 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGS T0365 129 :IDAVGLAQQVIN 1oq9A 200 :FISHGNTARQAK T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1oq9A 212 :EHGDIKLAQICGTIAADEKRHETAYTKIVEKLFEID T0365 191 :NPVDVMFLYKTIEW 1oq9A 248 :PDGTVLAFADMMRK T0365 207 :GLADLAERVG 1oq9A 277 :NLFDHFSAVA T0365 217 :SRLELMLAR 1oq9A 299 :DILEFLVGR Number of specific fragments extracted= 9 number of extra gaps= 0 total=2118 Number of alignments=270 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1oq9A 217 :KLAQICGTIAADEKRHETAYTKIVEKLFEIDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=2119 Number of alignments=271 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 175 :LQIQLRRQLFALESE 1oq9A 235 :AYTKIVEKLFEIDPD Number of specific fragments extracted= 1 number of extra gaps= 0 total=2120 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQIS 1oq9A 134 :IWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLI T0365 108 :GRQLLIPQALQVPF 1oq9A 174 :GSGMDPRTENSPYL T0365 122 :IAYLQRCIDAVGLAQQVINE 1oq9A 193 :SFQERATFISHGNTARQAKE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1oq9A 213 :HGDIKLAQICGTIAADEKRHETAYTKIVEKLFEIDPDGTVLAFADMMR T0365 201 :TIEWVGGLADL 1oq9A 278 :LFDHFSAVAQR T0365 212 :AERVGSRLELMLA 1oq9A 294 :AKDYADILEFLVG Number of specific fragments extracted= 6 number of extra gaps= 0 total=2126 Number of alignments=272 # 1oq9A read from 1oq9A/merged-a2m # found chain 1oq9A in template set T0365 63 :SLKREIRLTLPSGL 1oq9A 109 :PTYQTMLNTLDGVR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRC 1oq9A 131 :SWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMRQIEKTIQYLIGS T0365 129 :IDAVGLAQQVIN 1oq9A 200 :FISHGNTARQAK T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1oq9A 212 :EHGDIKLAQICGTIAADEKRHETAYTKIVEKLFEID T0365 191 :NPVDVMFLYKTIEW 1oq9A 248 :PDGTVLAFADMMRK T0365 207 :GLADLAERVG 1oq9A 277 :NLFDHFSAVA T0365 217 :SRLELML 1oq9A 299 :DILEFLV Number of specific fragments extracted= 7 number of extra gaps= 0 total=2133 Number of alignments=273 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1o5hA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1o5hA/merged-a2m # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1o5hA 6 :LSLKEFCDMVAERKPTPGGGAVGSVVGAMACALAEMVANFTRKKKGYEDVEPEMERIVEAMEEARLKLFDLAKK T0365 75 :GLFMPVER 1o5hA 85 :EKVMKAYK T0365 89 :LTQQD 1o5hA 93 :SSEGE T0365 109 :RQLLIPQALQVPF 1o5hA 98 :LQNALKEAASVPM T0365 123 :AYLQRCIDAVGLAQQVI 1o5hA 111 :DVIRVMKDLAHELEKLA T0365 140 :NELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELN 1o5hA 133 :NLASDTLNAADLCHAVFQVEKVNVLINLKEISDETFRKNMLEELEEQEAQIE T0365 210 :DLAERVGSRLELMLARV 1o5hA 185 :GCYQRVKKMLEGIVWSS Number of specific fragments extracted= 7 number of extra gaps= 0 total=2140 Number of alignments=274 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 1 :MPVNSILGVFAKSPIKP 1o5hA 6 :LSLKEFCDMVAERKPTP T0365 23 :DKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1o5hA 28 :GSVVGAMACALAEMVANFTRKKKGYEDVEPEMERIVEAMEEARLKLFDLAKK T0365 75 :GLFMPVER 1o5hA 85 :EKVMKAYK T0365 109 :RQLLIPQALQVPF 1o5hA 98 :LQNALKEAASVPM T0365 123 :AYLQRCIDAVGLAQQVINELD 1o5hA 111 :DVIRVMKDLAHELEKLAEFGN T0365 144 :DLLEAGFRGREVDFVA 1o5hA 137 :DTLNAADLCHAVFQVE T0365 160 :KMINELDIIEED 1o5hA 156 :VLINLKEISDET T0365 175 :LQIQLRRQLFALESELN 1o5hA 168 :FRKNMLEELEEQEAQIE T0365 210 :DLAERVGSRLELMLARV 1o5hA 185 :GCYQRVKKMLEGIVWSS Number of specific fragments extracted= 9 number of extra gaps= 0 total=2149 Number of alignments=275 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 153 :REVDFVAKMINELDIIEEDTDDL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGC Number of specific fragments extracted= 1 number of extra gaps= 0 total=2150 Number of alignments=276 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 114 :PQALQVPF 1o5hA 103 :KEAASVPM T0365 123 :AYLQRCIDAVGLAQQVINELDD 1o5hA 111 :DVIRVMKDLAHELEKLAEFGNK T0365 145 :LLEAGFRGR 1o5hA 144 :LCHAVFQVE T0365 154 :EVDFVAKMINELDIIEEDT 1o5hA 165 :DETFRKNMLEELEEQEAQI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2154 Number of alignments=277 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 1 :MPVNSILGVFA 1o5hA 6 :LSLKEFCDMVA T0365 12 :KSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQ 1o5hA 49 :KKGYEDVEPEMERIVEAMEEARLKLFDLAKKDMEAFEKVMKAYKSSEGE T0365 109 :RQLLIPQALQVPF 1o5hA 98 :LQNALKEAASVPM T0365 123 :AYLQRCIDAVGLAQQVI 1o5hA 111 :DVIRVMKDLAHELEKLA T0365 140 :NELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNP 1o5hA 133 :NLASDTLNAADLCHAVFQVEKVNVLINLKEISDETFRKNMLEELEEQEAQIEG T0365 211 :LAERVGSRLELMLARV 1o5hA 186 :CYQRVKKMLEGIVWSS Number of specific fragments extracted= 6 number of extra gaps= 0 total=2160 Number of alignments=278 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 1 :MPVNSILGVFAKSPIKP 1o5hA 6 :LSLKEFCDMVAERKPTP T0365 25 :VYDCASLLVPFFEATITG 1o5hA 32 :GAMACALAEMVANFTRKK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIR 1o5hA 50 :KGYEDVEPEMERIVEAMEEARLKLF T0365 70 :LTLPSGLFMPVER 1o5hA 85 :EKVMKAYKSSEGE T0365 109 :RQLLIPQALQVPF 1o5hA 98 :LQNALKEAASVPM T0365 123 :AYLQRCIDAVGLAQQVINEL 1o5hA 111 :DVIRVMKDLAHELEKLAEFG T0365 143 :DDLLEAGFRGREVDF 1o5hA 136 :SDTLNAADLCHAVFQ T0365 158 :VAKMINELDIIEEDTDD 1o5hA 154 :VNVLINLKEISDETFRK T0365 178 :QLRRQLFALESELN 1o5hA 171 :NMLEELEEQEAQIE T0365 210 :DLAERVGSRLELMLARV 1o5hA 185 :GCYQRVKKMLEGIVWSS Number of specific fragments extracted= 10 number of extra gaps= 0 total=2170 Number of alignments=279 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 153 :REVDFVAKMINELDIIEEDTDDL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGC Number of specific fragments extracted= 1 number of extra gaps= 0 total=2171 Number of alignments=280 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 109 :RQLLIPQALQVPF 1o5hA 98 :LQNALKEAASVPM T0365 123 :AYLQRCIDAVGLAQQVINELD 1o5hA 111 :DVIRVMKDLAHELEKLAEFGN T0365 144 :DL 1o5hA 137 :DT T0365 146 :LEAGFRG 1o5hA 145 :CHAVFQV T0365 153 :REVDFVAKMINELDIIEED 1o5hA 164 :SDETFRKNMLEELEEQEAQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=2176 Number of alignments=281 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRL 1o5hA 6 :LSLKEFCDMVAERKPTPGGGAVGSVVGAMACALAEMVANFTRKKKGYEDVEPEMERIVEAMEEARLKLFD T0365 71 :TLPSGLFMPVER 1o5hA 86 :KVMKAYKSSEGE T0365 117 :LQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQ 1o5hA 98 :LQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLKEI T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGI Number of specific fragments extracted= 4 number of extra gaps= 0 total=2180 Number of alignments=282 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 1 :MPVNSILGVFAKSPIKP 1o5hA 6 :LSLKEFCDMVAERKPTP T0365 21 :HMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTL 1o5hA 26 :AVGSVVGAMACALAEMVANFTRKKKGYEDVEPEMERIVEAMEEARLKLFDLA T0365 73 :PSGLFMPVER 1o5hA 88 :MKAYKSSEGE T0365 145 :LLEAGFRGREV 1o5hA 98 :LQNALKEAASV T0365 156 :DFVAKMINELDIIEED 1o5hA 111 :DVIRVMKDLAHELEKL T0365 172 :TDDLQIQLRRQLFALESELNPVDVM 1o5hA 135 :ASDTLNAADLCHAVFQVEKVNVLIN T0365 197 :FLYKTIEWVG 1o5hA 168 :FRKNMLEELE T0365 207 :GLADLAERVGSRLELMLARV 1o5hA 182 :QIEGCYQRVKKMLEGIVWSS Number of specific fragments extracted= 8 number of extra gaps= 0 total=2188 Number of alignments=283 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKML Number of specific fragments extracted= 1 number of extra gaps= 0 total=2189 Number of alignments=284 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 115 :QALQVPF 1o5hA 104 :EAASVPM T0365 123 :AYLQRCIDAVGLAQQVINELDD 1o5hA 111 :DVIRVMKDLAHELEKLAEFGNK T0365 145 :LLEAGFRG 1o5hA 144 :LCHAVFQV T0365 153 :REVDFVAKMINELDIIEEDTDDL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGC Number of specific fragments extracted= 4 number of extra gaps= 0 total=2193 Number of alignments=285 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 129 :IDAVGLAQQVINELDDLLEAG 1o5hA 110 :MDVIRVMKDLAHELEKLAEFG Number of specific fragments extracted= 1 number of extra gaps= 0 total=2194 Number of alignments=286 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=2194 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1o5hA)E2 T0365 12 :KS 1o5hA 3 :VE T0365 14 :PIKPLQEH 1o5hA 11 :FCDMVAER T0365 22 :MDKVYDCASLLVPFF 1o5hA 28 :GSVVGAMACALAEMV T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGL 1o5hA 43 :ANFTRKKKGYEDVEPEMERIVEAMEEARLKLFDLA T0365 96 :ANKAKDISGRVIGRQLL 1o5hA 78 :KKDMEAFEKVMKAYKSS T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEA 1o5hA 95 :EGELQNALKEAASVPMDVIRVMKDLAHELEKLAEF T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1o5hA 130 :GNKNLASDTLNAADLCHAVFQVEKVNVLINLKEISD T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1o5hA 166 :ETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 8 number of extra gaps= 0 total=2202 Number of alignments=287 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1o5hA)E2 T0365 12 :KS 1o5hA 3 :VE T0365 14 :PIKPLQEH 1o5hA 11 :FCDMVAER T0365 22 :MDKVYDCASLLVPFFEATI 1o5hA 28 :GSVVGAMACALAEMVANFT T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKREIR 1o5hA 49 :KKGYEDVEPEMERIVEAMEEARLKLFDLA T0365 96 :ANKAKDISGRVIGRQLL 1o5hA 78 :KKDMEAFEKVMKAYKSS T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1o5hA 95 :EGELQNALKEAASVPMDVIRVMKDLAHELEKLAEFG T0365 152 :GR 1o5hA 131 :NK T0365 154 :EVDFVAKMINELDIIEE 1o5hA 137 :DTLNAADLCHAVFQVEK T0365 177 :IQLRRQLFALES 1o5hA 154 :VNVLINLKEISD T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1o5hA 166 :ETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 10 number of extra gaps= 0 total=2212 Number of alignments=288 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1o5hA)E2 Warning: unaligning (T0365)L190 because last residue in template chain is (1o5hA)S201 T0365 12 :KS 1o5hA 3 :VE T0365 14 :PIKPLQEH 1o5hA 7 :SLKEFCDM T0365 22 :MDKVYDCASLLVPFFEATI 1o5hA 28 :GSVVGAMACALAEMVANFT T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLK 1o5hA 49 :KKGYEDVEPEMERIVEAMEEARLKL T0365 66 :REIRLTLPSGLFMPV 1o5hA 81 :MEAFEKVMKAYKSSE T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1o5hA 98 :LQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLI T0365 144 :DL 1o5hA 159 :NL T0365 148 :AGF 1o5hA 161 :KEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 9 number of extra gaps= 0 total=2221 Number of alignments=289 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1o5hA)E2 Warning: unaligning (T0365)N191 because last residue in template chain is (1o5hA)S201 T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAKKDMEA T0365 72 :LPSG 1o5hA 87 :VMKA T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 98 :LQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 149 :GF 1o5hA 162 :EI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 7 number of extra gaps= 0 total=2228 Number of alignments=290 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 94 :KIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1o5hA 111 :DVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEK T0365 139 :INELDDLLEA 1o5hA 154 :VNVLINLKEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKML Number of specific fragments extracted= 3 number of extra gaps= 0 total=2231 Number of alignments=291 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 13 :S 1o5hA 53 :E T0365 14 :PIKPLQEHMDKVYDCASLLVPFFE 1o5hA 55 :VEPEMERIVEAMEEARLKLFDLAK T0365 42 :GNWDDAVQIRKQISLAEK 1o5hA 79 :KDMEAFEKVMKAYKSSEG T0365 67 :EIRLTLPSGLFMPV 1o5hA 97 :ELQNALKEAASVPM T0365 94 :KIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVG 1o5hA 111 :DVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQ T0365 136 :QQVINELDDLLEA 1o5hA 151 :VEKVNVLINLKEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEG Number of specific fragments extracted= 7 number of extra gaps= 0 total=2238 Number of alignments=292 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 9 :VFA 1o5hA 49 :KKG T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEA 1o5hA 55 :VEPEMERIVEAMEEARLKLFDLAKK T0365 47 :AVQIRKQISLAEKQGDSLKR 1o5hA 80 :DMEAFEKVMKAYKSSEGELQ T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1o5hA 100 :NALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLI T0365 144 :DL 1o5hA 159 :NL T0365 148 :AGF 1o5hA 161 :KEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGI Number of specific fragments extracted= 7 number of extra gaps= 0 total=2245 Number of alignments=293 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAKKDMEA T0365 72 :LPSG 1o5hA 87 :VMKA T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 98 :LQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 149 :GF 1o5hA 162 :EI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGI Number of specific fragments extracted= 7 number of extra gaps= 0 total=2252 Number of alignments=294 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (1o5hA)E2 T0365 15 :IKP 1o5hA 3 :VER T0365 18 :LQEHMDKVYD 1o5hA 8 :LKEFCDMVAE T0365 28 :CASLLVPFF 1o5hA 34 :MACALAEMV T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGL 1o5hA 43 :ANFTRKKKGYEDVEPEMERIVEAMEEARLKLFDLA T0365 96 :ANKAKDISGRVIGRQLLI 1o5hA 78 :KKDMEAFEKVMKAYKSSE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1o5hA 96 :GELQNALKEAASVPMDVIRVMKDLAHELEKLAEFG T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1o5hA 131 :NKNLASDTLNAADLCHAVFQVEKVNVLINLKEISD T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1o5hA 166 :ETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 8 number of extra gaps= 0 total=2260 Number of alignments=295 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1o5hA)E2 T0365 12 :KS 1o5hA 3 :VE T0365 14 :PIKPLQE 1o5hA 11 :FCDMVAE T0365 21 :HMDKVYDCASLLVPFFEATI 1o5hA 27 :VGSVVGAMACALAEMVANFT T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKREIR 1o5hA 49 :KKGYEDVEPEMERIVEAMEEARLKLFDLA T0365 82 :R 1o5hA 78 :K T0365 97 :NKAKDISGRVIGRQLL 1o5hA 79 :KDMEAFEKVMKAYKSS T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRG 1o5hA 95 :EGELQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKN T0365 153 :REVDFVAKMINELDIIEE 1o5hA 136 :SDTLNAADLCHAVFQVEK T0365 177 :IQLRRQLFALES 1o5hA 154 :VNVLINLKEISD T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1o5hA 166 :ETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 10 number of extra gaps= 0 total=2270 Number of alignments=296 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)S5 because first residue in template chain is (1o5hA)E2 Warning: unaligning (T0365)R225 because last residue in template chain is (1o5hA)S201 T0365 6 :ILGVFAKSPIKPLQ 1o5hA 3 :VERLSLKEFCDMVA T0365 21 :HMDKVYDCASLLVPFFEATI 1o5hA 27 :VGSVVGAMACALAEMVANFT T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKR 1o5hA 49 :KKGYEDVEPEMERIVEAMEEARLKLF T0365 67 :EIRLTLPSGLFMPVE 1o5hA 82 :EAFEKVMKAYKSSEG T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLI T0365 144 :DLLE 1o5hA 159 :NLKE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 7 number of extra gaps= 0 total=2277 Number of alignments=297 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1o5hA)E2 Warning: unaligning (T0365)R225 because last residue in template chain is (1o5hA)S201 T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKR 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAK T0365 67 :EIRLTLPSGLFM 1o5hA 82 :EAFEKVMKAYKS T0365 81 :E 1o5hA 94 :S T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 152 :G 1o5hA 162 :E T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 8 number of extra gaps= 0 total=2285 Number of alignments=298 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 94 :KIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGL 1o5hA 111 :DVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQV T0365 137 :QVINELDDLLEA 1o5hA 152 :EKVNVLINLKEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKML Number of specific fragments extracted= 3 number of extra gaps= 0 total=2288 Number of alignments=299 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 14 :PIKPLQEHMDKVYDCASLLVPFFE 1o5hA 55 :VEPEMERIVEAMEEARLKLFDLAK T0365 42 :GNWDDAVQIRKQISLAEK 1o5hA 79 :KDMEAFEKVMKAYKSSEG T0365 67 :EIRLTLPSGLFMPV 1o5hA 97 :ELQNALKEAASVPM T0365 94 :KIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVG 1o5hA 111 :DVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQ T0365 136 :QQVINELDDLLEA 1o5hA 151 :VEKVNVLINLKEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEG Number of specific fragments extracted= 6 number of extra gaps= 0 total=2294 Number of alignments=300 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEA 1o5hA 51 :GYEDVEPEMERIVEAMEEARLKLFDLAKK T0365 47 :AVQIRKQISLAEKQGDSL 1o5hA 80 :DMEAFEKVMKAYKSSEGE T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1o5hA 98 :LQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLI T0365 144 :DLLE 1o5hA 159 :NLKE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 5 number of extra gaps= 0 total=2299 Number of alignments=301 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKR 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAK T0365 67 :EIRLTLPSGLFM 1o5hA 82 :EAFEKVMKAYKS T0365 81 :E 1o5hA 94 :S T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 152 :G 1o5hA 162 :E T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 8 number of extra gaps= 0 total=2307 Number of alignments=302 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGN 1o5hA 14 :MVAERKPTPGGGAVGSVVGAMACALAEMVANFTRKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 52 :YEDVEPEMERIVEAMEEARLKLFDLAKK T0365 98 :KAKDISGRVIGRQL 1o5hA 80 :DMEAFEKVMKAYKS T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1o5hA 94 :SEGELQNALKEAASVPMDVIRVMKDLAHELEKLAEFG T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1o5hA 131 :NKNLASDTLNAADLCHAVFQVEKVNVLINLKEISD T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1o5hA 166 :ETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVW Number of specific fragments extracted= 6 number of extra gaps= 0 total=2313 Number of alignments=303 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGN 1o5hA 14 :MVAERKPTPGGGAVGSVVGAMACALAEMVANFTRKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIR 1o5hA 52 :YEDVEPEMERIVEAMEEARLKLFDLA T0365 82 :RTDLL 1o5hA 78 :KKDME T0365 91 :QQDKI 1o5hA 83 :AFEKV T0365 106 :VIGRQL 1o5hA 88 :MKAYKS T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDF 1o5hA 94 :SEGELQNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDT T0365 158 :VAKMINELDIIE 1o5hA 141 :AADLCHAVFQVE T0365 176 :QIQLRRQLFALES 1o5hA 153 :KVNVLINLKEISD T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1o5hA 166 :ETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVW Number of specific fragments extracted= 9 number of extra gaps= 0 total=2322 Number of alignments=304 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)L190 because last residue in template chain is (1o5hA)S201 T0365 3 :V 1o5hA 8 :L T0365 4 :NSILGVFAKSP 1o5hA 10 :EFCDMVAERKP T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATIT 1o5hA 22 :PGGGAVGSVVGAMACALAEMVANFTRK T0365 42 :GNWDDAVQIRKQISLAEKQG 1o5hA 50 :KGYEDVEPEMERIVEAMEEA T0365 63 :SLKREIRLTLPSG 1o5hA 82 :EAFEKVMKAYKSS T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLIN T0365 145 :LLEA 1o5hA 160 :LKEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 8 number of extra gaps= 0 total=2330 Number of alignments=305 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1o5hA)E2 Warning: unaligning (T0365)L190 because last residue in template chain is (1o5hA)S201 T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAKKDMEA T0365 72 :LPSG 1o5hA 87 :VMKA T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 150 :F 1o5hA 163 :I T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVWS Number of specific fragments extracted= 7 number of extra gaps= 0 total=2337 Number of alignments=306 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 160 :KMINELDIIEEDTDDLQIQLRRQL 1o5hA 171 :NMLEELEEQEAQIEGCYQRVKKML Number of specific fragments extracted= 1 number of extra gaps= 0 total=2338 Number of alignments=307 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 23 :DKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEK 1o5hA 60 :ERIVEAMEEARLKLFDLAKKDMEAFEKVMKAYKSSEG T0365 67 :EIRLTLPSGLFMPVE 1o5hA 97 :ELQNALKEAASVPMD T0365 95 :IANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGL 1o5hA 112 :VIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQV T0365 135 :AQQVINELDDLLEAGFRGR 1o5hA 153 :KVNVLINLKEISDETFRKN T0365 161 :MINELDIIEEDTDDLQIQLRRQL 1o5hA 172 :MLEELEEQEAQIEGCYQRVKKML Number of specific fragments extracted= 5 number of extra gaps= 0 total=2343 Number of alignments=308 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQ 1o5hA 51 :GYEDVEPEMERIVEAMEEARLKLFDLAKKDMEAFEKVMKAYKSSEGELQNA T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1o5hA 102 :LKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLIN T0365 145 :LLEA 1o5hA 160 :LKEI T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKMLEGIVW Number of specific fragments extracted= 4 number of extra gaps= 0 total=2347 Number of alignments=309 # 1o5hA read from 1o5hA/merged-a2m # found chain 1o5hA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1o5hA)E2 T0365 10 :FAKSPIKPLQEHMD 1o5hA 3 :VERLSLKEFCDMVA T0365 24 :KVYDCASLLVPFFEATITGN 1o5hA 31 :VGAMACALAEMVANFTRKKK T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1o5hA 56 :EPEMERIVEAMEEARLKLFDLAKKDMEA T0365 72 :LPSG 1o5hA 87 :VMKA T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1o5hA 99 :QNALKEAASVPMDVIRVMKDLAHELEKLAEFGNKNLASDTLNAADLCHAVFQVEKVNVLINLK T0365 150 :F 1o5hA 163 :I T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQL 1o5hA 164 :SDETFRKNMLEELEEQEAQIEGCYQRVKKML Number of specific fragments extracted= 7 number of extra gaps= 0 total=2354 Number of alignments=310 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kgnA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kgnA expands to /projects/compbio/data/pdb/1kgn.pdb.gz 1kgnA:# T0365 read from 1kgnA/merged-a2m # 1kgnA read from 1kgnA/merged-a2m # adding 1kgnA to template set # found chain 1kgnA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1kgnA)S2 Warning: unaligning (T0365)R225 because last residue in template chain is (1kgnA)S297 T0365 10 :FAKSPIKPLQEHMDKVYD 1kgnA 3 :NEYDEYIANHTDPVKAIN T0365 28 :CASLLVPFFEATITGNWDDA 1kgnA 25 :PDEKDLEVWDRLTGNFWLPE T0365 48 :VQIRKQISLAEKQGDSL 1kgnA 68 :RVFTGLTLLDTIQGTVG T0365 65 :KREIRLT 1kgnA 86 :ISLLPDA T0365 72 :LPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQ 1kgnA 118 :IFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVAS T0365 120 :PFIAYLQR 1kgnA 177 :YLPMYLSS T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMIN 1kgnA 206 :GYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYE T0365 164 :ELDIIEEDTDD 1kgnA 243 :EIEYTEDIYDD T0365 184 :FALESEL 1kgnA 254 :LGWTEDV T0365 195 :VMFLYKTIEWVGGLADLAERVGS 1kgnA 261 :KRFLRYNANKALNNLGYEGLFPT T0365 218 :RLELMLA 1kgnA 290 :PAILSSL Number of specific fragments extracted= 11 number of extra gaps= 0 total=2365 Number of alignments=311 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)R225 because last residue in template chain is (1kgnA)S297 T0365 1 :MPVNSILGVFAKSPIKPLQ 1kgnA 2 :SNEYDEYIANHTDPVKAIN T0365 24 :KVYDCASLLVPFFEATITGNWDDA 1kgnA 21 :WNVIPDEKDLEVWDRLTGNFWLPE T0365 48 :VQI 1kgnA 53 :QSW T0365 51 :RKQISLAEKQGDSL 1kgnA 71 :TGLTLLDTIQGTVG T0365 65 :K 1kgnA 89 :L T0365 66 :REIRL 1kgnA 95 :MHEEA T0365 71 :TLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQ 1kgnA 117 :NIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVAS T0365 119 :VPFI 1kgnA 174 :SGFY T0365 123 :AYLQR 1kgnA 180 :MYLSS T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMIN 1kgnA 206 :GYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYE T0365 164 :ELDIIEEDTDD 1kgnA 243 :EIEYTEDIYDD T0365 184 :FALESELNP 1kgnA 254 :LGWTEDVKR T0365 195 :VMFLYKTIEWVGGLADLAERVG 1kgnA 264 :LRYNANKALNNLGYEGLFPTDE T0365 217 :SRLELMLA 1kgnA 289 :SPAILSSL Number of specific fragments extracted= 14 number of extra gaps= 0 total=2379 Number of alignments=312 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMIN 1kgnA 206 :GYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYE T0365 164 :ELDIIEEDTDDLQI 1kgnA 243 :EIEYTEDIYDDLGW Number of specific fragments extracted= 2 number of extra gaps= 0 total=2381 Number of alignments=313 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 76 :LFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQ 1kgnA 122 :LASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVAS T0365 119 :VPFI 1kgnA 174 :SGFY T0365 123 :AYLQR 1kgnA 180 :MYLSS T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMIN 1kgnA 206 :GYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYE T0365 164 :ELDIIEEDTDDLQ 1kgnA 243 :EIEYTEDIYDDLG Number of specific fragments extracted= 5 number of extra gaps= 0 total=2386 Number of alignments=314 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)D210 because last residue in template chain is (1kgnA)S297 T0365 1 :MPVN 1kgnA 9 :IANH T0365 5 :SILGVFAKSPIK 1kgnA 14 :DPVKAINWNVIP T0365 17 :PLQEHMDKVYDCASLLVPFFEATITGNW 1kgnA 57 :KMTPQEQLATMRVFTGLTLLDTIQGTVG T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1kgnA 86 :ISLLPDAETMHEEAVYTNIAFMESVHA T0365 72 :LPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVP 1kgnA 118 :IFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTL T0365 121 :FIAYLQR 1kgnA 178 :LPMYLSS T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMI 1kgnA 206 :GYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLY T0365 163 :NELDIIEEDTDDLQI 1kgnA 242 :NEIEYTEDIYDDLGW T0365 178 :QLRRQLFALESELNPVDVMFLYKTIEWVGGLA 1kgnA 265 :RYNANKALNNLGYEGLFPTDETKVSPAILSSL Number of specific fragments extracted= 9 number of extra gaps= 0 total=2395 Number of alignments=315 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1kgnA)S2 T0365 8 :GVFAKSPI 1kgnA 3 :NEYDEYIA T0365 16 :KP 1kgnA 17 :KA T0365 18 :LQEHMDKVYDCASLLVPFFEATITGNW 1kgnA 58 :MTPQEQLATMRVFTGLTLLDTIQGTVG T0365 45 :DDAVQIRKQISLAEKQGDSLKREIR 1kgnA 86 :ISLLPDAETMHEEAVYTNIAFMESV T0365 70 :LTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQ 1kgnA 116 :SNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVAS T0365 119 :VPFIA 1kgnA 174 :SGFYL T0365 124 :YLQR 1kgnA 181 :YLSS T0365 128 :CID 1kgnA 191 :TAD T0365 131 :AVGLAQQVINELDDL 1kgnA 209 :IGYKYQQGVKKLSEA T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQL 1kgnA 224 :EQEEYKAYTFDLMYDLYENEIEYTEDIYDD T0365 188 :SELNP 1kgnA 254 :LGWTE T0365 194 :DVM 1kgnA 259 :DVK T0365 198 :LY 1kgnA 262 :RF T0365 202 :IEWVGG 1kgnA 264 :LRYNAN T0365 208 :LADLAERVG 1kgnA 274 :NLGYEGLFP T0365 217 :SRLELMLA 1kgnA 287 :KVSPAILS Number of specific fragments extracted= 16 number of extra gaps= 0 total=2411 Number of alignments=316 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 76 :LFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLL 1kgnA 122 :LASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPL Number of specific fragments extracted= 1 number of extra gaps= 0 total=2412 Number of alignments=317 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 75 :GLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQ 1kgnA 121 :TLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVAS T0365 119 :VPFIA 1kgnA 174 :SGFYL T0365 124 :YLQR 1kgnA 181 :YLSS T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMI 1kgnA 206 :GYYIGYKYQQGVKKLSEAEQEEYKAYTFDLMYDLY Number of specific fragments extracted= 4 number of extra gaps= 0 total=2416 Number of alignments=318 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIR 1kgnA 6 :DEYIANHTDPVKAINWNVIPDEKDLEVWDRLTGNFWLPEKIPVSNDIQSWN T0365 53 :QISLAEKQG 1kgnA 57 :KMTPQEQLA T0365 62 :DSLKREIRLT 1kgnA 86 :ISLLPDAETM T0365 72 :LPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQ 1kgnA 118 :IFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVAS T0365 123 :AYLQRCIDAVGLAQQVINELDDLLEAGFRGRE 1kgnA 165 :TLLESFLFYSGFYLPMYLSSRAKLTNTADIIR T0365 155 :VDFVAKMINELD 1kgnA 210 :GYKYQQGVKKLS T0365 167 :IIEEDTDDLQIQLRRQLFALESELNPV 1kgnA 227 :EYKAYTFDLMYDLYENEIEYTEDIYDD T0365 195 :VMFLYKTIEWVGGLADLAERV 1kgnA 254 :LGWTEDVKRFLRYNANKALNN T0365 216 :GSRLELMLARV 1kgnA 286 :TKVSPAILSSL Number of specific fragments extracted= 9 number of extra gaps= 0 total=2425 Number of alignments=319 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 3 :VNSIL 1kgnA 3 :NEYDE T0365 8 :GVFAKSPIKPLQEHMDKVYDCAS 1kgnA 9 :IANHTDPVKAINWNVIPDEKDLE T0365 31 :LLVPFFEA 1kgnA 36 :LTGNFWLP T0365 39 :TITG 1kgnA 57 :KMTP T0365 43 :NWDDAVQIRKQISLAEKQ 1kgnA 75 :LLDTIQGTVGAISLLPDA T0365 62 :DSLKREIRL 1kgnA 93 :ETMHEEAVY T0365 71 :TLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQ 1kgnA 117 :NIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVAS T0365 119 :VPF 1kgnA 174 :SGF T0365 122 :IAYLQR 1kgnA 179 :PMYLSS T0365 128 :CIDAVGLAQQVINELDDLLE 1kgnA 206 :GYYIGYKYQQGVKKLSEAEQ T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQL 1kgnA 226 :EEYKAYTFDLMYDLYENEIEYTEDIYDD T0365 195 :VMFLYKTIEWVGGLADLAER 1kgnA 254 :LGWTEDVKRFLRYNANKALN T0365 215 :VGSRLELMLARV 1kgnA 285 :ETKVSPAILSSL Number of specific fragments extracted= 13 number of extra gaps= 0 total=2438 Number of alignments=320 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 76 :LFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLL 1kgnA 122 :LASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPL Number of specific fragments extracted= 1 number of extra gaps= 0 total=2439 Number of alignments=321 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 75 :GLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQ 1kgnA 121 :TLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2440 Number of alignments=322 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 163 :NELDIIEEDTDDL 1kgnA 242 :NEIEYTEDIYDDL Number of specific fragments extracted= 1 number of extra gaps= 0 total=2441 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 62 :DSLKREIRLTL 1kgnA 156 :DPLKKKVASTL T0365 73 :PSGLFMPVE 1kgnA 173 :YSGFYLPMY T0365 89 :LTQQDKIANKAKDI 1kgnA 182 :LSSRAKLTNTADII T0365 109 :RQLLIPQALQVPFIAYL 1kgnA 196 :RLIIRDESVHGYYIGYK T0365 135 :AQQVINELDDLLEAGFRGREVDFVAKMI 1kgnA 213 :YQQGVKKLSEAEQEEYKAYTFDLMYDLY T0365 163 :NELDIIEEDTDDL 1kgnA 242 :NEIEYTEDIYDDL Number of specific fragments extracted= 6 number of extra gaps= 0 total=2447 Number of alignments=323 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1kgnA)S2 T0365 12 :KSPIKPLQEHMDKVYDCASLLVPFF 1kgnA 3 :NEYDEYIANHTDPVKAINWNVIPDE T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVER 1kgnA 28 :KDLEVWDRLTGNFWLPEKIPVSNDIQSWNKMTPQEQLATMR T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLL 1kgnA 69 :VFTGLTLLDTIQGTVGAISLLPDAETMH T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1kgnA 97 :EEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLE T0365 188 :SELNPVDVMFLYKTIEW 1kgnA 169 :SFLFYSGFYLPMYLSSR T0365 210 :DLAERVGSRLELMLAR 1kgnA 186 :AKLTNTADIIRLIIRD T0365 226 :V 1kgnA 204 :V Number of specific fragments extracted= 7 number of extra gaps= 0 total=2454 Number of alignments=324 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 12 :KSPIKPLQEHMDKV 1kgnA 3 :NEYDEYIANHTDPV T0365 48 :VQIRKQISL 1kgnA 17 :KAINWNVIP T0365 62 :DSLKREIRLTLPSGLFMPV 1kgnA 26 :DEKDLEVWDRLTGNFWLPE T0365 82 :RTDL 1kgnA 49 :SNDI T0365 87 :ELLTQ 1kgnA 63 :QLATM T0365 94 :KIANKAKDISGRVIGR 1kgnA 74 :TLLDTIQGTVGAISLL T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1kgnA 93 :ETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLE T0365 188 :SELNPVDVMFLYKTIE 1kgnA 169 :SFLFYSGFYLPMYLSS T0365 209 :ADLAERVGSRLELMLAR 1kgnA 185 :RAKLTNTADIIRLIIRD Number of specific fragments extracted= 9 number of extra gaps= 0 total=2463 Number of alignments=325 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 3 :VN 1kgnA 3 :NE T0365 5 :SILGVFAKS 1kgnA 8 :YIANHTDPV T0365 14 :PIK 1kgnA 18 :AIN T0365 42 :GNWD 1kgnA 22 :NVIP T0365 62 :DSLKREIRLTLPSGLFMPV 1kgnA 26 :DEKDLEVWDRLTGNFWLPE T0365 81 :ERTDLLELLTQQD 1kgnA 59 :TPQEQLATMRVFT T0365 94 :KIANKAKDISGRVIG 1kgnA 74 :TLLDTIQGTVGAISL T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINEL 1kgnA 89 :LPDAETMHEEAVYTNIAFMESVHAKSYSNI T0365 143 :DDL 1kgnA 120 :MTL T0365 153 :REVDFV 1kgnA 123 :ASTPQI T0365 163 :NELDIIEEDTDDLQI 1kgnA 129 :NEAFRWSEENENLQR T0365 179 :LRRQLFALESELNPVDVMFLYKTIEW 1kgnA 144 :KAKIIMSYYNGDDPLKKKVASTLLES T0365 205 :VGGLADL 1kgnA 178 :LPMYLSS T0365 212 :AERVGSRLELMLAR 1kgnA 188 :LTNTADIIRLIIRD Number of specific fragments extracted= 14 number of extra gaps= 0 total=2477 Number of alignments=326 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 3 :V 1kgnA 3 :N T0365 4 :NSILGVFAKS 1kgnA 7 :EYIANHTDPV T0365 14 :PIKPLQEHMDKVY 1kgnA 25 :PDEKDLEVWDRLT T0365 27 :DCASLLVPFFEATI 1kgnA 64 :LATMRVFTGLTLLD T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1kgnA 92 :AETMHEEAVYTNIAFMESVHAKSYSNIFMTLAS T0365 83 :TDLLELLTQQDKIAN 1kgnA 139 :ENLQRKAKIIMSYYN T0365 104 :GRVIGR 1kgnA 163 :ASTLLE T0365 110 :QLLIP 1kgnA 181 :YLSSR T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINE 1kgnA 186 :AKLTNTADIIRLIIRDESVHGYYIGY T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1kgnA 212 :KYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG T0365 191 :NPVDVMFLYKT 1kgnA 256 :WTEDVKRFLRY T0365 202 :IEWVG 1kgnA 269 :NKALN T0365 207 :GLADLA 1kgnA 291 :AILSSL Number of specific fragments extracted= 13 number of extra gaps= 0 total=2490 Number of alignments=327 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 62 :DSLKREIRLTLPSGLFMP 1kgnA 26 :DEKDLEVWDRLTGNFWLP Number of specific fragments extracted= 1 number of extra gaps= 0 total=2491 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 48 :VQIRKQISL 1kgnA 17 :KAINWNVIP T0365 62 :DSLKREIRLTLPSGLFMPVE 1kgnA 26 :DEKDLEVWDRLTGNFWLPEK T0365 96 :ANKAKDISGRV 1kgnA 46 :IPVSNDIQSWN T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1kgnA 57 :KMTPQEQLATMRVFTGLTLLDTIQGTVGAISLLPD T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1kgnA 92 :AETMHEEAVYTNIAFMESVHAKSYSNIFMTLA Number of specific fragments extracted= 5 number of extra gaps= 0 total=2496 Number of alignments=328 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 95 :IANKAKDISGRVIG 1kgnA 75 :LLDTIQGTVGAISL T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINEL 1kgnA 89 :LPDAETMHEEAVYTNIAFMESVHAKSYSNI T0365 143 :DDL 1kgnA 120 :MTL T0365 153 :REVDFV 1kgnA 123 :ASTPQI T0365 163 :NELDIIEEDTDDLQI 1kgnA 129 :NEAFRWSEENENLQR T0365 179 :LRRQLFALESELNPVDVMFLYKTIEW 1kgnA 144 :KAKIIMSYYNGDDPLKKKVASTLLES T0365 205 :VGGLADL 1kgnA 178 :LPMYLSS T0365 212 :AERVGSRLELML 1kgnA 188 :LTNTADIIRLII Number of specific fragments extracted= 8 number of extra gaps= 0 total=2504 Number of alignments=329 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 9 :VFAKSPIKPLQEHMDKVYDCASLLVPFFEATIT 1kgnA 88 :LLPDAETMHEEAVYTNIAFMESVHAKSYSNIFM T0365 42 :GNWD 1kgnA 123 :ASTP T0365 50 :IRKQISLAEKQG 1kgnA 127 :QINEAFRWSEEN T0365 83 :TDLLELLTQQDKIAN 1kgnA 139 :ENLQRKAKIIMSYYN T0365 99 :A 1kgnA 167 :L T0365 102 :ISGRVIGRQLLIP 1kgnA 173 :YSGFYLPMYLSSR T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINE 1kgnA 186 :AKLTNTADIIRLIIRDESVHGYYIGY T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1kgnA 212 :KYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG T0365 191 :NPVDVMFLYKTI 1kgnA 256 :WTEDVKRFLRYN T0365 209 :A 1kgnA 268 :A Number of specific fragments extracted= 10 number of extra gaps= 0 total=2514 Number of alignments=330 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1kgnA)S2 T0365 12 :KSPIKPLQEHMDKVYDCASLLVPFF 1kgnA 3 :NEYDEYIANHTDPVKAINWNVIPDE T0365 42 :GNWDDAVQIRKQISLAEK 1kgnA 28 :KDLEVWDRLTGNFWLPEK T0365 66 :REIRLTLPS 1kgnA 46 :IPVSNDIQS T0365 75 :GLFMPVERTDLLELLTQQ 1kgnA 56 :NKMTPQEQLATMRVFTGL T0365 94 :KIANKAKDISGRVIGR 1kgnA 74 :TLLDTIQGTVGAISLL T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1kgnA 93 :ETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLE T0365 188 :SELNPVDVMFLYKTIEW 1kgnA 169 :SFLFYSGFYLPMYLSSR T0365 210 :DLAERVGSRLELMLAR 1kgnA 186 :AKLTNTADIIRLIIRD T0365 226 :V 1kgnA 203 :S Number of specific fragments extracted= 9 number of extra gaps= 0 total=2523 Number of alignments=331 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 12 :KSPIKPLQEHMDKVYDCASLLVP 1kgnA 3 :NEYDEYIANHTDPVKAINWNVIP T0365 57 :AEK 1kgnA 26 :DEK T0365 65 :KREIRLTLPSGLFMPVERT 1kgnA 29 :DLEVWDRLTGNFWLPEKIP T0365 84 :DLLELLTQQ 1kgnA 65 :ATMRVFTGL T0365 94 :KIANKAKDISGRVIGR 1kgnA 74 :TLLDTIQGTVGAISLL T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1kgnA 93 :ETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLES T0365 187 :ESELNPVDVMFLYKT 1kgnA 171 :LFYSGFYLPMYLSSR T0365 210 :DLAERVGSRLELMLAR 1kgnA 186 :AKLTNTADIIRLIIRD T0365 226 :V 1kgnA 203 :S Number of specific fragments extracted= 9 number of extra gaps= 0 total=2532 Number of alignments=332 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 3 :VN 1kgnA 3 :NE T0365 5 :SILGVFAKS 1kgnA 8 :YIANHTDPV T0365 41 :TGNWDDAVQIRKQISL 1kgnA 23 :VIPDEKDLEVWDRLTG T0365 72 :LPSGLFMPVERT 1kgnA 42 :LPEKIPVSNDIQ T0365 84 :DLLELLTQQ 1kgnA 65 :ATMRVFTGL T0365 94 :KIANKAKDISGRVIGR 1kgnA 74 :TLLDTIQGTVGAISLL T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINEL 1kgnA 90 :PDAETMHEEAVYTNIAFMESVHAKSYSNI T0365 143 :DDL 1kgnA 120 :MTL T0365 153 :REVDFV 1kgnA 123 :ASTPQI T0365 163 :NELDIIEEDTDDLQI 1kgnA 129 :NEAFRWSEENENLQR T0365 179 :LRRQLFALESELNPVDVMFLYKTIEW 1kgnA 144 :KAKIIMSYYNGDDPLKKKVASTLLES T0365 205 :VGGLAD 1kgnA 178 :LPMYLS T0365 211 :LAERVGSRLELMLAR 1kgnA 187 :KLTNTADIIRLIIRD Number of specific fragments extracted= 13 number of extra gaps= 0 total=2545 Number of alignments=333 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 Warning: unaligning (T0365)A224 because last residue in template chain is (1kgnA)S297 T0365 3 :VN 1kgnA 3 :NE T0365 5 :SILGVFAKS 1kgnA 8 :YIANHTDPV T0365 14 :PIKPLQEHMDKVY 1kgnA 25 :PDEKDLEVWDRLT T0365 27 :DCASLLVPFFEATI 1kgnA 64 :LATMRVFTGLTLLD T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1kgnA 92 :AETMHEEAVYTNIAFMESVHAKSYSNIFMTLAS T0365 83 :TDLLELLTQQDKIAN 1kgnA 139 :ENLQRKAKIIMSYYN T0365 98 :KAKDISGRVIGR 1kgnA 160 :KKVASTLLESFL T0365 110 :QL 1kgnA 183 :SS T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVI 1kgnA 185 :RAKLTNTADIIRLIIRDESVHGYYI T0365 143 :DDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1kgnA 210 :GYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG T0365 191 :NPVDVMFLYKT 1kgnA 256 :WTEDVKRFLRY T0365 208 :LADLAERV 1kgnA 267 :NANKALNN T0365 218 :RLELML 1kgnA 291 :AILSSL Number of specific fragments extracted= 13 number of extra gaps= 0 total=2558 Number of alignments=334 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 62 :DSLKREIRLTLPSGLFMP 1kgnA 26 :DEKDLEVWDRLTGNFWLP Number of specific fragments extracted= 1 number of extra gaps= 0 total=2559 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 64 :LKREIRLTLPSGLFMPVE 1kgnA 28 :KDLEVWDRLTGNFWLPEK T0365 96 :ANKAKDISGRVIGRQL 1kgnA 46 :IPVSNDIQSWNKMTPQ T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1kgnA 62 :EQLATMRVFTGLTLLDTIQGTVGAISLLPD T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1kgnA 92 :AETMHEEAVYTNIAFMESVHAKSYSNIFMTLASTP Number of specific fragments extracted= 4 number of extra gaps= 0 total=2563 Number of alignments=335 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 20 :EHMDKVYDCASLLVPFFEATIT 1kgnA 99 :AVYTNIAFMESVHAKSYSNIFM T0365 42 :GNWDDA 1kgnA 123 :ASTPQI T0365 52 :KQISLAEKQGDSLKREI 1kgnA 129 :NEAFRWSEENENLQRKA T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGR 1kgnA 146 :KIIMSYYNGDDPLKKKVASTLLESFLF T0365 110 :QL 1kgnA 183 :SS T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINE 1kgnA 185 :RAKLTNTADIIRLIIRDESVHGYYIGY T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWV 1kgnA 212 :KYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLGWTEDVKRFLRYNANKAL Number of specific fragments extracted= 7 number of extra gaps= 0 total=2570 Number of alignments=336 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFEATIT 1kgnA 87 :SLLPDAETMHEEAVYTNIAFMESVHAKSYSNIFM T0365 42 :GNWD 1kgnA 123 :ASTP T0365 50 :IRKQISLAEKQGDSLKREI 1kgnA 127 :QINEAFRWSEENENLQRKA T0365 83 :TDLLELLT 1kgnA 146 :KIIMSYYN T0365 96 :ANKAKDISGRVIGR 1kgnA 158 :LKKKVASTLLESFL T0365 110 :QL 1kgnA 183 :SS T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVI 1kgnA 185 :RAKLTNTADIIRLIIRDESVHGYYI T0365 143 :DDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1kgnA 210 :GYKYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG T0365 191 :NPVDVMFLYKT 1kgnA 256 :WTEDVKRFLRY T0365 208 :LADLA 1kgnA 267 :NANKA Number of specific fragments extracted= 10 number of extra gaps= 0 total=2580 Number of alignments=337 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1kgnA)S2 T0365 12 :KSPIKPLQEHMDKVYDCASLLVPFFE 1kgnA 3 :NEYDEYIANHTDPVKAINWNVIPDEK T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVER 1kgnA 29 :DLEVWDRLTGNFWLPEKIPVSNDIQSWNKMTPQEQLATMR T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQL 1kgnA 69 :VFTGLTLLDTIQGTVGAISLLPDAETM T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLAD 1kgnA 96 :HEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKLTNTAD T0365 218 :RLELMLARV 1kgnA 194 :IIRLIIRDE Number of specific fragments extracted= 5 number of extra gaps= 0 total=2585 Number of alignments=338 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 34 :PFFEATITGNWDDAVQIRKQISLAEK 1kgnA 3 :NEYDEYIANHTDPVKAINWNVIPDEK T0365 65 :KREIRLTLPSGLFMPVE 1kgnA 29 :DLEVWDRLTGNFWLPEK T0365 83 :TDLLELLTQQD 1kgnA 50 :NDIQSWNKMTP T0365 95 :IANKAKDISGRVIGRQLL 1kgnA 75 :LLDTIQGTVGAISLLPDA T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWV 1kgnA 96 :HEEAVYTNIAFMESVHAKSYSNIFMTLASTPQINEAFRWSEENENLQRKAKIIMSYYNGDDPLKKKVASTLLESFLFYSGFYLPMYLSSRAKL T0365 213 :ERVGSRLELMLAR 1kgnA 189 :TNTADIIRLIIRD Number of specific fragments extracted= 6 number of extra gaps= 0 total=2591 Number of alignments=339 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 3 :VNSILGVFAKS 1kgnA 3 :NEYDEYIANHT T0365 14 :P 1kgnA 15 :P T0365 40 :ITGNWDDAVQIRKQISL 1kgnA 22 :NVIPDEKDLEVWDRLTG T0365 71 :TLPSGLFMP 1kgnA 39 :NFWLPEKIP T0365 80 :VERTDLLELLTQQ 1kgnA 58 :MTPQEQLATMRVF T0365 94 :KIANKAKDISGRVIGRQLL 1kgnA 74 :TLLDTIQGTVGAISLLPDA T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVIN 1kgnA 96 :HEEAVYTNIAFMESVHAKSYSNIFMTLA T0365 151 :RGREVDFVAKMINE 1kgnA 124 :STPQINEAFRWSEE T0365 173 :DDLQIQLRRQLFALESELNPVDVMFLYKTIE 1kgnA 138 :NENLQRKAKIIMSYYNGDDPLKKKVASTLLE T0365 207 :GLADL 1kgnA 181 :YLSSR T0365 213 :ERVGSRLELMLA 1kgnA 189 :TNTADIIRLIIR Number of specific fragments extracted= 11 number of extra gaps= 0 total=2602 Number of alignments=340 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1kgnA)S2 T0365 3 :V 1kgnA 3 :N T0365 4 :NSILGVFAKSPIKPLQEHMDKVY 1kgnA 15 :PVKAINWNVIPDEKDLEVWDRLT T0365 28 :CASLLVPFFEATI 1kgnA 62 :EQLATMRVFTGLT T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTL 1kgnA 92 :AETMHEEAVYTNIAFMESVHAKSYSNIFMTL T0365 80 :VERTDLLELLTQQDK 1kgnA 123 :ASTPQINEAFRWSEE T0365 98 :KAKDISGRVIGR 1kgnA 140 :NLQRKAKIIMSY T0365 115 :QALQ 1kgnA 156 :DPLK T0365 119 :VPFIAYLQRCIDAVGLAQQVINE 1kgnA 189 :TNTADIIRLIIRDESVHGYYIGY T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1kgnA 212 :KYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG T0365 191 :NPVDVMFLYKTI 1kgnA 256 :WTEDVKRFLRYN T0365 209 :ADLAER 1kgnA 268 :ANKALN Number of specific fragments extracted= 11 number of extra gaps= 0 total=2613 Number of alignments=341 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 62 :DSLKREIRLTLPSGLFMP 1kgnA 26 :DEKDLEVWDRLTGNFWLP Number of specific fragments extracted= 1 number of extra gaps= 0 total=2614 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 72 :LPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQL 1kgnA 172 :FYSGFYLPMYLSSRAKLTNTADIIRLIIRDESVHGYYIGY Number of specific fragments extracted= 1 number of extra gaps= 0 total=2615 Number of alignments=342 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 15 :IKPLQEHMDKVYDCASLLVPFFE 1kgnA 101 :YTNIAFMESVHAKSYSNIFMTLA T0365 43 :NWDDAVQIRKQISLA 1kgnA 124 :STPQINEAFRWSEEN T0365 83 :TDLLELLTQQDKIAN 1kgnA 139 :ENLQRKAKIIMSYYN T0365 98 :KAKDISGR 1kgnA 158 :LKKKVAST T0365 106 :VIGRQLLIPQALQ 1kgnA 180 :MYLSSRAKLTNTA T0365 123 :AYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINEL 1kgnA 193 :DIIRLIIRDESVHGYYIGYKYQQGVKKLSEAEQEEYKAYTFDL T0365 169 :EEDTDDLQIQLRRQLFALESELNPVDVMFLYK 1kgnA 236 :MYDLYENEIEYTEDIYDDLGWTEDVKRFLRYN Number of specific fragments extracted= 7 number of extra gaps= 0 total=2622 Number of alignments=343 # 1kgnA read from 1kgnA/merged-a2m # found chain 1kgnA in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATIT 1kgnA 95 :MHEEAVYTNIAFMESVHAKSYSNIFM T0365 43 :NWD 1kgnA 124 :STP T0365 50 :IRKQISLAEKQ 1kgnA 127 :QINEAFRWSEE T0365 82 :RTDLLELLTQQDKIAN 1kgnA 138 :NENLQRKAKIIMSYYN T0365 98 :KAKDISGRVIG 1kgnA 157 :PLKKKVASTLL T0365 119 :VPFIAYLQRCIDAVGLAQQVINE 1kgnA 189 :TNTADIIRLIIRDESVHGYYIGY T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1kgnA 212 :KYQQGVKKLSEAEQEEYKAYTFDLMYDLYENEIEYTEDIYDDLG T0365 191 :NPVDVMFLYKTI 1kgnA 256 :WTEDVKRFLRYN T0365 209 :ADL 1kgnA 268 :ANK Number of specific fragments extracted= 9 number of extra gaps= 0 total=2631 Number of alignments=344 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xwmA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1xwmA/merged-a2m # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEV T0365 69 :RLTLP 1xwmA 61 :DFALW T0365 74 :SGLFMPVER 1xwmA 67 :IAAQQPVAT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 81 :VAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESEL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAVAKTD T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1xwmA 174 :AATLAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 6 number of extra gaps= 0 total=2637 Number of alignments=345 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEV T0365 69 :RLTL 1xwmA 61 :DFAL T0365 73 :PSGLFMPVER 1xwmA 66 :LIAAQQPVAT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 81 :VAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESEL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAVAKTD T0365 191 :NPVDVMFLYKTIEWVGGLA 1xwmA 179 :QMNVLALVARYIERTADHA T0365 210 :DLAERVGSRLELMLARV 1xwmA 199 :NIAEHLVYLVKGKHYDF Number of specific fragments extracted= 7 number of extra gaps= 0 total=2644 Number of alignments=346 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEV T0365 69 :RLTLP 1xwmA 61 :DFALW T0365 74 :SGLFMPVER 1xwmA 67 :IAAQQPVAT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 81 :VAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELNPVDVMFLYKTIEWVGGLA 1xwmA 175 :ATLAQMNVLALVARYIERTADHA Number of specific fragments extracted= 6 number of extra gaps= 0 total=2650 Number of alignments=347 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 18 :LQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1xwmA 9 :LASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEV T0365 69 :RLTL 1xwmA 61 :DFAL T0365 73 :PSGLFMPVER 1xwmA 66 :LIAAQQPVAT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 81 :VAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESEL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAVAKTD T0365 191 :N 1xwmA 176 :T T0365 192 :PVDVMFLYKTIEWVGGL 1xwmA 180 :MNVLALVARYIERTADH Number of specific fragments extracted= 7 number of extra gaps= 0 total=2657 Number of alignments=348 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAA T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 77 :LRRIVAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFA 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLA T0365 186 :LESELNP 1xwmA 171 :KTDAATL T0365 193 :VDVMFLYKTIEWVGGLA 1xwmA 181 :NVLALVARYIERTADHA T0365 210 :DLAERVGSRLELMLARV 1xwmA 199 :NIAEHLVYLVKGKHYDF Number of specific fragments extracted= 6 number of extra gaps= 0 total=2663 Number of alignments=349 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1xwmA)T4 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNW 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNA T0365 49 :QIRKQISLAEKQGDSLKREIRLTLPSGLFM 1xwmA 40 :NLAMAVIDGDGSIDALEEEVNDFALWLIAA T0365 79 :PVER 1xwmA 72 :PVAT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQ 1xwmA 81 :VAAIKIASDIERIADFAVNIAKACIRIG T0365 111 :LLIP 1xwmA 112 :FVMD T0365 118 :QVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 116 :IGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFA 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLA T0365 186 :LESELNP 1xwmA 171 :KTDAATL T0365 193 :VDVMFLYKTIEWVGGLA 1xwmA 181 :NVLALVARYIERTADHA T0365 210 :DLAERVGSRLELMLARV 1xwmA 199 :NIAEHLVYLVKGKHYDF Number of specific fragments extracted= 10 number of extra gaps= 0 total=2673 Number of alignments=350 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAA T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 77 :LRRIVAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFA 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLA T0365 186 :LESELNP 1xwmA 171 :KTDAATL T0365 193 :VDVMFLYKTIEWVGGLA 1xwmA 181 :NVLALVARYIERTADHA Number of specific fragments extracted= 5 number of extra gaps= 0 total=2678 Number of alignments=351 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 22 :MDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1xwmA 13 :HNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAA T0365 79 :PVER 1xwmA 72 :PVAT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQ 1xwmA 81 :VAAIKIASDIERIADFAVNIAKACIRIG T0365 111 :LLIP 1xwmA 112 :FVMD T0365 118 :QVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 116 :IGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFA 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLA T0365 186 :LESELNP 1xwmA 171 :KTDAATL T0365 193 :VDVMFLYKTIEWVGGLA 1xwmA 181 :NVLALVARYIERTADHA Number of specific fragments extracted= 8 number of extra gaps= 0 total=2686 Number of alignments=352 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1xwmA)T4 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGN 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQN T0365 48 :VQIRKQISLAEKQGDSLKREIRLTLPSGLFMP 1xwmA 39 :ANLAMAVIDGDGSIDALEEEVNDFALWLIAAQ T0365 80 :VERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 78 :RRIVAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELNPVDVMFLYKTIEWVGGLA 1xwmA 175 :ATLAQMNVLALVARYIERTADHA T0365 210 :DLAERVGSRLELMLARV 1xwmA 199 :NIAEHLVYLVKGKHYDF Number of specific fragments extracted= 6 number of extra gaps= 0 total=2692 Number of alignments=353 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 10 :FA 1xwmA 5 :FA T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1xwmA 7 :DDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAA T0365 79 :PVE 1xwmA 72 :PVA T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 80 :IVAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELN 1xwmA 172 :TDAAT T0365 192 :PVDVMFLYKTIEWVGGLA 1xwmA 180 :MNVLALVARYIERTADHA T0365 210 :DLAERVGSRLELMLARV 1xwmA 199 :NIAEHLVYLVKGKHYDF Number of specific fragments extracted= 8 number of extra gaps= 0 total=2700 Number of alignments=354 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 35 :FFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVI 1xwmA 133 :AIAAYDREDASLAAQIADMDHRVDEQYGEMMASLLAVAKTDAATLAQMNVLALVARYIERTADHATNIAEHLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=2701 Number of alignments=355 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 22 :MDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1xwmA 13 :HNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAA T0365 79 :PVE 1xwmA 72 :PVA T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 80 :IVAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELNPVDVMFLYKTIEWVGGLA 1xwmA 175 :ATLAQMNVLALVARYIERTADHA Number of specific fragments extracted= 5 number of extra gaps= 0 total=2706 Number of alignments=356 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 163 :NELDIIEEDTDDLQIQL 1xwmA 50 :GSIDALEEEVNDFALWL Number of specific fragments extracted= 1 number of extra gaps= 0 total=2707 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=2707 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1xwmA)T4 T0365 10 :FAKS 1xwmA 5 :FADD T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDS 1xwmA 12 :LHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVND T0365 66 :REIRLTLPSGLFMPVERT 1xwmA 62 :FALWLIAAQQPVATDLRR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 111 :PFVMDIGPLVLMYRLATDMVSTAIAAYD T0365 156 :DFVAKMINELDIIEEDTDDLQIQLRRQLF 1xwmA 139 :REDASLAAQIADMDHRVDEQYGEMMASLL T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 170 :AKTDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 7 number of extra gaps= 0 total=2714 Number of alignments=357 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1xwmA)T4 T0365 10 :FAKS 1xwmA 5 :FADD T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLK 1xwmA 12 :LHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFA T0365 68 :IRLTLPSGLFMPVERT 1xwmA 64 :LWLIAAQQPVATDLRR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 111 :PFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :RE 1xwmA 140 :ED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 172 :TDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 8 number of extra gaps= 0 total=2722 Number of alignments=358 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASL 1xwmA 5 :FADDLASLHNKLIEMGRL T0365 32 :LVPFFEATITGNWDDAVQIRK 1xwmA 27 :LQQAIEAFQTQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 77 :FMPV 1xwmA 70 :QQPV T0365 81 :ERT 1xwmA 76 :DLR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 111 :PFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALE 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVA T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 10 number of extra gaps= 0 total=2732 Number of alignments=359 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAI T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 80 :VERTDL 1xwmA 72 :PVATDL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQ 1xwmA 111 :PFV T0365 119 :VPFIAYLQRCIDAVGL 1xwmA 117 :GPLVLMYRLATDMVST T0365 138 :VINELDD 1xwmA 133 :AIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQL 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASL T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 11 number of extra gaps= 0 total=2743 Number of alignments=360 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELD 1xwmA 111 :PFVMDIGPLVLMYRLATDMVSTAIAAYD T0365 156 :DFVAKMINELDIIEEDTDDLQIQLRRQLF 1xwmA 139 :REDASLAAQIADMDHRVDEQYGEMMASLL T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1xwmA 170 :AKTDAATLAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 4 number of extra gaps= 0 total=2747 Number of alignments=361 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 46 :DAVQIRKQISLAEKQGDSLK 1xwmA 44 :AVIDGDGSIDALEEEVNDFA T0365 68 :IRLTLPSGLFMPVERT 1xwmA 64 :LWLIAAQQPVATDLRR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 111 :PFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :RE 1xwmA 140 :ED T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 142 :ASLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1xwmA 172 :TDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVK Number of specific fragments extracted= 7 number of extra gaps= 0 total=2754 Number of alignments=362 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASL 1xwmA 5 :FADDLASLHNKLIEMGRL T0365 32 :LVPFFEATITGNWDDAVQIRK 1xwmA 27 :LQQAIEAFQTQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 77 :FMPV 1xwmA 70 :QQPV T0365 81 :ERT 1xwmA 76 :DLR T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 111 :PFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALE 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVA T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 10 number of extra gaps= 0 total=2764 Number of alignments=363 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAI T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 80 :VERTDL 1xwmA 72 :PVATDL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQ T0365 116 :ALQ 1xwmA 111 :PFV T0365 119 :VPFIAYLQRCIDAVGL 1xwmA 117 :GPLVLMYRLATDMVST T0365 138 :VINELDD 1xwmA 133 :AIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQL 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASL T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLVK Number of specific fragments extracted= 11 number of extra gaps= 0 total=2775 Number of alignments=364 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALW T0365 75 :GLFMPVERT 1xwmA 68 :AAQQPVATD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGG T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINE 1xwmA 110 :QPFVMDIGPLVLMYRLATDMVSTAIAA T0365 153 :REVDFV 1xwmA 137 :YDREDA T0365 160 :KMINELDIIEEDTDDLQIQLRRQLF 1xwmA 143 :SLAAQIADMDHRVDEQYGEMMASLL T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 170 :AKTDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 7 number of extra gaps= 0 total=2782 Number of alignments=365 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEV T0365 70 :LTLPS 1xwmA 61 :DFALW T0365 75 :GLFMPVERT 1xwmA 68 :AAQQPVATD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGG T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 110 :QPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REV 1xwmA 140 :EDA T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 143 :SLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 172 :TDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 8 number of extra gaps= 0 total=2790 Number of alignments=366 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASL 1xwmA 5 :FADDLASLHNKLIEMGRL T0365 32 :LVPFFEATITGNWDDAVQIRK 1xwmA 27 :LQQAIEAFQTQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRL 1xwmA 51 :SIDALEEEVNDFALWLIA T0365 76 :LFMPVERT 1xwmA 69 :AQQPVATD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGG T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 110 :QPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REVDF 1xwmA 140 :EDASL T0365 162 :INELDIIEEDTDDLQIQLRRQLFALESE 1xwmA 145 :AAQIADMDHRVDEQYGEMMASLLAVAKT T0365 190 :LNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 175 :ATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 9 number of extra gaps= 0 total=2799 Number of alignments=367 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAI T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 76 :L 1xwmA 71 :Q T0365 80 :VERT 1xwmA 72 :PVAT T0365 84 :DL 1xwmA 79 :RI T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGG T0365 112 :LIPQAL 1xwmA 111 :PFVMDI T0365 119 :VPFIAYLQRCID 1xwmA 117 :GPLVLMYRLATD T0365 134 :LAQQVINELDD 1xwmA 129 :MVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALESE 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVAKT T0365 191 :N 1xwmA 173 :D T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 14 number of extra gaps= 0 total=2813 Number of alignments=368 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALW T0365 75 :GLFMPVERT 1xwmA 68 :AAQQPVATD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGG T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINE 1xwmA 110 :QPFVMDIGPLVLMYRLATDMVSTAIAA T0365 153 :REVDFV 1xwmA 137 :YDREDA T0365 160 :KMINELDIIEEDTDDLQIQLRRQLF 1xwmA 143 :SLAAQIADMDHRVDEQYGEMMASLL T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 170 :AKTDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 7 number of extra gaps= 0 total=2820 Number of alignments=369 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEV T0365 70 :LTLPS 1xwmA 61 :DFALW T0365 75 :GLFMPVERT 1xwmA 68 :AAQQPVATD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGG T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 110 :QPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REV 1xwmA 140 :EDA T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFAL 1xwmA 143 :SLAAQIADMDHRVDEQYGEMMASLLAV T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 172 :TDAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 8 number of extra gaps= 0 total=2828 Number of alignments=370 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASL 1xwmA 5 :FADDLASLHNKLIEMGRL T0365 32 :LVPFFEATITGNWDDAVQIRK 1xwmA 27 :LQQAIEAFQTQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRL 1xwmA 51 :SIDALEEEVNDFALWLIA T0365 76 :LFMPVERT 1xwmA 69 :AQQPVATD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQL 1xwmA 82 :AAIKIASDIERIADFAVNIAKACIRIGG T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1xwmA 110 :QPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REVDF 1xwmA 140 :EDASL T0365 162 :INELDIIEEDTDDLQIQLRRQLFALESE 1xwmA 145 :AAQIADMDHRVDEQYGEMMASLLAVAKT T0365 190 :LNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 175 :ATLAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 9 number of extra gaps= 0 total=2837 Number of alignments=371 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1xwmA)T4 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAI T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 76 :L 1xwmA 71 :Q T0365 80 :VERT 1xwmA 72 :PVAT T0365 84 :DL 1xwmA 79 :RI T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGG T0365 112 :LIPQAL 1xwmA 111 :PFVMDI T0365 119 :VPFIAYLQRCID 1xwmA 117 :GPLVLMYRLATD T0365 134 :LAQQVINELDD 1xwmA 129 :MVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALESE 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVAKT T0365 191 :N 1xwmA 173 :D T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 14 number of extra gaps= 0 total=2851 Number of alignments=372 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1xwmA)T4 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVIDGDGSIDALEEEVNDFALWLIAAQQPVATDLRRIVAAIKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALE 1xwmA 140 :EDASLAAQIADMDHRVDEQYGEMMASLLAVA T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLVKGK Number of specific fragments extracted= 3 number of extra gaps= 0 total=2854 Number of alignments=373 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1xwmA)T4 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWD 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNAN T0365 50 :IRKQISLAEKQGDSLKREI 1xwmA 41 :LAMAVIDGDGSIDALEEEV T0365 69 :RLTLPSGLFMPVERTDL 1xwmA 64 :LWLIAAQQPVATDLRRI T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRE T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFALE 1xwmA 141 :DASLAAQIADMDHRVDEQYGEMMASLLAVA T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLVK Number of specific fragments extracted= 6 number of extra gaps= 0 total=2860 Number of alignments=374 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1xwmA)T4 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRK 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLTLPS 1xwmA 51 :SIDALEEEVNDFALWLIAAQQP T0365 81 :ERTDL 1xwmA 73 :VATDL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REV 1xwmA 140 :EDA T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFALES 1xwmA 143 :SLAAQIADMDHRVDEQYGEMMASLLAVAK T0365 190 :LN 1xwmA 172 :TD T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLVKG Number of specific fragments extracted= 8 number of extra gaps= 0 total=2868 Number of alignments=375 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1xwmA)T4 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFE 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQ T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 80 :VERTD 1xwmA 72 :PVATD T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLLIP 1xwmA 83 :AIKIASDIERIADFAVNIAKACIRIGGQPF T0365 119 :VPFIAYLQRCIDAVGLAQQVINE 1xwmA 117 :GPLVLMYRLATDMVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALES 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVAK T0365 190 :LN 1xwmA 172 :TD T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLVK Number of specific fragments extracted= 10 number of extra gaps= 0 total=2878 Number of alignments=376 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 157 :FVAKMINELDIIEEDTDDLQIQLRRQLFALE 1xwmA 140 :EDASLAAQIADMDHRVDEQYGEMMASLLAVA T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2881 Number of alignments=377 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 87 :ELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1xwmA 85 :KIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDRE T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFALE 1xwmA 141 :DASLAAQIADMDHRVDEQYGEMMASLLAVA T0365 188 :SELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1xwmA 173 :DAATLAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 3 number of extra gaps= 0 total=2884 Number of alignments=378 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set Warning: unaligning (T0365)V9 because first residue in template chain is (1xwmA)T4 T0365 10 :FAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRK 1xwmA 5 :FADDLASLHNKLIEMGRLTEVALQQAIEAFQTQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLTLPS 1xwmA 51 :SIDALEEEVNDFALWLIAAQQP T0365 81 :ERTDL 1xwmA 73 :VATDL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1xwmA 84 :IKIASDIERIADFAVNIAKACIRIGGQPFVMDIGPLVLMYRLATDMVSTAIAAYDR T0365 153 :REV 1xwmA 140 :EDA T0365 160 :KMINELDIIEEDTDDLQIQLRRQLFALES 1xwmA 143 :SLAAQIADMDHRVDEQYGEMMASLLAVAK T0365 190 :LN 1xwmA 172 :TD T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELML 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 8 number of extra gaps= 0 total=2892 Number of alignments=379 # 1xwmA read from 1xwmA/merged-a2m # found chain 1xwmA in template set T0365 14 :PIKPLQEHMDKVYDCASLLVPFFE 1xwmA 12 :LHNKLIEMGRLTEVALQQAIEAFQ T0365 41 :TGNWDDAVQIRK 1xwmA 36 :TQNANLAMAVID T0365 53 :QISLAEKQGDSLKREIRLT 1xwmA 51 :SIDALEEEVNDFALWLIAA T0365 80 :VERTD 1xwmA 72 :PVATD T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLLIP 1xwmA 83 :AIKIASDIERIADFAVNIAKACIRIGGQPF T0365 119 :VPFIAYLQRCIDAVGLAQQVINE 1xwmA 117 :GPLVLMYRLATDMVSTAIAAYDR T0365 153 :REVD 1xwmA 140 :EDAS T0365 161 :MINELDIIEEDTDDLQIQLRRQLFALES 1xwmA 144 :LAAQIADMDHRVDEQYGEMMASLLAVAK T0365 190 :LN 1xwmA 172 :TD T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELML 1xwmA 177 :LAQMNVLALVARYIERTADHATNIAEHLVYLV Number of specific fragments extracted= 10 number of extra gaps= 0 total=2902 Number of alignments=380 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ofcX/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1ofcX/merged-a2m # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCAS 1ofcX 721 :KQPIVQDFQFFPPRLFELLDQEIYYFRKTV T0365 33 :VPFF 1ofcX 753 :KVPK T0365 119 :VPFIAYLQRCIDAVGLAQQVINELDDL 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 148 :AGF 1ofcX 795 :QGF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFL 1ofcX 845 :RCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRL T0365 199 :YKTI 1ofcX 925 :YEEL T0365 203 :EWVGGLADLAE 1ofcX 941 :DWFIKSRTALE T0365 215 :VGSRLELMLARV 1ofcX 952 :LQRRCNTLITLI Number of specific fragments extracted= 8 number of extra gaps= 3 total=2910 Number of alignments=381 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1ofcX)A697 Warning: unaligning (T0365)I15 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)K715 Warning: unaligning (T0365)T41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 7 :LGVFAKSP 1ofcX 698 :VDAYFREA T0365 23 :DKVYDCASLLVPFFEATI 1ofcX 733 :PRLFELLDQEIYYFRKTV T0365 43 :NW 1ofcX 753 :KV T0365 108 :GRQLL 1ofcX 788 :EKENL T0365 115 :QALQV 1ofcX 795 :QGFTA T0365 120 :PF 1ofcX 804 :DF T0365 123 :AYLQRCIDAVGL 1ofcX 806 :NQFIKANEKYGR T0365 135 :AQQVINELDDLLE 1ofcX 832 :PEEVIEYNAVFWE T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQI 1ofcX 845 :RCTELQDIERIMGQIERGEGKIQRRLS T0365 178 :QLRRQLFALESELNPVDVM 1ofcX 875 :ALDQKMSRYRAPFHQLRLQ T0365 197 :FLYKTIEWVG 1ofcX 909 :FLVCMLHKLG T0365 207 :GLADLAERVGS 1ofcX 948 :TALELQRRCNT T0365 219 :LELMLAR 1ofcX 959 :LITLIER Number of specific fragments extracted= 13 number of extra gaps= 2 total=2923 Number of alignments=382 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 130 :DAVGLAQQVINELDDL 1ofcX 777 :EAEPLTEEEIQEKENL T0365 148 :AGF 1ofcX 795 :QGF Number of specific fragments extracted= 2 number of extra gaps= 1 total=2925 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 135 :AQQVINELDDL 1ofcX 782 :TEEEIQEKENL T0365 148 :AGF 1ofcX 795 :QGF T0365 151 :RGREVDFVAKMINELDIIEE 1ofcX 845 :RCTELQDIERIMGQIERGEG Number of specific fragments extracted= 3 number of extra gaps= 1 total=2928 Number of alignments=383 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)A11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)K715 Warning: unaligning (T0365)K12 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)K715 Warning: unaligning (T0365)S13 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)D45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)D46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)R51 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 3 :VNSILGVF 1ofcX 698 :VDAYFREA T0365 14 :PIKPLQEHMDK 1ofcX 717 :PRPPKQPIVQD T0365 25 :VYDCASLLVPFFEATITGNW 1ofcX 731 :FPPRLFELLDQEIYYFRKTV T0365 47 :AVQI 1ofcX 753 :KVPK T0365 119 :VPFIAYLQRCIDAVGLAQQVINELDDL 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 148 :AGF 1ofcX 795 :QGF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPV 1ofcX 845 :RCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPF T0365 194 :DVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1ofcX 935 :SPQFRFDWFIKSRTALELQRRCNTLITLIEREN Number of specific fragments extracted= 8 number of extra gaps= 3 total=2936 Number of alignments=384 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)A11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)K715 Warning: unaligning (T0365)D45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)D46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)R51 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 4 :NSILGVF 1ofcX 699 :DAYFREA T0365 35 :FFEATITGNW 1ofcX 741 :QEIYYFRKTV T0365 47 :AVQI 1ofcX 753 :KVPK T0365 129 :IDAVGLAQQVINELDDL 1ofcX 776 :DEAEPLTEEEIQEKENL T0365 148 :AGF 1ofcX 795 :QGF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQ 1ofcX 845 :RCTELQDIERIMGQIERGEGKIQRRLSIKKAL T0365 183 :LFALESELNP 1ofcX 887 :FHQLRLQYGN T0365 193 :VDVMFLYKTIE 1ofcX 906 :EDRFLVCMLHK T0365 204 :WVGGLADLAERVGSRLELMLARV 1ofcX 945 :KSRTALELQRRCNTLITLIEREN Number of specific fragments extracted= 9 number of extra gaps= 3 total=2945 Number of alignments=385 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLR 1ofcX 845 :RCTELQDIERIMGQIERGEGKIQRRLSIKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2946 Number of alignments=386 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=2946 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)K715 Warning: unaligning (T0365)G8 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)K715 Warning: unaligning (T0365)V9 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)T41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)A47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 1 :MPVNSI 1ofcX 700 :AYFREA T0365 10 :FAKSPIKPLQEHM 1ofcX 717 :PRPPKQPIVQDFQ T0365 23 :DKVYDCASLLVPFFEATI 1ofcX 733 :PRLFELLDQEIYYFRKTV T0365 43 :NWDD 1ofcX 753 :KVPK T0365 119 :VPFIAYLQRCIDAVGLAQQVINELDDL 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 148 :AGF 1ofcX 795 :QGF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFL 1ofcX 845 :RCTELQDIERIMGQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRL T0365 199 :YKTIEWV 1ofcX 925 :YEELRAA T0365 206 :GGLADLAERVGSRLELMLARV 1ofcX 947 :RTALELQRRCNTLITLIEREN Number of specific fragments extracted= 9 number of extra gaps= 3 total=2955 Number of alignments=387 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L7 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)K715 Warning: unaligning (T0365)G8 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)K715 Warning: unaligning (T0365)V9 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)T41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)A47 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)F197 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)L198 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 1 :MPVNSI 1ofcX 700 :AYFREA T0365 10 :FAKSPIKPLQEHM 1ofcX 717 :PRPPKQPIVQDFQ T0365 23 :DKVYDCASLLVPFFEATI 1ofcX 733 :PRLFELLDQEIYYFRKTV T0365 43 :NWDD 1ofcX 753 :KVPK T0365 121 :FIAYLQRCIDAVGLAQQVINELDDL 1ofcX 768 :QREEQRKIDEAEPLTEEEIQEKENL T0365 148 :AGFR 1ofcX 795 :QGFT T0365 152 :GR 1ofcX 816 :GR T0365 154 :EVDFVA 1ofcX 819 :DIDNIA T0365 160 :KMINELDIIEEDTDDLQIQLRRQLF 1ofcX 851 :DIERIMGQIERGEGKIQRRLSIKKA T0365 185 :ALESELNPVD 1ofcX 879 :KMSRYRAPFH T0365 195 :V 1ofcX 892 :L T0365 196 :M 1ofcX 899 :G T0365 199 :YKT 1ofcX 902 :YTE T0365 202 :I 1ofcX 928 :L T0365 203 :EWVGGLADLAERVGSRLELMLARV 1ofcX 944 :IKSRTALELQRRCNTLITLIEREN Number of specific fragments extracted= 15 number of extra gaps= 4 total=2970 Number of alignments=388 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 130 :DAVGLAQQVINELDDL 1ofcX 777 :EAEPLTEEEIQEKENL T0365 148 :AGF 1ofcX 795 :QGF Number of specific fragments extracted= 2 number of extra gaps= 1 total=2972 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L146 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)E147 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 130 :DAVGLAQQVINELDDL 1ofcX 777 :EAEPLTEEEIQEKENL T0365 148 :AGFR 1ofcX 795 :QGFT Number of specific fragments extracted= 2 number of extra gaps= 1 total=2974 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set T0365 92 :QDKIANKAKDISGR 1ofcX 817 :RDDIDNIAKDVEGK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2975 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set T0365 91 :QQDKIANKAKDISGR 1ofcX 816 :GRDDIDNIAKDVEGK Number of specific fragments extracted= 1 number of extra gaps= 0 total=2976 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)N191 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)P192 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 726 :QDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQ 1ofcX 798 :TAWTKRDFNQFIKA T0365 92 :QDKIANKAKDISG 1ofcX 817 :RDDIDNIAKDVEG T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDLLEA 1ofcX 830 :KTPEEVIEYNAVFWERCTELQDIERIMGQIERG T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1ofcX 863 :EGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKG T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1ofcX 902 :YTEIEDRFLVCMLHKLGFDKENVYEELRAAIRA Number of specific fragments extracted= 9 number of extra gaps= 4 total=2985 Number of alignments=389 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)N163 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E164 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 4 :NSILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 725 :VQDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQ 1ofcX 798 :TAWTKRDFNQFIKA T0365 92 :QDKIANKAKDISGRV 1ofcX 817 :RDDIDNIAKDVEGKT T0365 107 :IGRQLLIPQALQV 1ofcX 836 :IEYNAVFWERCTE T0365 120 :PFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMI 1ofcX 857 :GQIERGEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKG T0365 165 :LDIIEEDT 1ofcX 902 :YTEIEDRF T0365 173 :DDLQIQLRRQLFAL 1ofcX 922 :ENVYEELRAAIRAS T0365 191 :NPVDVMFLYKT 1ofcX 936 :PQFRFDWFIKS T0365 207 :GLADLAERVGSRLELMLAR 1ofcX 947 :RTALELQRRCNTLITLIER Number of specific fragments extracted= 12 number of extra gaps= 4 total=2997 Number of alignments=390 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1ofcX)A697 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 3 :VNSILG 1ofcX 698 :VDAYFR T0365 9 :VFAKS 1ofcX 718 :RPPKQ T0365 14 :PIKPLQEHMDK 1ofcX 731 :FPPRLFELLDQ T0365 28 :CASLLVP 1ofcX 742 :EIYYFRK T0365 39 :TI 1ofcX 749 :TV T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 97 :N 1ofcX 822 :N T0365 109 :RQLLIPQALQVPFIAYLQRCID 1ofcX 823 :IAKDVEGKTPEEVIEYNAVFWE T0365 152 :GREVDFVAKMINELDIIEEDTDDLQ 1ofcX 846 :CTELQDIERIMGQIERGEGKIQRRL T0365 178 :QLRRQLFAL 1ofcX 871 :SIKKALDQK T0365 187 :E 1ofcX 899 :G T0365 190 :LNPVDVMFLYKTIEWV 1ofcX 902 :YTEIEDRFLVCMLHKL T0365 212 :AERVGSRLELMLAR 1ofcX 952 :LQRRCNTLITLIER Number of specific fragments extracted= 15 number of extra gaps= 2 total=3012 Number of alignments=391 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1ofcX)A697 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 3 :VNSILG 1ofcX 698 :VDAYFR T0365 9 :VFAKS 1ofcX 718 :RPPKQ T0365 14 :PIKP 1ofcX 730 :FFPP T0365 28 :CASLLVPFFEATI 1ofcX 735 :LFELLDQEIYYFR T0365 45 :DDAVQIRKQIS 1ofcX 766 :KVQREEQRKID T0365 63 :SLKREIRLT 1ofcX 784 :EEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 100 :KDISG 1ofcX 821 :DNIAK T0365 110 :QLL 1ofcX 826 :DVE T0365 116 :ALQ 1ofcX 829 :GKT T0365 119 :VPFIAYLQRCID 1ofcX 833 :EEVIEYNAVFWE T0365 153 :REVDFVA 1ofcX 850 :QDIERIM T0365 163 :NELDIIEEDTDD 1ofcX 857 :GQIERGEGKIQR T0365 175 :LQIQLRRQLFAL 1ofcX 871 :SIKKALDQKMSR T0365 190 :LNPVDVMFLYKT 1ofcX 902 :YTEIEDRFLVCM T0365 202 :IEWVGGLADL 1ofcX 925 :YEELRAAIRA T0365 212 :AERVGSRLELMLAR 1ofcX 952 :LQRRCNTLITLIER Number of specific fragments extracted= 18 number of extra gaps= 2 total=3030 Number of alignments=392 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCA 1ofcX 728 :FQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQ 1ofcX 798 :TAWTKRDFNQFIKA T0365 92 :QDKIANKAKDI 1ofcX 817 :RDDIDNIAKDV T0365 110 :QLLIPQALQVPFIAYLQRC 1ofcX 828 :EGKTPEEVIEYNAVFWERC T0365 153 :REVDFVAKMINELDIIEEDT 1ofcX 847 :TELQDIERIMGQIERGEGKI Number of specific fragments extracted= 8 number of extra gaps= 3 total=3038 Number of alignments=393 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCA 1ofcX 728 :FQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQ 1ofcX 798 :TAWTKRDFNQFIKA T0365 92 :QDKIANKAKDISG 1ofcX 817 :RDDIDNIAKDVEG T0365 112 :LIPQALQVPFIAYLQRC 1ofcX 830 :KTPEEVIEYNAVFWERC T0365 153 :REVDFVAKMINELDIIEEDT 1ofcX 847 :TELQDIERIMGQIERGEGKI Number of specific fragments extracted= 8 number of extra gaps= 3 total=3046 Number of alignments=394 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 10 :FAKS 1ofcX 719 :PPKQ T0365 14 :PIKPLQEHMDK 1ofcX 731 :FPPRLFELLDQ T0365 28 :CASLLV 1ofcX 742 :EIYYFR T0365 38 :ATI 1ofcX 748 :KTV T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 97 :N 1ofcX 822 :N T0365 109 :RQLLIPQALQVPFIAYLQRCID 1ofcX 823 :IAKDVEGKTPEEVIEYNAVFWE T0365 152 :GREVDFVAKMINELDIIEEDTDDLQ 1ofcX 846 :CTELQDIERIMGQIERGEGKIQRRL T0365 178 :QLRRQLFALE 1ofcX 871 :SIKKALDQKM Number of specific fragments extracted= 11 number of extra gaps= 1 total=3057 Number of alignments=395 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)Q115 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)A116 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYD 1ofcX 820 :IDNIAKDVEGKTPEEVIEYNAVFWE T0365 42 :GNWDDA 1ofcX 850 :QDIERI T0365 51 :RKQISLAEKQGDSLKR 1ofcX 856 :MGQIERGEGKIQRRLS T0365 92 :QDKIANKAKD 1ofcX 872 :IKKALDQKMS T0365 109 :R 1ofcX 882 :R T0365 110 :QLLIP 1ofcX 889 :QLRLQ T0365 117 :LQV 1ofcX 902 :YTE T0365 120 :PFIAYLQRCIDA 1ofcX 906 :EDRFLVCMLHKL T0365 132 :VGLAQQVINE 1ofcX 925 :YEELRAAIRA T0365 149 :G 1ofcX 935 :S T0365 150 :FRGR 1ofcX 938 :FRFD T0365 154 :EVDFVAKMINELDII 1ofcX 948 :TALELQRRCNTLITL T0365 169 :EEDTDDLQIQ 1ofcX 964 :ERENIELEEK Number of specific fragments extracted= 13 number of extra gaps= 1 total=3070 Number of alignments=396 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)N191 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)P192 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 723 :PIVQDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDKIA 1ofcX 798 :TAWTKRDFNQFIKANEKYG T0365 97 :NKAKDISGRVIGRQL 1ofcX 818 :DDIDNIAKDVEGKTP T0365 115 :QALQVPFIAYLQRCID 1ofcX 833 :EEVIEYNAVFWERCTE T0365 132 :VGLAQQVINELDD 1ofcX 849 :LQDIERIMGQIER T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1ofcX 862 :GEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKG T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1ofcX 902 :YTEIEDRFLVCMLHKLGFDKENVYEELRAAIRAS Number of specific fragments extracted= 10 number of extra gaps= 4 total=3080 Number of alignments=397 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)L190 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)N191 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 724 :IVQDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQ 1ofcX 798 :TAWTKRDFNQFIKA T0365 92 :QDKIANKAKDISGR 1ofcX 817 :RDDIDNIAKDVEGK T0365 113 :IPQALQVPFIAYLQRCIDAVG 1ofcX 831 :TPEEVIEYNAVFWERCTELQD T0365 135 :AQQVINELDD 1ofcX 852 :IERIMGQIER T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1ofcX 862 :GEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGN T0365 187 :ESE 1ofcX 897 :NKG T0365 192 :PVDV 1ofcX 902 :YTEI T0365 197 :FLYKTIEWVGGLADLAERVGSRLELMLARV 1ofcX 906 :EDRFLVCMLHKLGFDKENVYEELRAAIRAS Number of specific fragments extracted= 12 number of extra gaps= 4 total=3092 Number of alignments=398 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)I6 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)K715 Warning: unaligning (T0365)L7 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)W44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)D45 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 8 :GVFAKS 1ofcX 717 :PRPPKQ T0365 14 :PIKPLQEHMDK 1ofcX 731 :FPPRLFELLDQ T0365 35 :FFEATI 1ofcX 742 :EIYYFR T0365 42 :GN 1ofcX 755 :PK T0365 53 :QISLAEKQ 1ofcX 766 :KVQREEQR T0365 61 :GD 1ofcX 775 :ID T0365 63 :SLKREIRLT 1ofcX 784 :EEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 110 :QLLIPQALQVPFIAYLQR 1ofcX 828 :EGKTPEEVIEYNAVFWER T0365 152 :GREVDFVAKMINELDIIEEDTDDLQ 1ofcX 846 :CTELQDIERIMGQIERGEGKIQRRL T0365 177 :IQLRRQLFA 1ofcX 874 :KALDQKMSR T0365 187 :E 1ofcX 899 :G T0365 190 :LNPVDVMFLYKTIEWV 1ofcX 902 :YTEIEDRFLVCMLHKL T0365 207 :GLADLAERVGSRLELMLAR 1ofcX 951 :ELQRRCNTLITLIERENIE Number of specific fragments extracted= 15 number of extra gaps= 3 total=3107 Number of alignments=399 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1ofcX)A697 Warning: unaligning (T0365)I6 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)K715 Warning: unaligning (T0365)L7 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 3 :VNS 1ofcX 698 :VDA T0365 8 :GVFAKS 1ofcX 717 :PRPPKQ T0365 14 :PIKP 1ofcX 730 :FFPP T0365 28 :CASLLVPFFEATI 1ofcX 735 :LFELLDQEIYYFR T0365 45 :DDAVQIRKQIS 1ofcX 766 :KVQREEQRKID T0365 62 :DSLKREIRLT 1ofcX 783 :EEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 109 :RQLLIPQAL 1ofcX 815 :YGRDDIDNI T0365 118 :QVPFIAYLQRCIDAV 1ofcX 832 :PEEVIEYNAVFWERC T0365 150 :F 1ofcX 849 :L T0365 153 :REVDFVA 1ofcX 850 :QDIERIM T0365 163 :NELDIIEEDTDDLQI 1ofcX 857 :GQIERGEGKIQRRLS T0365 178 :QLRRQLFAL 1ofcX 874 :KALDQKMSR T0365 190 :LNPVDVMFLYKT 1ofcX 902 :YTEIEDRFLVCM T0365 202 :IEWVGGLAD 1ofcX 925 :YEELRAAIR T0365 211 :LAERVGSRLELMLAR 1ofcX 951 :ELQRRCNTLITLIER Number of specific fragments extracted= 17 number of extra gaps= 2 total=3124 Number of alignments=400 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCA 1ofcX 728 :FQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDKIA 1ofcX 798 :TAWTKRDFNQFIKANEKYG T0365 97 :NKAKDISGRVIGRQL 1ofcX 818 :DDIDNIAKDVEGKTP T0365 115 :QALQVPFIAYLQRCIDAVGL 1ofcX 833 :EEVIEYNAVFWERCTELQDI Number of specific fragments extracted= 7 number of extra gaps= 3 total=3131 Number of alignments=401 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCA 1ofcX 728 :FQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDKIA 1ofcX 798 :TAWTKRDFNQFIKANEKYG T0365 97 :NKAKDISGRVIG 1ofcX 818 :DDIDNIAKDVEG T0365 112 :LIPQALQVPFIAYLQRCIDAV 1ofcX 830 :KTPEEVIEYNAVFWERCTELQ T0365 157 :FVAKMINELDIIEE 1ofcX 851 :DIERIMGQIERGEG Number of specific fragments extracted= 8 number of extra gaps= 3 total=3139 Number of alignments=402 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L7 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)W44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)D45 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 8 :GVFAKS 1ofcX 717 :PRPPKQ T0365 14 :PIKPLQEHMD 1ofcX 731 :FPPRLFELLD T0365 34 :PFFEATI 1ofcX 741 :QEIYYFR T0365 42 :GN 1ofcX 755 :PK T0365 53 :QISLAEKQ 1ofcX 766 :KVQREEQR T0365 61 :GD 1ofcX 775 :ID T0365 63 :SLKREIRLT 1ofcX 784 :EEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 110 :QLLIPQALQVPFIAYLQR 1ofcX 828 :EGKTPEEVIEYNAVFWER T0365 152 :GREVDFVAKMINELDIIEEDTDDLQ 1ofcX 846 :CTELQDIERIMGQIERGEGKIQRRL T0365 178 :QLRRQLFALES 1ofcX 871 :SIKKALDQKMS Number of specific fragments extracted= 12 number of extra gaps= 3 total=3151 Number of alignments=403 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)L7 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 8 :GVFAKS 1ofcX 717 :PRPPKQ T0365 14 :PIKP 1ofcX 730 :FFPP T0365 28 :CASLLVPFFEATI 1ofcX 735 :LFELLDQEIYYFR T0365 45 :DDAVQIRKQIS 1ofcX 766 :KVQREEQRKID T0365 62 :DSLKREIRLT 1ofcX 783 :EEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 109 :RQLLIPQAL 1ofcX 815 :YGRDDIDNI T0365 118 :QVPFIAYLQRCIDAV 1ofcX 832 :PEEVIEYNAVFWERC T0365 150 :F 1ofcX 849 :L T0365 153 :REVDFVA 1ofcX 850 :QDIERIM T0365 163 :NELDIIEEDTDDLQI 1ofcX 857 :GQIERGEGKIQRRLS T0365 178 :QLRRQLFAL 1ofcX 874 :KALDQKMSR T0365 190 :LNPVDVMFLYKT 1ofcX 902 :YTEIEDRFLVCM T0365 202 :IEWVGGLAD 1ofcX 925 :YEELRAAIR T0365 211 :LAERVGSRLELMLA 1ofcX 951 :ELQRRCNTLITLIE Number of specific fragments extracted= 16 number of extra gaps= 3 total=3167 Number of alignments=404 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)N191 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)P192 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 722 :QPIVQDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDKI 1ofcX 798 :TAWTKRDFNQFIKANEKY T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1ofcX 817 :RDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDIERIMGQIERG T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1ofcX 863 :EGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNKG T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1ofcX 902 :YTEIEDRFLVCMLHKLGFDKENVYEELRAAIRAS Number of specific fragments extracted= 8 number of extra gaps= 4 total=3175 Number of alignments=405 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 723 :PIVQDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDKI 1ofcX 798 :TAWTKRDFNQFIKANEKY T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDA 1ofcX 817 :RDDIDNIAKDVEGKTPEEVIEYNAVFWERCTELQDI T0365 133 :GLAQQVINE 1ofcX 853 :ERIMGQIER T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1ofcX 862 :GEGKIQRRLSIKKALDQKMSRYRAPFHQLRLQYGNNK T0365 190 :LNPVDVMFLY 1ofcX 902 :YTEIEDRFLV T0365 203 :EWVGGLADLAERVGSRLELMLAR 1ofcX 912 :CMLHKLGFDKENVYEELRAAIRA Number of specific fragments extracted= 10 number of extra gaps= 4 total=3185 Number of alignments=406 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)I6 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)K715 Warning: unaligning (T0365)L7 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)A716 Warning: unaligning (T0365)T41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)W44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)D45 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 8 :GVFAKS 1ofcX 717 :PRPPKQ T0365 14 :PIKPLQEHMDKVY 1ofcX 732 :PPRLFELLDQEIY T0365 35 :FFEATI 1ofcX 745 :YFRKTV T0365 43 :N 1ofcX 753 :K T0365 53 :QISLAEKQ 1ofcX 766 :KVQREEQR T0365 62 :DSLKREIRLT 1ofcX 783 :EEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 101 :D 1ofcX 822 :N T0365 107 :IGRQLL 1ofcX 823 :IAKDVE T0365 113 :IPQALQV 1ofcX 830 :KTPEEVI T0365 134 :LAQQVINEL 1ofcX 837 :EYNAVFWER T0365 152 :GREVDFVAKMINELDIIEEDTDDLQI 1ofcX 846 :CTELQDIERIMGQIERGEGKIQRRLS T0365 178 :QLRRQLFALE 1ofcX 874 :KALDQKMSRY T0365 190 :LNPVDVMFLYKTIEWV 1ofcX 902 :YTEIEDRFLVCMLHKL T0365 206 :GGL 1ofcX 929 :RAA T0365 209 :ADLAERVGSRLELMLAR 1ofcX 949 :ALELQRRCNTLITLIER Number of specific fragments extracted= 17 number of extra gaps= 4 total=3202 Number of alignments=407 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ofcX)A697 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 14 :PIKPLQEH 1ofcX 698 :VDAYFREA T0365 28 :CASLLVPFFEATI 1ofcX 735 :LFELLDQEIYYFR T0365 45 :DDAVQIRKQIS 1ofcX 766 :KVQREEQRKID T0365 62 :DSLKREIRLT 1ofcX 783 :EEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 100 :KDISG 1ofcX 821 :DNIAK T0365 110 :QLL 1ofcX 826 :DVE T0365 113 :IPQA 1ofcX 830 :KTPE T0365 120 :PFIAYLQRCIDA 1ofcX 834 :EVIEYNAVFWER T0365 153 :REVDFVA 1ofcX 850 :QDIERIM T0365 163 :NELDIIEEDTDDL 1ofcX 857 :GQIERGEGKIQRR T0365 176 :QIQLRRQLFALE 1ofcX 872 :IKKALDQKMSRY T0365 190 :LNPVDVMFLYKT 1ofcX 902 :YTEIEDRFLVCM T0365 202 :IEWVGGLADL 1ofcX 925 :YEELRAAIRA T0365 212 :AERVGSRLELMLAR 1ofcX 952 :LQRRCNTLITLIER Number of specific fragments extracted= 16 number of extra gaps= 2 total=3218 Number of alignments=408 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 723 :PIVQDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDKI 1ofcX 798 :TAWTKRDFNQFIKANEKY T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYL 1ofcX 817 :RDDIDNIAKDVEGKTPEEVIEYNAVFWERC T0365 153 :REVDFVAKMINELDIIEEDTDD 1ofcX 847 :TELQDIERIMGQIERGEGKIQR Number of specific fragments extracted= 7 number of extra gaps= 3 total=3225 Number of alignments=409 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)S30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)F36 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)E37 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCA 1ofcX 726 :QDFQFFPPRLFELLDQEIYYFRKTV T0365 32 :LVPF 1ofcX 753 :KVPK T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1ofcX 766 :KVQREEQRKIDEAEPLTEEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDKI 1ofcX 798 :TAWTKRDFNQFIKANEKY T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAYL 1ofcX 817 :RDDIDNIAKDVEGKTPEEVIEYNAVFWERC T0365 153 :REVDFVAKMINELDIIEEDTD 1ofcX 847 :TELQDIERIMGQIERGEGKIQ Number of specific fragments extracted= 7 number of extra gaps= 3 total=3232 Number of alignments=410 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)T41 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1ofcX)Y752 Warning: unaligning (T0365)W44 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ofcX)T765 Warning: unaligning (T0365)D45 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ofcX)T765 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 T0365 7 :LGVFAKSPIKPLQEHMD 1ofcX 728 :FQFFPPRLFELLDQEIY T0365 35 :FFEATI 1ofcX 745 :YFRKTV T0365 43 :N 1ofcX 753 :K T0365 53 :QISLAEKQ 1ofcX 766 :KVQREEQR T0365 62 :DSLKREIRLT 1ofcX 783 :EEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 101 :D 1ofcX 822 :N T0365 107 :IGRQLL 1ofcX 823 :IAKDVE T0365 113 :IPQALQV 1ofcX 830 :KTPEEVI T0365 134 :LAQQVINEL 1ofcX 837 :EYNAVFWER T0365 152 :GREVDFVAKMINELDIIEEDTDDLQI 1ofcX 846 :CTELQDIERIMGQIERGEGKIQRRLS T0365 179 :LRRQLFAL 1ofcX 872 :IKKALDQK Number of specific fragments extracted= 13 number of extra gaps= 3 total=3245 Number of alignments=411 # 1ofcX read from 1ofcX/merged-a2m # found chain 1ofcX in template set Warning: unaligning (T0365)G42 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1ofcX)Y752 Warning: unaligning (T0365)L72 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)S794 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)S794 Warning: unaligning (T0365)S188 because of BadResidue code BAD_PEPTIDE in next template residue (1ofcX)N901 Warning: unaligning (T0365)E189 because of BadResidue code BAD_PEPTIDE at template residue (1ofcX)N901 T0365 2 :PVNSILGVFAKSPIKPLQEHMDK 1ofcX 723 :PIVQDFQFFPPRLFELLDQEIYY T0365 37 :EATIT 1ofcX 746 :FRKTV T0365 45 :DDAVQIRKQIS 1ofcX 766 :KVQREEQRKID T0365 62 :DSLKREIRLT 1ofcX 783 :EEEIQEKENL T0365 74 :SGL 1ofcX 795 :QGF T0365 78 :MPVERTDLLELLTQQDK 1ofcX 798 :TAWTKRDFNQFIKANEK T0365 100 :KDISG 1ofcX 821 :DNIAK T0365 110 :QLL 1ofcX 826 :DVE T0365 113 :IPQA 1ofcX 830 :KTPE T0365 120 :PFIAYLQRCIDA 1ofcX 834 :EVIEYNAVFWER T0365 153 :REVDFVA 1ofcX 850 :QDIERIM T0365 163 :NELDIIEEDTDDL 1ofcX 857 :GQIERGEGKIQRR T0365 176 :QIQLRRQLFALE 1ofcX 872 :IKKALDQKMSRY T0365 190 :LNPVDVMFLYKT 1ofcX 902 :YTEIEDRFLVCM T0365 202 :IEWVGGLADL 1ofcX 925 :YEELRAAIRA T0365 212 :AERVGSRLELMLAR 1ofcX 952 :LQRRCNTLITLIER Number of specific fragments extracted= 16 number of extra gaps= 3 total=3261 Number of alignments=412 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1h6pA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1h6pA expands to /projects/compbio/data/pdb/1h6p.pdb.gz 1h6pA:# T0365 read from 1h6pA/merged-a2m # 1h6pA read from 1h6pA/merged-a2m # adding 1h6pA to template set # found chain 1h6pA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)S63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)E87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)F150 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)T172 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGD 1h6pA 44 :GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPL T0365 65 :KREIRLT 1h6pA 98 :SRLLRVM T0365 75 :GLFMPVERTDL 1h6pA 105 :QCLSRIEEGEN T0365 88 :LLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 173 :DDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLA 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHL T0365 213 :ERVGSRLELMLARV 1h6pA 230 :DDAEPYLLTMAKKA Number of specific fragments extracted= 6 number of extra gaps= 0 total=3267 Number of alignments=413 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)Q60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)E87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)F150 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R180 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 15 :IKPLQEHM 1h6pA 44 :GEARLEEA T0365 23 :DKVYDCASLL 1h6pA 56 :VLKFYFHEAL T0365 34 :PFFEATITGNWDDAVQIRKQISLAEK 1h6pA 66 :RAFRGSRYGDFRQIRDIMQALLVRPL T0365 65 :KREIRL 1h6pA 98 :SRLLRV T0365 74 :SGLFMPVERTDL 1h6pA 104 :MQCLSRIEEGEN T0365 88 :LLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 181 :RQLFALESELNPVDVMF 1h6pA 193 :NDLLNIIREKNLAHPVI T0365 198 :LYKTIEWVGGLA 1h6pA 218 :QQKMLRFLESHL T0365 213 :ERVGSRLELMLARV 1h6pA 230 :DDAEPYLLTMAKKA Number of specific fragments extracted= 9 number of extra gaps= 0 total=3276 Number of alignments=414 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLI 1h6pA 134 :NVLEMIKTEFTLTEAVVESSRKLVKEAAVI Number of specific fragments extracted= 1 number of extra gaps= 0 total=3277 Number of alignments=415 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3277 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)S63 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)E87 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)F150 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R151 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 Warning: unaligning (T0365)W204 because last residue in template chain is (1h6pA)K245 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGD 1h6pA 44 :GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPL T0365 65 :KREIRLTL 1h6pA 98 :SRLLRVMQ T0365 76 :LFMPVERTDL 1h6pA 106 :CLSRIEEGEN T0365 88 :LLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIE 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTMAKKAL Number of specific fragments extracted= 5 number of extra gaps= 0 total=3282 Number of alignments=416 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)P17 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)Q60 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)G61 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)R180 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 18 :LQEHMDKV 1h6pA 44 :GEARLEEA T0365 26 :YDCAS 1h6pA 59 :FYFHE T0365 32 :LVPFFEATITGNWDDAVQIRKQISLAEK 1h6pA 64 :ALRAFRGSRYGDFRQIRDIMQALLVRPL T0365 62 :DSL 1h6pA 98 :SRL T0365 68 :IRLTL 1h6pA 101 :LRVMQ T0365 76 :LFMPVERTDL 1h6pA 106 :CLSRIEEGEN T0365 87 :ELLTQQDKIANKAKDISGRVIGRQLLI 1h6pA 137 :EMIKTEFTLTEAVVESSRKLVKEAAVI T0365 181 :RQLFALESELNPVDVMFLYKTI 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSY T0365 203 :EWVGGLA 1h6pA 223 :RFLESHL T0365 213 :ERVGSRLELMLA 1h6pA 230 :DDAEPYLLTMAK Number of specific fragments extracted= 10 number of extra gaps= 0 total=3292 Number of alignments=417 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTL 1h6pA 130 :ESAINVLEMIKTEFTLTEAVVESSRKLV Number of specific fragments extracted= 1 number of extra gaps= 0 total=3293 Number of alignments=418 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3293 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)P17 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)R66 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)E67 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)F150 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)T172 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 18 :LQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLK 1h6pA 44 :GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPL T0365 68 :IRLTLPSGLFMPVERTDL 1h6pA 98 :SRLLRVMQCLSRIEEGEN T0365 88 :LLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 173 :DDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAE 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSYETFQQKMLRFLESHLDDAE T0365 217 :SRLELMLARV 1h6pA 234 :PYLLTMAKKA Number of specific fragments extracted= 5 number of extra gaps= 0 total=3298 Number of alignments=419 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)D45 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)I50 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)L64 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)I129 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R180 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 1 :MPVNSILGVFAKSPIK 1h6pA 43 :AGEARLEEAVNRWVLK T0365 17 :PLQEHMDKVYDCASLLVPFFEATITGNW 1h6pA 64 :ALRAFRGSRYGDFRQIRDIMQALLVRPL T0365 51 :RKQISLA 1h6pA 98 :SRLLRVM T0365 58 :EKQGDS 1h6pA 110 :IEEGEN T0365 70 :LTLPSG 1h6pA 120 :FDMEAE T0365 77 :FMPVER 1h6pA 126 :LTPLES T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPF 1h6pA 133 :INVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEF T0365 122 :IAYLQRC 1h6pA 175 :SKILKKH T0365 181 :RQLFALESELNPVDV 1h6pA 193 :NDLLNIIREKNLAHP T0365 196 :MFLYKTIEWVGGLADLAE 1h6pA 216 :TFQQKMLRFLESHLDDAE T0365 217 :SRLELMLARV 1h6pA 234 :PYLLTMAKKA Number of specific fragments extracted= 11 number of extra gaps= 0 total=3309 Number of alignments=420 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLI 1h6pA 134 :NVLEMIKTEFTLTEAVVESSRKLVKEAAVI Number of specific fragments extracted= 1 number of extra gaps= 0 total=3310 Number of alignments=421 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set T0365 83 :TDLLELLTQQDKIAN 1h6pA 193 :NDLLNIIREKNLAHP Number of specific fragments extracted= 1 number of extra gaps= 0 total=3311 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)D173 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)Q176 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 T0365 167 :IIEEDT 1h6pA 110 :IEEGEN T0365 177 :IQLRRQLFALESELNPVDVM 1h6pA 120 :FDMEAELTPLESAINVLEMI Number of specific fragments extracted= 2 number of extra gaps= 0 total=3313 Number of alignments=422 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)Q176 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 T0365 177 :IQLRRQLFALESELNPV 1h6pA 120 :FDMEAELTPLESAINVL Number of specific fragments extracted= 1 number of extra gaps= 0 total=3314 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)R105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)G108 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 14 :PIKPLQEHMDKVYDCA 1h6pA 44 :GEARLEEAVNRWVLKF T0365 31 :LLVPFFEATITGNWDDA 1h6pA 60 :YFHEALRAFRGSRYGDF T0365 66 :REIRLTLPSGLFMPV 1h6pA 77 :RQIRDIMQALLVRPL T0365 87 :ELLTQQDKIANKAKDISG 1h6pA 98 :SRLLRVMQCLSRIEEGEN T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEA T0365 150 :FRGREVDFVAKMINEL 1h6pA 166 :IKNKEFEKASKILKKH T0365 177 :IQLRRQLFALESELNPVDVMFLYKT 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSYETF T0365 202 :IEWVGGLADLAE 1h6pA 222 :LRFLESHLDDAE T0365 217 :SRLELMLAR 1h6pA 234 :PYLLTMAKK Number of specific fragments extracted= 9 number of extra gaps= 0 total=3323 Number of alignments=423 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)R105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)G108 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 15 :IKPLQEHMDKVY 1h6pA 45 :EARLEEAVNRWV T0365 28 :CASLLVPFFEATITGNWDDAV 1h6pA 57 :LKFYFHEALRAFRGSRYGDFR T0365 67 :EIRLTLPSGLFMPV 1h6pA 78 :QIRDIMQALLVRPL T0365 87 :ELLTQQDKIANKAKDISG 1h6pA 98 :SRLLRVMQCLSRIEEGEN T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEA T0365 150 :FRGREVDFVAKMINEL 1h6pA 166 :IKNKEFEKASKILKKH T0365 177 :IQLRRQLFALESELNPVDVMFL 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSY T0365 200 :KT 1h6pA 215 :ET T0365 202 :IEWVGGLADLAE 1h6pA 222 :LRFLESHLDDAE T0365 217 :SRLELMLAR 1h6pA 234 :PYLLTMAKK Number of specific fragments extracted= 10 number of extra gaps= 0 total=3333 Number of alignments=424 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 T0365 1 :M 1h6pA 43 :A T0365 3 :VNSI 1h6pA 44 :GEAR T0365 18 :LQE 1h6pA 48 :LEE T0365 22 :MDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 51 :AVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 76 :LFMPV 1h6pA 87 :LVRPL T0365 83 :TDLLELLTQQDKIAN 1h6pA 98 :SRLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGR 1h6pA 128 :PLESAINVLEMI T0365 110 :QLLIPQALQVPFIAYLQRCIDAVG 1h6pA 142 :EFTLTEAVVESSRKLVKEAAVIIC T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINE 1h6pA 168 :NKEFEKASKILKK T0365 165 :LDIIEE 1h6pA 198 :IIREKN T0365 172 :TDDLQIQLRRQLFALESELNPVDV 1h6pA 214 :YETFQQKMLRFLESHLDDAEPYLL T0365 221 :LMLAR 1h6pA 238 :TMAKK Number of specific fragments extracted= 13 number of extra gaps= 0 total=3346 Number of alignments=425 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 T0365 1 :M 1h6pA 43 :A T0365 3 :V 1h6pA 44 :G T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 45 :EARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 78 :MPV 1h6pA 89 :RPL T0365 83 :TDLLELLTQQDKIAN 1h6pA 98 :SRLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGRQLLI 1h6pA 128 :PLESAINVLEMIKTEF T0365 116 :ALQVPFIA 1h6pA 144 :TLTEAVVE T0365 124 :YLQRCIDAVGLAQ 1h6pA 153 :SRKLVKEAAVIIC T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINEL 1h6pA 168 :NKEFEKASKILKKH T0365 180 :RRQLFALESE 1h6pA 195 :LLNIIREKNL T0365 190 :LNPVDVM 1h6pA 212 :FSYETFQ T0365 199 :YKTIEWVGG 1h6pA 219 :QKMLRFLES T0365 219 :LELMLAR 1h6pA 236 :LLTMAKK Number of specific fragments extracted= 14 number of extra gaps= 0 total=3360 Number of alignments=426 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)L72 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R82 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLT 1h6pA 134 :NVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 83 :TDLLELLT 1h6pA 193 :NDLLNIIR Number of specific fragments extracted= 2 number of extra gaps= 0 total=3362 Number of alignments=427 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)L72 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R82 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLT 1h6pA 134 :NVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 83 :TDLLELLTQQDKIANKAKDISGRVI 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSYETF Number of specific fragments extracted= 2 number of extra gaps= 0 total=3364 Number of alignments=428 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)E169 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 57 :LKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 76 :LFMPV 1h6pA 87 :LVRPL T0365 83 :TDLLELLTQQDKIAN 1h6pA 98 :SRLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGR 1h6pA 128 :PLESAINVLEMI T0365 110 :QLLIPQALQVPFIAYLQRCIDAV 1h6pA 142 :EFTLTEAVVESSRKLVKEAAVII T0365 136 :Q 1h6pA 165 :C T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINE 1h6pA 168 :NKEFEKASKILKK T0365 170 :EDTDDLQIQ 1h6pA 193 :NDLLNIIRE Number of specific fragments extracted= 9 number of extra gaps= 0 total=3373 Number of alignments=429 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 T0365 19 :QEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 48 :LEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 78 :MPV 1h6pA 89 :RPL T0365 83 :TDLLELLTQQDKIAN 1h6pA 98 :SRLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGRQLLI 1h6pA 128 :PLESAINVLEMIKTEF T0365 116 :ALQVPFIA 1h6pA 144 :TLTEAVVE T0365 124 :YLQRCIDAVGLAQ 1h6pA 153 :SRKLVKEAAVIIC T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINEL 1h6pA 168 :NKEFEKASKILKKH T0365 180 :RRQLFALESE 1h6pA 195 :LLNIIREKNL T0365 190 :LNPVDVM 1h6pA 212 :FSYETFQ T0365 199 :YKTIEWVGG 1h6pA 219 :QKMLRFLES Number of specific fragments extracted= 11 number of extra gaps= 0 total=3384 Number of alignments=430 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)D27 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)R105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)G108 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 28 :CASLLVPFF 1h6pA 44 :GEARLEEAV T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPV 1h6pA 53 :NRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPL T0365 87 :ELLTQQDKIANKAKDISG 1h6pA 98 :SRLLRVMQCLSRIEEGEN T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEA T0365 150 :FRGREVDFVAKMINEL 1h6pA 166 :IKNKEFEKASKILKKH T0365 177 :IQLRRQLF 1h6pA 193 :NDLLNIIR T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAE 1h6pA 205 :AHPVIQNFSYETFQQKMLRFLESHLDDAE T0365 217 :SRLELMLAR 1h6pA 234 :PYLLTMAKK Number of specific fragments extracted= 8 number of extra gaps= 0 total=3392 Number of alignments=431 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)G61 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)L76 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)P79 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 16 :KPLQEHMDKVYD 1h6pA 46 :ARLEEAVNRWVL T0365 29 :ASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 58 :KFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 62 :DSLKR 1h6pA 98 :SRLLR T0365 67 :EIRLTLPS 1h6pA 105 :QCLSRIEE T0365 75 :G 1h6pA 115 :N T0365 80 :VERT 1h6pA 120 :FDME T0365 94 :KIANKAKDISGRVIGRQL 1h6pA 124 :AELTPLESAINVLEMIKT T0365 121 :FIAYLQRCIDAVGLAQQVINELDDL 1h6pA 142 :EFTLTEAVVESSRKLVKEAAVIICI T0365 151 :RGREVDFVAKMINEL 1h6pA 167 :KNKEFEKASKILKKH T0365 177 :IQLRRQLF 1h6pA 193 :NDLLNIIR T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAER 1h6pA 205 :AHPVIQNFSYETFQQKMLRFLESHLDDAEP T0365 218 :RLELMLAR 1h6pA 235 :YLLTMAKK Number of specific fragments extracted= 12 number of extra gaps= 0 total=3404 Number of alignments=432 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 3 :VNSILG 1h6pA 44 :GEARLE T0365 12 :KS 1h6pA 50 :EA T0365 23 :DKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 52 :VNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 76 :LFMPV 1h6pA 87 :LVRPL T0365 84 :DLLELLTQQDKIAN 1h6pA 99 :RLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGR 1h6pA 128 :PLESAINVLEMI T0365 110 :QLLIPQALQVPFIAYLQRC 1h6pA 142 :EFTLTEAVVESSRKLVKEA T0365 132 :VGLAQ 1h6pA 161 :AVIIC T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINEL 1h6pA 168 :NKEFEKASKILKKH T0365 177 :IQLRRQLFALESE 1h6pA 193 :NDLLNIIREKNLA T0365 190 :LNPVDV 1h6pA 212 :FSYETF T0365 198 :LYKTIEWVGG 1h6pA 218 :QQKMLRFLES T0365 218 :RLELMLAR 1h6pA 235 :YLLTMAKK Number of specific fragments extracted= 14 number of extra gaps= 0 total=3418 Number of alignments=433 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 44 :GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 76 :LFMPV 1h6pA 87 :LVRPL T0365 84 :DLLELLTQQDKIAN 1h6pA 99 :RLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGR 1h6pA 128 :PLESAINVLEMI T0365 110 :QLLIPQALQVPFIAYL 1h6pA 142 :EFTLTEAVVESSRKLV T0365 129 :IDAVGLAQ 1h6pA 158 :KEAAVIIC T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINEL 1h6pA 168 :NKEFEKASKILKKH T0365 180 :RRQLFALESE 1h6pA 195 :LLNIIREKNL T0365 190 :LNPVDV 1h6pA 212 :FSYETF T0365 198 :LYKTIEWVGGLAD 1h6pA 218 :QQKMLRFLESHLD T0365 218 :RLELMLAR 1h6pA 235 :YLLTMAKK Number of specific fragments extracted= 12 number of extra gaps= 0 total=3430 Number of alignments=434 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)L72 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R82 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLT 1h6pA 134 :NVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 83 :TDLLELLT 1h6pA 193 :NDLLNIIR Number of specific fragments extracted= 2 number of extra gaps= 0 total=3432 Number of alignments=435 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)L72 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R82 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLT 1h6pA 134 :NVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 83 :TDLLELLTQQDKIANKAKDISG 1h6pA 193 :NDLLNIIREKNLAHPVIQNFSY Number of specific fragments extracted= 2 number of extra gaps= 0 total=3434 Number of alignments=436 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 57 :LKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 76 :LFMPV 1h6pA 87 :LVRPL T0365 84 :DLLELLTQQDKIAN 1h6pA 99 :RLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGR 1h6pA 128 :PLESAINVLEMI T0365 110 :QLLIPQALQVPFIAYLQRC 1h6pA 142 :EFTLTEAVVESSRKLVKEA T0365 132 :VGLAQ 1h6pA 161 :AVIIC T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINEL 1h6pA 168 :NKEFEKASKILKKH T0365 177 :IQLRRQLFALESE 1h6pA 193 :NDLLNIIREKNLA T0365 190 :LNPVDV 1h6pA 212 :FSYETF T0365 198 :LYKTIEWVG 1h6pA 218 :QQKMLRFLE Number of specific fragments extracted= 11 number of extra gaps= 0 total=3445 Number of alignments=437 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 T0365 19 :QEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 48 :LEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 76 :LFMPV 1h6pA 87 :LVRPL T0365 84 :DLLELLTQQDKIAN 1h6pA 99 :RLLRVMQCLSRIEE T0365 98 :KAKDISGRVIGR 1h6pA 128 :PLESAINVLEMI T0365 110 :QLLIPQALQVPFIAYL 1h6pA 142 :EFTLTEAVVESSRKLV T0365 129 :IDAVGLAQ 1h6pA 158 :KEAAVIIC T0365 142 :LD 1h6pA 166 :IK T0365 152 :GREVDFVAKMINEL 1h6pA 168 :NKEFEKASKILKKH T0365 180 :RRQLFALESE 1h6pA 195 :LLNIIREKNL T0365 190 :LNPVDV 1h6pA 212 :FSYETF T0365 198 :LYKTIEWVGG 1h6pA 218 :QQKMLRFLES Number of specific fragments extracted= 11 number of extra gaps= 0 total=3456 Number of alignments=438 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)D27 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)R105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)G108 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 Warning: unaligning (T0365)R225 because last residue in template chain is (1h6pA)K245 T0365 28 :CASLLVPFFE 1h6pA 44 :GEARLEEAVN T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPV 1h6pA 54 :RWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPL T0365 87 :ELLTQQDKIANKAKDISG 1h6pA 98 :SRLLRVMQCLSRIEEGEN T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEA T0365 150 :FRGREVDFVAKMINEL 1h6pA 166 :IKNKEFEKASKILKKH T0365 177 :IQLRRQLFALESELNPVDVM 1h6pA 193 :NDLLNIIREKNLAHPVIQNF T0365 197 :FLYKTIEWVGGLADLAERVGSRLELMLA 1h6pA 217 :FQQKMLRFLESHLDDAEPYLLTMAKKAL Number of specific fragments extracted= 7 number of extra gaps= 0 total=3463 Number of alignments=439 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)E81 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)L86 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)R105 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)S119 Warning: unaligning (T0365)G108 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)S119 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 Warning: unaligning (T0365)R225 because last residue in template chain is (1h6pA)K245 T0365 1 :MPVNSILGVFAKSPIKP 1h6pA 43 :AGEARLEEAVNRWVLKF T0365 31 :LLVPFFEATITGNWDDA 1h6pA 60 :YFHEALRAFRGSRYGDF T0365 66 :REIRLTLPSGLFMPV 1h6pA 77 :RQIRDIMQALLVRPL T0365 87 :ELLTQQDKIANKAKDISG 1h6pA 98 :SRLLRVMQCLSRIEEGEN T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAG 1h6pA 120 :FDMEAELTPLESAINVLEMIKTEFTLTEAVVESSRKLVKEA T0365 150 :FRGREVDFVAKMINEL 1h6pA 166 :IKNKEFEKASKILKKH T0365 177 :IQLRRQLFALESELNPVDVM 1h6pA 193 :NDLLNIIREKNLAHPVIQNF T0365 197 :FLYKTIEWVGGLADLAERVGSRLELMLA 1h6pA 217 :FQQKMLRFLESHLDDAEPYLLTMAKKAL Number of specific fragments extracted= 8 number of extra gaps= 0 total=3471 Number of alignments=440 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)S5 because first residue in template chain is (1h6pA)A43 Warning: unaligning (T0365)F77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)R82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 Warning: unaligning (T0365)R225 because last residue in template chain is (1h6pA)K245 T0365 6 :ILGVFAKSPIKPLQE 1h6pA 44 :GEARLEEAVNRWVLK T0365 30 :SLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 59 :FYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 72 :LPSGL 1h6pA 87 :LVRPL T0365 83 :TDLLELLTQQDKI 1h6pA 98 :SRLLRVMQCLSRI T0365 98 :KAKDISGRVIGRQLL 1h6pA 128 :PLESAINVLEMIKTE T0365 113 :IPQALQVPFIAYLQRCIDAV 1h6pA 145 :LTEAVVESSRKLVKEAAVII T0365 138 :VINE 1h6pA 165 :CIKN T0365 153 :REVDFVAKMINEL 1h6pA 169 :KEFEKASKILKKH T0365 177 :IQLRRQLFALE 1h6pA 193 :NDLLNIIREKN T0365 188 :SELNPVDVMFLYKTIEWVGG 1h6pA 208 :VIQNFSYETFQQKMLRFLES T0365 217 :SRLELMLA 1h6pA 237 :LTMAKKAL Number of specific fragments extracted= 11 number of extra gaps= 0 total=3482 Number of alignments=441 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)F77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)R82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)R225 because last residue in template chain is (1h6pA)K245 T0365 1 :M 1h6pA 43 :A T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 44 :GEARLEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 72 :LPSGL 1h6pA 87 :LVRPL T0365 83 :TDLLELLT 1h6pA 98 :SRLLRVMQ T0365 91 :QQDKIANKAKDISGR 1h6pA 128 :PLESAINVLEMIKTE T0365 111 :LLIPQALQVPFIAYLQRCIDAV 1h6pA 143 :FTLTEAVVESSRKLVKEAAVII T0365 133 :GLAQQVINEL 1h6pA 172 :EKASKILKKH T0365 180 :RRQLFALESE 1h6pA 195 :LLNIIREKNL T0365 190 :LNPVDVM 1h6pA 212 :FSYETFQ T0365 199 :YKTIEWVGG 1h6pA 219 :QKMLRFLES T0365 209 :A 1h6pA 237 :L T0365 218 :RLELMLA 1h6pA 238 :TMAKKAL Number of specific fragments extracted= 12 number of extra gaps= 0 total=3494 Number of alignments=442 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)L72 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R82 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLT 1h6pA 134 :NVLEMIKTEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKH T0365 83 :TDLLELLT 1h6pA 193 :NDLLNIIR Number of specific fragments extracted= 2 number of extra gaps= 0 total=3496 Number of alignments=443 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)L72 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)R82 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 54 :ISLAEKQGDSLKREIRLT 1h6pA 164 :ICIKNKEFEKASKILKKH T0365 83 :TDLLELLT 1h6pA 193 :NDLLNIIR Number of specific fragments extracted= 2 number of extra gaps= 0 total=3498 Number of alignments=444 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)F77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)R82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 Warning: unaligning (T0365)D166 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)R192 Warning: unaligning (T0365)Q176 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)R192 T0365 30 :SLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 59 :FYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 72 :LPSGL 1h6pA 87 :LVRPL T0365 83 :TDLLELLTQQDKI 1h6pA 98 :SRLLRVMQCLSRI T0365 98 :KAKDISGRVIGRQLL 1h6pA 128 :PLESAINVLEMIKTE T0365 113 :IPQALQVPFIAYLQRCIDAV 1h6pA 145 :LTEAVVESSRKLVKEAAVII T0365 138 :VINE 1h6pA 165 :CIKN T0365 153 :REVDFVAKMINEL 1h6pA 169 :KEFEKASKILKKH T0365 177 :IQLRRQLFALE 1h6pA 193 :NDLLNIIREKN T0365 188 :SELNPVDVMFLYKTIEWVGG 1h6pA 208 :VIQNFSYETFQQKMLRFLES Number of specific fragments extracted= 9 number of extra gaps= 0 total=3507 Number of alignments=445 # 1h6pA read from 1h6pA/merged-a2m # found chain 1h6pA in template set Warning: unaligning (T0365)F77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1h6pA)V97 Warning: unaligning (T0365)R82 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1h6pA)V97 T0365 19 :QEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLA 1h6pA 48 :LEEAVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQAL T0365 72 :LPSGL 1h6pA 87 :LVRPL T0365 83 :TDLLELLT 1h6pA 98 :SRLLRVMQ T0365 91 :QQDKIANKAKDISGR 1h6pA 128 :PLESAINVLEMIKTE T0365 111 :LLIPQALQVPFIAYLQRCIDAV 1h6pA 143 :FTLTEAVVESSRKLVKEAAVII T0365 138 :VINE 1h6pA 165 :CIKN T0365 153 :REVDFVAKMINEL 1h6pA 169 :KEFEKASKILKKH T0365 180 :RRQLFALESE 1h6pA 195 :LLNIIREKNL T0365 190 :LNPVDVM 1h6pA 212 :FSYETFQ T0365 199 :YKTIEWVGG 1h6pA 219 :QKMLRFLES Number of specific fragments extracted= 10 number of extra gaps= 0 total=3517 Number of alignments=446 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1urvA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1urvA/merged-a2m # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)K94 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)A185 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)L186 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 95 :IANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQ 1urvA 19 :LSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHASRVMGALNTVVENLHDPD T0365 177 :IQLRRQLF 1urvA 106 :LALVGKAH T0365 187 :ESELNPVDVMFLYKTI 1urvA 116 :KHKVEPVYFKILSGVI T0365 203 :EWVGGLADLAERVGSRLELMLARV 1urvA 146 :ETQRAWAKLRGLIYSHVTAAYKEV Number of specific fragments extracted= 4 number of extra gaps= 1 total=3521 Number of alignments=447 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)K94 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I95 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)L134 because last residue in template chain is (1urvA)W171 T0365 70 :LTLPSGLFMPVERTDLLELLTQQD 1urvA 90 :NTVVENLHDPDKVSSVLALVGKAH T0365 96 :ANKAKDISGRVIGRQLLIPQ 1urvA 116 :KHKVEPVYFKILSGVILEVV T0365 116 :ALQVPFIAYLQRC 1urvA 138 :EFASDFPPETQRA T0365 129 :IDAVG 1urvA 166 :YKEVG Number of specific fragments extracted= 4 number of extra gaps= 1 total=3525 Number of alignments=448 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 135 :AQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 82 :ASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQL 1urvA 116 :KHKVEPVYFKI Number of specific fragments extracted= 2 number of extra gaps= 1 total=3527 Number of alignments=449 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set T0365 142 :LDDLLEAGFRGREVDFVAKMINELD 1urvA 66 :MEDPLEMERSPQLRKHASRVMGALN Number of specific fragments extracted= 1 number of extra gaps= 0 total=3528 Number of alignments=450 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I107 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)G108 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)P192 because last residue in template chain is (1urvA)W171 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQI 1urvA 19 :LSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHM T0365 55 :SLAEKQGDSLKREIRLTLPSGLFMPVERTD 1urvA 68 :DPLEMERSPQLRKHASRVMGALNTVVENLH T0365 91 :QQDKIANKAKDISGRV 1urvA 98 :DPDKVSSVLALVGKAH T0365 109 :RQLLIPQALQV 1urvA 116 :KHKVEPVYFKI T0365 134 :LAQQVINELDDLLEAGFRGREVDFVAKMIN 1urvA 127 :LSGVILEVVAEEFASDFPPETQRAWAKLRG T0365 178 :QLRRQLFALESELN 1urvA 157 :LIYSHVTAAYKEVG Number of specific fragments extracted= 6 number of extra gaps= 1 total=3534 Number of alignments=451 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I107 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)G108 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 10 :FAKSPIKPLQEHMDKVY 1urvA 19 :LSEAERKAVQAMWARLY T0365 29 :ASLLVPFFEAT 1urvA 43 :VAILVRFFVNF T0365 42 :GNWDDAVQIRKQI 1urvA 54 :PSAKQYFSQFKHM T0365 55 :SLAEKQGDSLKREIRLTLPSGLFMPVERTD 1urvA 68 :DPLEMERSPQLRKHASRVMGALNTVVENLH T0365 91 :QQDKIANKAKDISGRV 1urvA 98 :DPDKVSSVLALVGKAH T0365 109 :RQLLIPQALQV 1urvA 116 :KHKVEPVYFKI T0365 125 :LQRC 1urvA 127 :LSGV T0365 138 :VINELDDLLEAGFRGREVDFVAKMINEL 1urvA 131 :ILEVVAEEFASDFPPETQRAWAKLRGLI Number of specific fragments extracted= 8 number of extra gaps= 1 total=3542 Number of alignments=452 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set T0365 155 :VDFVAKMINELDIIEEDTDDL 1urvA 89 :LNTVVENLHDPDKVSSVLALV Number of specific fragments extracted= 1 number of extra gaps= 0 total=3543 Number of alignments=453 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3543 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I107 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)R109 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)V155 because last residue in template chain is (1urvA)W171 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEA 1urvA 25 :KAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQ T0365 51 :RKQIS 1urvA 63 :FKHME T0365 56 :LAEKQGDSLKREIRLTLPSGLFMPVERTD 1urvA 69 :PLEMERSPQLRKHASRVMGALNTVVENLH T0365 91 :QQDKIANKAKDISGRV 1urvA 98 :DPDKVSSVLALVGKAH T0365 110 :QLLIPQALQVPFIAYLQRCIDAV 1urvA 116 :KHKVEPVYFKILSGVILEVVAEE T0365 133 :GLAQQVINELDDLLEAGFRGRE 1urvA 149 :RAWAKLRGLIYSHVTAAYKEVG Number of specific fragments extracted= 6 number of extra gaps= 1 total=3549 Number of alignments=454 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I107 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)R109 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)V155 because last residue in template chain is (1urvA)W171 T0365 1 :MPVNSILGVFAK 1urvA 25 :KAVQAMWARLYA T0365 23 :DKVYDCASLLVPFFEAT 1urvA 37 :NSEDVGVAILVRFFVNF T0365 42 :GNWDDAVQIRKQIS 1urvA 54 :PSAKQYFSQFKHME T0365 56 :LAEKQGDSLKREIRLTLPSGLFMPVERTD 1urvA 69 :PLEMERSPQLRKHASRVMGALNTVVENLH T0365 91 :QQDKIANKAKDISGRV 1urvA 98 :DPDKVSSVLALVGKAH T0365 110 :QLLIPQAL 1urvA 116 :KHKVEPVY T0365 118 :QVPFIAYLQRCI 1urvA 128 :SGVILEVVAEEF T0365 130 :DAVGLAQQVINELDDLLEAGFRGRE 1urvA 146 :ETQRAWAKLRGLIYSHVTAAYKEVG Number of specific fragments extracted= 8 number of extra gaps= 1 total=3557 Number of alignments=455 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set T0365 155 :VDFVAKMINELDIIEEDTDDL 1urvA 89 :LNTVVENLHDPDKVSSVLALV Number of specific fragments extracted= 1 number of extra gaps= 0 total=3558 Number of alignments=456 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3558 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)L134 because last residue in template chain is (1urvA)W171 T0365 132 :VG 1urvA 169 :VG Number of specific fragments extracted= 1 number of extra gaps= 0 total=3559 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3559 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)Q53 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)R218 because last residue in template chain is (1urvA)W171 T0365 54 :ISLAEKQGDS 1urvA 19 :LSEAERKAVQ T0365 90 :TQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAY 1urvA 29 :AMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQF T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQLF 1urvA 116 :KHKVEPVYFKILSGVI T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGS 1urvA 138 :EFASDFPPETQRAWAKLRGLIYSHVTAAYKEVG Number of specific fragments extracted= 5 number of extra gaps= 1 total=3564 Number of alignments=457 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)P17 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)R218 because last residue in template chain is (1urvA)W171 T0365 18 :LQEHMDKVYDCASLL 1urvA 19 :LSEAERKAVQAMWAR T0365 40 :ITGNWDD 1urvA 34 :LYANSED T0365 60 :QGDSLKREIRLTLPS 1urvA 41 :VGVAILVRFFVNFPS T0365 95 :IANK 1urvA 56 :AKQY T0365 108 :GRQLLIPQALQ 1urvA 60 :FSQFKHMEDPL T0365 124 :YLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 71 :EMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQLF 1urvA 116 :KHKVEPVYFKILSGVI T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGS 1urvA 138 :EFASDFPPETQRAWAKLRGLIYSHVTAAYKEVG Number of specific fragments extracted= 8 number of extra gaps= 1 total=3572 Number of alignments=458 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1urvA)E18 T0365 14 :PIKP 1urvA 19 :LSEA T0365 21 :HM 1urvA 23 :ER T0365 30 :SLLVPFFEATITG 1urvA 25 :KAVQAMWARLYAN T0365 57 :AEKQGDSLKREIRLTLPS 1urvA 38 :SEDVGVAILVRFFVNFPS T0365 75 :GLFMPVER 1urvA 65 :HMEDPLEM T0365 116 :ALQVPFIAYLQ 1urvA 73 :ERSPQLRKHAS T0365 137 :QVINELDDLLEAG 1urvA 84 :RVMGALNTVVENL T0365 153 :REVDFVAKMINELDII 1urvA 97 :HDPDKVSSVLALVGKA T0365 169 :EEDTDDLQIQLRRQLFALE 1urvA 120 :EPVYFKILSGVILEVVAEE T0365 188 :SELNPVDVMFLYKTIEWVGGLADLA 1urvA 141 :SDFPPETQRAWAKLRGLIYSHVTAA Number of specific fragments extracted= 10 number of extra gaps= 0 total=3582 Number of alignments=459 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)S103 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)G104 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)L190 because last residue in template chain is (1urvA)W171 T0365 14 :PIK 1urvA 19 :LSE T0365 20 :EHMDKVYDCASLLV 1urvA 22 :AERKAVQAMWARLY T0365 34 :PFFEATI 1urvA 44 :AILVRFF T0365 41 :TGNWDDAVQ 1urvA 66 :MEDPLEMER T0365 53 :QISLAEKQGDSLKREIRLTLP 1urvA 77 :QLRKHASRVMGALNTVVENLH T0365 81 :ERTDLLELLTQQD 1urvA 98 :DPDKVSSVLALVG T0365 100 :KDI 1urvA 111 :KAH T0365 110 :QLLI 1urvA 116 :KHKV T0365 116 :AL 1urvA 120 :EP T0365 119 :VPFIAYLQRCID 1urvA 122 :VYFKILSGVILE T0365 145 :LLEAGFRGREVDFVAKMINELDII 1urvA 134 :VVAEEFASDFPPETQRAWAKLRGL T0365 172 :TDDLQIQLRRQ 1urvA 158 :IYSHVTAAYKE T0365 187 :ES 1urvA 169 :VG Number of specific fragments extracted= 13 number of extra gaps= 1 total=3595 Number of alignments=460 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRR 1urvA 116 :KHKVEPVYFKILS Number of specific fragments extracted= 2 number of extra gaps= 1 total=3597 Number of alignments=461 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 127 :RCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 74 :RSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRR 1urvA 116 :KHKVEPVYFKILS Number of specific fragments extracted= 2 number of extra gaps= 1 total=3599 Number of alignments=462 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)K59 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 7 :LGVFAKS 1urvA 63 :FKHMEDP T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1urvA 74 :RSPQLRKHASRVMGALNTVVENL T0365 42 :GNWDDAVQIRKQISLAE 1urvA 97 :HDPDKVSSVLALVGKAH T0365 74 :SGL 1urvA 116 :KHK T0365 80 :VERTDLLELLTQQDKIAN 1urvA 119 :VEPVYFKILSGVILEVVA T0365 110 :QLL 1urvA 138 :EFA T0365 113 :IPQALQVPFIAYLQRCIDAVG 1urvA 143 :FPPETQRAWAKLRGLIYSHVT Number of specific fragments extracted= 7 number of extra gaps= 1 total=3606 Number of alignments=463 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)S103 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)G104 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 21 :HMDKVYDCASLLV 1urvA 23 :ERKAVQAMWARLY T0365 34 :PFFEATI 1urvA 44 :AILVRFF T0365 41 :TGNWDDAVQ 1urvA 66 :MEDPLEMER T0365 53 :QISLAEKQGDSLKREIRLTLP 1urvA 77 :QLRKHASRVMGALNTVVENLH T0365 81 :ERTDLLELLTQQDKI 1urvA 98 :DPDKVSSVLALVGKA T0365 102 :I 1urvA 113 :H T0365 110 :QLLI 1urvA 116 :KHKV T0365 116 :AL 1urvA 120 :EP T0365 119 :VPFIAYLQRCID 1urvA 122 :VYFKILSGVILE T0365 145 :LLEAGFRGREVDFVAKMINELDII 1urvA 134 :VVAEEFASDFPPETQRAWAKLRGL T0365 172 :TDDLQIQLRRQ 1urvA 158 :IYSHVTAAYKE Number of specific fragments extracted= 11 number of extra gaps= 1 total=3617 Number of alignments=464 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)Q53 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)R218 because last residue in template chain is (1urvA)W171 T0365 54 :ISLAEKQGDS 1urvA 19 :LSEAERKAVQ T0365 90 :TQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAY 1urvA 29 :AMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQF T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQLF 1urvA 116 :KHKVEPVYFKILSGVI T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGS 1urvA 138 :EFASDFPPETQRAWAKLRGLIYSHVTAAYKEVG Number of specific fragments extracted= 5 number of extra gaps= 1 total=3622 Number of alignments=465 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)Q53 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)S217 because last residue in template chain is (1urvA)W171 T0365 54 :ISLAEKQGDSLKREIR 1urvA 19 :LSEAERKAVQAMWARL T0365 96 :ANKAKDISGRVIGRQLLIPQALQVPFIAY 1urvA 35 :YANSEDVGVAILVRFFVNFPSAKQYFSQF T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQLF 1urvA 116 :KHKVEPVYFKILSGVI T0365 185 :ALESELNPVDVMFLYKTIEWVGG 1urvA 138 :EFASDFPPETQRAWAKLRGLIYS T0365 208 :LADLAERVG 1urvA 162 :VTAAYKEVG Number of specific fragments extracted= 6 number of extra gaps= 1 total=3628 Number of alignments=466 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set T0365 14 :PIK 1urvA 19 :LSE T0365 20 :EHMDKVY 1urvA 22 :AERKAVQ T0365 34 :PFFEATI 1urvA 29 :AMWARLY T0365 42 :GNW 1urvA 36 :ANS T0365 58 :EKQGDSLKREIRLTLPSGLF 1urvA 39 :EDVGVAILVRFFVNFPSAKQ T0365 110 :QLLIPQALQV 1urvA 65 :HMEDPLEMER T0365 120 :PFI 1urvA 77 :QLR T0365 133 :GLAQQVINELDDLLEAG 1urvA 80 :KHASRVMGALNTVVENL T0365 153 :REVDFVAKMINELDII 1urvA 97 :HDPDKVSSVLALVGKA T0365 169 :EED 1urvA 116 :KHK T0365 172 :TDDLQIQLRRQLF 1urvA 123 :YFKILSGVILEVV T0365 185 :ALESELNPVDVMFLYKTIEWVGGLAD 1urvA 138 :EFASDFPPETQRAWAKLRGLIYSHVT T0365 221 :LMLAR 1urvA 164 :AAYKE Number of specific fragments extracted= 13 number of extra gaps= 0 total=3641 Number of alignments=467 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set T0365 14 :PI 1urvA 19 :LS T0365 19 :QEHMDKVYDCASLLV 1urvA 21 :EAERKAVQAMWARLY T0365 42 :GNWDDA 1urvA 36 :ANSEDV T0365 61 :GDSLKREIRLTLPSGLFM 1urvA 42 :GVAILVRFFVNFPSAKQY T0365 108 :GRQLLIPQALQV 1urvA 63 :FKHMEDPLEMER T0365 130 :DAVGLAQQVINELDDLLEAG 1urvA 77 :QLRKHASRVMGALNTVVENL T0365 153 :REVDFVAKMINELDIIE 1urvA 97 :HDPDKVSSVLALVGKAH T0365 172 :TDDLQIQLRRQLFAL 1urvA 124 :FKILSGVILEVVAEE T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAER 1urvA 140 :ASDFPPETQRAWAKLRGLIYSHVTAAYK Number of specific fragments extracted= 9 number of extra gaps= 0 total=3650 Number of alignments=468 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRR 1urvA 116 :KHKVEPVYFKILS Number of specific fragments extracted= 2 number of extra gaps= 1 total=3652 Number of alignments=469 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 126 :QRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 73 :ERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQ 1urvA 116 :KHKVEPVYFKILSG Number of specific fragments extracted= 2 number of extra gaps= 1 total=3654 Number of alignments=470 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)K59 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)P73 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 7 :LGVFAKS 1urvA 63 :FKHMEDP T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1urvA 74 :RSPQLRKHASRVMGALNTVVENL T0365 42 :GNWDDAVQIRKQISLAE 1urvA 97 :HDPDKVSSVLALVGKAH T0365 74 :SGLFMPV 1urvA 116 :KHKVEPV T0365 84 :DLLELLTQQDKIA 1urvA 123 :YFKILSGVILEVV T0365 108 :GRQL 1urvA 136 :AEEF T0365 112 :LIPQALQVPFIAYLQRCIDAV 1urvA 142 :DFPPETQRAWAKLRGLIYSHV Number of specific fragments extracted= 7 number of extra gaps= 1 total=3661 Number of alignments=471 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set T0365 21 :HMDKVYDCASLLV 1urvA 23 :ERKAVQAMWARLY T0365 42 :GNWDDA 1urvA 36 :ANSEDV T0365 61 :GDSLKREIRLTLPSGLFM 1urvA 42 :GVAILVRFFVNFPSAKQY T0365 108 :GRQLLIPQALQV 1urvA 63 :FKHMEDPLEMER T0365 130 :DAVGLAQQVINELDDLLEAG 1urvA 77 :QLRKHASRVMGALNTVVENL T0365 153 :REVDFVAKMINELDIIE 1urvA 97 :HDPDKVSSVLALVGKAH T0365 172 :TDDLQIQLRRQLFAL 1urvA 124 :FKILSGVILEVVAEE T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAER 1urvA 140 :ASDFPPETQRAWAKLRGLIYSHVTAAYK Number of specific fragments extracted= 8 number of extra gaps= 0 total=3669 Number of alignments=472 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)Q53 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)R218 because last residue in template chain is (1urvA)W171 T0365 54 :ISLAEKQG 1urvA 19 :LSEAERKA T0365 65 :KREIRLTLPSGL 1urvA 27 :VQAMWARLYANS T0365 100 :KDISGRVIGRQLLIPQALQVPFIAY 1urvA 39 :EDVGVAILVRFFVNFPSAKQYFSQF T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQLFA 1urvA 116 :KHKVEPVYFKILSGVIL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGS 1urvA 139 :FASDFPPETQRAWAKLRGLIYSHVTAAYKEVG Number of specific fragments extracted= 6 number of extra gaps= 1 total=3675 Number of alignments=473 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)Q53 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)S217 because last residue in template chain is (1urvA)W171 T0365 54 :ISLAEKQG 1urvA 19 :LSEAERKA T0365 65 :KREIRLTLPSG 1urvA 27 :VQAMWARLYAN T0365 99 :AKDISGRVIGRQLLIPQALQVPFIAY 1urvA 38 :SEDVGVAILVRFFVNFPSAKQYFSQF T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQLFA 1urvA 116 :KHKVEPVYFKILSGVIL T0365 186 :LE 1urvA 137 :EE T0365 188 :SELNPVDVMFLYKTIEWVGG 1urvA 141 :SDFPPETQRAWAKLRGLIYS T0365 208 :LADLAERVG 1urvA 162 :VTAAYKEVG Number of specific fragments extracted= 8 number of extra gaps= 1 total=3683 Number of alignments=474 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)Q53 because first residue in template chain is (1urvA)E18 Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 54 :ISLAEKQG 1urvA 19 :LSEAERKA T0365 65 :KREIRLTLPSGL 1urvA 27 :VQAMWARLYANS T0365 83 :T 1urvA 39 :E T0365 97 :NKAKDISGRVIGR 1urvA 40 :DVGVAILVRFFVN T0365 110 :QLLIPQALQV 1urvA 65 :HMEDPLEMER T0365 130 :DAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 77 :QLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EE 1urvA 116 :KH T0365 171 :DTDDLQIQLRRQLFALE 1urvA 122 :VYFKILSGVILEVVAEE T0365 188 :SELNPVDVMFLYKTIEWVGGLADLA 1urvA 141 :SDFPPETQRAWAKLRGLIYSHVTAA T0365 213 :ERVG 1urvA 167 :KEVG Number of specific fragments extracted= 10 number of extra gaps= 1 total=3693 Number of alignments=475 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)S103 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)R109 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 Warning: unaligning (T0365)N191 because last residue in template chain is (1urvA)W171 T0365 12 :KSPIKPLQEHMDKVYD 1urvA 21 :EAERKAVQAMWARLYA T0365 28 :CASLLVPFFEA 1urvA 42 :GVAILVRFFVN T0365 42 :GNWDDAVQ 1urvA 67 :EDPLEMER T0365 53 :QISLAEKQGDSLKREIRLTLP 1urvA 77 :QLRKHASRVMGALNTVVENLH T0365 81 :ERTDLLELLTQQDKIA 1urvA 98 :DPDKVSSVLALVGKAH T0365 110 :QLLIPQALQVPFIAYL 1urvA 116 :KHKVEPVYFKILSGVI T0365 143 :DDLLEAGFRGREVDFVAKMINELDII 1urvA 132 :LEVVAEEFASDFPPETQRAWAKLRGL T0365 176 :QIQLRRQLFALES 1urvA 158 :IYSHVTAAYKEVG Number of specific fragments extracted= 8 number of extra gaps= 1 total=3701 Number of alignments=476 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRR 1urvA 116 :KHKVEPVYFKILS Number of specific fragments extracted= 2 number of extra gaps= 1 total=3703 Number of alignments=477 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)I167 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)I168 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELD 1urvA 72 :MERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAH T0365 169 :EEDTDDLQIQLRRQ 1urvA 116 :KHKVEPVYFKILSG Number of specific fragments extracted= 2 number of extra gaps= 1 total=3705 Number of alignments=478 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)K59 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)Q60 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 14 :PIKPLQEHMDKVYDCASLLVP 1urvA 74 :RSPQLRKHASRVMGALNTVVE T0365 40 :ITGNWDDAVQIRKQISLAE 1urvA 95 :NLHDPDKVSSVLALVGKAH T0365 73 :PS 1urvA 116 :KH T0365 79 :PVERTDLLELLTQQDK 1urvA 118 :KVEPVYFKILSGVILE T0365 183 :LFALE 1urvA 134 :VVAEE T0365 188 :SELNPVDVMFLYKTIEWVGGLA 1urvA 141 :SDFPPETQRAWAKLRGLIYSHV Number of specific fragments extracted= 6 number of extra gaps= 1 total=3711 Number of alignments=479 # 1urvA read from 1urvA/merged-a2m # found chain 1urvA in template set Warning: unaligning (T0365)S103 because of BadResidue code BAD_PEPTIDE in next template residue (1urvA)L115 Warning: unaligning (T0365)R109 because of BadResidue code BAD_PEPTIDE at template residue (1urvA)L115 T0365 12 :KSPIKPLQEHMDKVYD 1urvA 21 :EAERKAVQAMWARLYA T0365 28 :CASLLVPFFEA 1urvA 42 :GVAILVRFFVN T0365 42 :GNWDDAVQ 1urvA 67 :EDPLEMER T0365 53 :QISLAEKQGDSLKREIRLTLP 1urvA 77 :QLRKHASRVMGALNTVVENLH T0365 81 :ERTDLLELLTQQDKIA 1urvA 98 :DPDKVSSVLALVGKAH T0365 110 :QLLIPQALQVPFIAYL 1urvA 116 :KHKVEPVYFKILSGVI T0365 143 :DDLLEAGFRGREVDFVAKMINELDII 1urvA 132 :LEVVAEEFASDFPPETQRAWAKLRGL T0365 172 :TDDLQIQLRRQ 1urvA 158 :IYSHVTAAYKE Number of specific fragments extracted= 8 number of extra gaps= 1 total=3719 Number of alignments=480 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wkbA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1wkbA/merged-a2m # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 1 :MPVN 1wkbA 456 :AVIK T0365 5 :SILGVFAKSPIKPLQEHMDKVYD 1wkbA 472 :PEWKEKARKALERMKILPETRRA T0365 28 :CASLLVPFFEATITGNWDDAVQIRKQIS 1wkbA 496 :FEAIIDWLDKKACARKIGLGTPLPWDPE T0365 56 :LAEKQGDSLKREIRLTLP 1wkbA 525 :VIESLSDSTIYMAYYTIS T0365 74 :SGLFMPVERTDLLELLTQQD 1wkbA 565 :DYIFLEEFSEDKEKELEKKT T0365 94 :KIANKAKDISGRVIGRQLLIPQALQVPFIAYLQ 1wkbA 596 :EEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAI T0365 127 :RCIDAVGL 1wkbA 636 :KGIAVNGF T0365 135 :AQQVINELDDLLEAGFRGR 1wkbA 694 :VGKLRKQIERFYELISQFA T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESE 1wkbA 726 :DRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIM T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1wkbA 762 :NDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLMAPF Number of specific fragments extracted= 10 number of extra gaps= 0 total=3729 Number of alignments=481 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 2 :P 1wkbA 30 :K T0365 3 :VNSI 1wkbA 97 :RDPK T0365 7 :LGVFA 1wkbA 292 :IGKYV T0365 12 :KSPIKPLQEHMDKVYDCASLLVPFFEATIT 1wkbA 472 :PEWKEKARKALERMKILPETRRAQFEAIID T0365 42 :GNWDDAVQIRKQIS 1wkbA 510 :RKIGLGTPLPWDPE T0365 56 :LAEKQGDSLKREIRLTLP 1wkbA 525 :VIESLSDSTIYMAYYTIS T0365 74 :SGLFMPVERTDLLELLTQQD 1wkbA 565 :DYIFLEEFSEDKEKELEKKT T0365 94 :KIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRC 1wkbA 596 :EEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFR T0365 131 :AVGLAQQVIN 1wkbA 631 :EEHWPKGIAV T0365 141 :ELDDLLEA 1wkbA 660 :NFIDAIEE T0365 149 :GFRGREVDFVAK 1wkbA 681 :AEHDSDFDWRRK T0365 161 :M 1wkbA 704 :F T0365 162 :INELD 1wkbA 716 :VKGNV T0365 189 :ELNPVDVMFLYKTIEWVGGLADLAE 1wkbA 721 :ELKDIDRWMLHRLNKAIKETTNALE T0365 214 :RVGSRLELMLARV 1wkbA 785 :TLADVWVRLMAPF Number of specific fragments extracted= 15 number of extra gaps= 0 total=3744 Number of alignments=482 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 43 :NWDDAVQIRK 1wkbA 690 :RRKEVGKLRK T0365 56 :LAEKQGD 1wkbA 700 :QIERFYE T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGR 1wkbA 708 :ISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQ T0365 110 :QLL 1wkbA 756 :AFY Number of specific fragments extracted= 4 number of extra gaps= 0 total=3748 Number of alignments=483 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 29 :ASLLVPFFEATITGNWDDAV 1wkbA 294 :KYVRNPVSGDEVIILPAEFV T0365 49 :QIRKQISL 1wkbA 344 :EILEKYDI T0365 57 :AEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISG 1wkbA 389 :DKEKLEQATKTIYKAEYHKGIFKVPPYEGKPVQEVKEAIAKEMLEKGI T0365 105 :RVIGRQLLIP 1wkbA 460 :IIHDQWFIDY T0365 115 :QALQVPFIAYLQR 1wkbA 472 :PEWKEKARKALER T0365 131 :AVGLAQQVINELDDLLE 1wkbA 485 :MKILPETRRAQFEAIID T0365 149 :GFRGREVD 1wkbA 502 :WLDKKACA T0365 157 :FVAKMINELD 1wkbA 514 :LGTPLPWDPE T0365 167 :IIEEDTDDLQIQLRRQLF 1wkbA 525 :VIESLSDSTIYMAYYTIS Number of specific fragments extracted= 9 number of extra gaps= 0 total=3757 Number of alignments=484 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Warning: unaligning (T0365)E220 because last residue in template chain is (1wkbA)G810 T0365 1 :MPV 1wkbA 446 :KNV T0365 4 :NSILGVFAKSPIKPLQE 1wkbA 455 :RAVIKIIHDQWFIDYGN T0365 21 :HMDK 1wkbA 525 :VIES T0365 25 :VYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQG 1wkbA 534 :IYMAYYTISRHINKLRQEGKLDPEKLTPEFFDYIFLE T0365 63 :SLKREIRLTLPSGLFMP 1wkbA 571 :EFSEDKEKELEKKTGIP T0365 80 :VERTDLLELLTQQD 1wkbA 592 :HEMKEEFEYWYPLD T0365 95 :IANKAKDISGRVIGRQLLIPQAL 1wkbA 606 :WRCSGKDLIPNHLTFFIFNHVAI T0365 118 :QVPF 1wkbA 631 :EEHW T0365 122 :IAY 1wkbA 677 :IMS T0365 125 :LQRCIDAVGLAQ 1wkbA 701 :IERFYELISQFA T0365 141 :ELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQ 1wkbA 713 :EYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQ T0365 184 :FALESELNP 1wkbA 755 :WAFYSIMND T0365 193 :VDVMFLYKTIEWVGGLAD 1wkbA 778 :AKRYVLRTLADVWVRLMA T0365 211 :LAERVGSRL 1wkbA 801 :ICEELWEKL Number of specific fragments extracted= 14 number of extra gaps= 0 total=3771 Number of alignments=485 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Warning: unaligning (T0365)E220 because last residue in template chain is (1wkbA)G810 T0365 1 :M 1wkbA 4 :L T0365 2 :PVNSILGVFAK 1wkbA 104 :IYRDVYKVPEE T0365 13 :SPIKPLQEH 1wkbA 131 :KAAKETFIR T0365 22 :MDKVYDCAS 1wkbA 213 :KFELRENGE T0365 31 :LLVPFFEATI 1wkbA 296 :VRNPVSGDEV T0365 41 :TGNWDDAVQIR 1wkbA 412 :VPPYEGKPVQE T0365 52 :KQISLAEKQG 1wkbA 426 :AIAKEMLEKG T0365 62 :DSL 1wkbA 446 :KNV T0365 65 :K 1wkbA 453 :G T0365 66 :REIRLTLPSGLFMPVER 1wkbA 455 :RAVIKIIHDQWFIDYGN T0365 83 :TDLLELLTQQ 1wkbA 475 :KEKARKALER T0365 93 :DKIANKAKDISGRVIGRQLLIPQALQV 1wkbA 494 :AQFEAIIDWLDKKACARKIGLGTPLPW T0365 120 :PFIAYLQRCIDAVGLA 1wkbA 525 :VIESLSDSTIYMAYYT T0365 136 :QQVINE 1wkbA 547 :KLRQEG T0365 142 :LDDLLEAGFRGR 1wkbA 578 :KELEKKTGIPAE T0365 154 :EVDFVAKMIN 1wkbA 594 :MKEEFEYWYP T0365 165 :LDIIEEDTD 1wkbA 604 :LDWRCSGKD T0365 174 :DLQI 1wkbA 631 :EEHW T0365 178 :QLRRQLFAL 1wkbA 671 :DVVRLYIMS T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVG 1wkbA 719 :NVELKDIDRWMLHRLNKAIKETTNALEEFR T0365 217 :SRL 1wkbA 807 :EKL Number of specific fragments extracted= 21 number of extra gaps= 0 total=3792 Number of alignments=486 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 65 :K 1wkbA 453 :G T0365 66 :REIRLTLPSGLFMPVERT 1wkbA 455 :RAVIKIIHDQWFIDYGNP T0365 178 :QLRRQLFALESELNPVDVMFLYKTIEWVGGLADLA 1wkbA 473 :EWKEKARKALERMKILPETRRAQFEAIIDWLDKKA Number of specific fragments extracted= 3 number of extra gaps= 0 total=3795 Number of alignments=487 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 49 :QIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1wkbA 276 :QDREIEVIEEFKGEKLIGKYVRNPVSGDEVIILPA T0365 84 :DLLELLTQQDKIANKAKDISGRVIGR 1wkbA 374 :PAVEEVNKLGIKSQKDKEKLEQATKT T0365 110 :QLLIPQALQVP 1wkbA 429 :KEMLEKGIAEI T0365 121 :FIAYLQR 1wkbA 466 :FIDYGNP T0365 178 :QLRRQLFALESELNPVDVMFLYKTIEWVGGLADL 1wkbA 473 :EWKEKARKALERMKILPETRRAQFEAIIDWLDKK Number of specific fragments extracted= 5 number of extra gaps= 0 total=3800 Number of alignments=488 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 1 :MPVNSILGVFAKS 1wkbA 89 :GIAERIKNRDPKT T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGN 1wkbA 125 :IVKYFMKAAKETFIRAGFSVDWSREFYTTS T0365 44 :WDDAVQIRKQISLAEKQGDSLKRE 1wkbA 157 :PPFSKFIEWQFWKLKEKGYIVKGA T0365 68 :IRLTLPSGLFMPVE 1wkbA 376 :VEEVNKLGIKSQKD T0365 82 :RTDLLELLTQQDK 1wkbA 475 :KEKARKALERMKI T0365 95 :IANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAV 1wkbA 597 :EFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFREEHW T0365 133 :GLAQQ 1wkbA 676 :YIMSL T0365 138 :VINELDDLLEAGFRGREV 1wkbA 682 :EHDSDFDWRRKEVGKLRK T0365 157 :FVAKMINELDIIEEDTDDLQIQ 1wkbA 700 :QIERFYELISQFAEYEVKGNVE T0365 190 :LNPVDVMFLYKTIEWVGGLADLAE 1wkbA 722 :LKDIDRWMLHRLNKAIKETTNALE T0365 214 :RVGSRLELMLARV 1wkbA 748 :RTRTAVQWAFYSI Number of specific fragments extracted= 11 number of extra gaps= 0 total=3811 Number of alignments=489 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 1 :MPVNSILGVFAKS 1wkbA 89 :GIAERIKNRDPKT T0365 14 :PIKPLQEHMDKVYDCASLLVP 1wkbA 125 :IVKYFMKAAKETFIRAGFSVD T0365 35 :FFEATIT 1wkbA 148 :REFYTTS T0365 42 :GNWD 1wkbA 183 :VRWD T0365 46 :DA 1wkbA 332 :DH T0365 48 :VQIRKQ 1wkbA 345 :ILEKYD T0365 54 :ISLAEKQGDSLKRE 1wkbA 376 :VEEVNKLGIKSQKD T0365 68 :IRLTLPSGLFMPVE 1wkbA 459 :KIIHDQWFIDYGNP T0365 82 :RTDLLELLTQ 1wkbA 475 :KEKARKALER T0365 93 :D 1wkbA 485 :M T0365 94 :KIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRC 1wkbA 596 :EEFEYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFR T0365 141 :ELDDLL 1wkbA 660 :NFIDAI T0365 147 :EAGFRGRE 1wkbA 691 :RKEVGKLR T0365 157 :FVAKMINELDIIEEDTDDLQIQ 1wkbA 700 :QIERFYELISQFAEYEVKGNVE T0365 190 :LNPVDVMFLYKTIEWVGGLADLAERVGSRL 1wkbA 722 :LKDIDRWMLHRLNKAIKETTNALEEFRTRT T0365 220 :ELMLARV 1wkbA 754 :QWAFYSI Number of specific fragments extracted= 16 number of extra gaps= 0 total=3827 Number of alignments=490 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 105 :RVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEA 1wkbA 96 :NRDPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFIR Number of specific fragments extracted= 1 number of extra gaps= 0 total=3828 Number of alignments=491 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLE 1wkbA 104 :IYRDVYKVPEEILWTFEDPINIVKYFMKAAKETFI Number of specific fragments extracted= 1 number of extra gaps= 0 total=3829 Number of alignments=492 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Warning: unaligning (T0365)F77 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1wkbA)F373 T0365 78 :MPVERTDLLELLTQQDK 1wkbA 374 :PAVEEVNKLGIKSQKDK Number of specific fragments extracted= 1 number of extra gaps= 0 total=3830 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=3830 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 2 :PVNSILGVFAKS 1wkbA 5 :NFKAIEEKWQKR T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEK 1wkbA 23 :FEPNIRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKR T0365 60 :QGDSLKREIRLTLPSGLFMPVE 1wkbA 70 :QGYNVLFPMAWHITGSPIVGIA T0365 82 :RTDLLELLTQQDKIANKAKDISGRVI 1wkbA 95 :KNRDPKTIWIYRDVYKVPEEILWTFE T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1wkbA 121 :DPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVG T0365 188 :SELNPVDVMFLYKT 1wkbA 191 :TPLGDHDLMEGEDV T0365 218 :RLELMLARV 1wkbA 206 :ILDYIIIKF Number of specific fragments extracted= 7 number of extra gaps= 0 total=3837 Number of alignments=493 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 14 :PIKPLQEHMDKVYDCASLLVPFF 1wkbA 5 :NFKAIEEKWQKRWLEAKIFEPNI T0365 42 :GNWDDAVQIRKQI 1wkbA 28 :RDKPKEKKFYITV T0365 55 :SLAEKQGDSLKREIRLTLPS 1wkbA 46 :SGHLHVGHARTYTIPDVIAR T0365 75 :GLFMPVE 1wkbA 73 :NVLFPMA T0365 82 :RT 1wkbA 84 :GS T0365 87 :ELLTQQDKIANKAKDISGRVI 1wkbA 86 :PIVGIAERIKNRDPKTIWIYR T0365 108 :GRQLL 1wkbA 108 :VYKVP T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1wkbA 118 :TFEDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVVG T0365 188 :SELNPVDVMFLYKT 1wkbA 191 :TPLGDHDLMEGEDV T0365 217 :SRLELMLAR 1wkbA 205 :PILDYIIIK Number of specific fragments extracted= 10 number of extra gaps= 0 total=3847 Number of alignments=494 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 2 :PVNSI 1wkbA 5 :NFKAI T0365 10 :FAKS 1wkbA 95 :KNRD T0365 14 :PIKPL 1wkbA 112 :PEEIL T0365 19 :QEHMDKVYDCASLLV 1wkbA 123 :INIVKYFMKAAKETF T0365 34 :PFFEATITG 1wkbA 166 :QFWKLKEKG T0365 43 :NWDDAVQIRKQISLAEKQ 1wkbA 389 :DKEKLEQATKTIYKAEYH T0365 62 :DSLKREIRLTLPSGLFMPVE 1wkbA 472 :PEWKEKARKALERMKILPET T0365 82 :RTDLLELLTQQD 1wkbA 493 :RAQFEAIIDWLD T0365 94 :KIANKA 1wkbA 540 :TISRHI T0365 100 :KDISGRVIGR 1wkbA 561 :PEFFDYIFLE T0365 110 :QLLIPQALQVPFIAYLQR 1wkbA 583 :KTGIPAEIIHEMKEEFEY T0365 128 :CIDAVGL 1wkbA 661 :FIDAIEE T0365 135 :AQQVINELDDLLEA 1wkbA 697 :LRKQIERFYELISQ T0365 150 :FRGREV 1wkbA 711 :FAEYEV T0365 156 :DFVAKMINELDIIEEDTDDLQ 1wkbA 724 :DIDRWMLHRLNKAIKETTNAL T0365 177 :IQLRRQLFALESELNPVDVMFLYKTIEWVGGLA 1wkbA 762 :NDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLM T0365 217 :SRLELMLAR 1wkbA 800 :HICEELWEK Number of specific fragments extracted= 17 number of extra gaps= 0 total=3864 Number of alignments=495 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 1 :MPVNSILG 1wkbA 4 :LNFKAIEE T0365 12 :KS 1wkbA 97 :RD T0365 14 :PIKPL 1wkbA 112 :PEEIL T0365 21 :HMDKVYDCA 1wkbA 129 :FMKAAKETF T0365 30 :SLLVPFFEATI 1wkbA 157 :PPFSKFIEWQF T0365 43 :NW 1wkbA 392 :KL T0365 45 :DDAVQIRKQ 1wkbA 395 :QATKTIYKA T0365 54 :ISLAEKQGDS 1wkbA 420 :VQEVKEAIAK T0365 64 :LKREIRLTLPSGLFMPV 1wkbA 474 :WKEKARKALERMKILPE T0365 81 :ERTDLLELLTQ 1wkbA 492 :RRAQFEAIIDW T0365 92 :QDKIANKAKDI 1wkbA 538 :YYTISRHINKL T0365 103 :SGRVIGRQ 1wkbA 564 :FDYIFLEE T0365 113 :IPQALQVPFIA 1wkbA 572 :FSEDKEKELEK T0365 124 :YLQRCIDAVGLA 1wkbA 590 :IIHEMKEEFEYW T0365 136 :QQVINE 1wkbA 662 :IDAIEE T0365 142 :LD 1wkbA 675 :LY T0365 145 :LLEAGFRGR 1wkbA 677 :IMSLAEHDS T0365 154 :EVDFVAKMINELDII 1wkbA 690 :RRKEVGKLRKQIERF T0365 169 :EEDTDDLQIQLRRQLFALESELNPVDVMFL 1wkbA 726 :DRWMLHRLNKAIKETTNALEEFRTRTAVQW T0365 199 :YKTIEWVGGLADL 1wkbA 758 :YSIMNDLRWYLRR T0365 212 :AERVGSRLELMLAR 1wkbA 783 :LRTLADVWVRLMAP Number of specific fragments extracted= 21 number of extra gaps= 0 total=3885 Number of alignments=496 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 54 :ISLAEKQGDSLKREIRLTLPS 1wkbA 662 :IDAIEENGADVVRLYIMSLAE T0365 75 :GLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQL 1wkbA 684 :DSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNV T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 1wkbA 721 :ELKDIDRWMLHRLNKAIKETTNALEEFRT T0365 147 :EAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1wkbA 750 :RTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADV Number of specific fragments extracted= 4 number of extra gaps= 0 total=3889 Number of alignments=497 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 50 :IRKQISLAEKQGDSLKREIRLTLPS 1wkbA 658 :VLNFIDAIEENGADVVRLYIMSLAE T0365 77 :FMPVERTDLLELLTQQDKIANKAKDISGR 1wkbA 686 :DFDWRRKEVGKLRKQIERFYELISQFAEY T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1wkbA 715 :EVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRT T0365 147 :EAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1wkbA 750 :RTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADV Number of specific fragments extracted= 4 number of extra gaps= 0 total=3893 Number of alignments=498 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 80 :VERTDLLELLTQQDKIANKAKDIS 1wkbA 689 :WRRKEVGKLRKQIERFYELISQFA T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1wkbA 713 :EYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEF T0365 143 :DDLLEAGFR 1wkbA 750 :RTAVQWAFY T0365 174 :DLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLA 1wkbA 759 :SIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLM Number of specific fragments extracted= 4 number of extra gaps= 0 total=3897 Number of alignments=499 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 80 :VERTDLLELLTQQDKIANKAKDIS 1wkbA 689 :WRRKEVGKLRKQIERFYELISQFA T0365 108 :GRQLL 1wkbA 713 :EYEVK T0365 115 :Q 1wkbA 718 :G T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINEL 1wkbA 721 :ELKDIDRWMLHRLNKAIKETTNALEEF T0365 143 :DDLLEAGF 1wkbA 750 :RTAVQWAF T0365 170 :EDTDDLQIQLRRQL 1wkbA 758 :YSIMNDLRWYLRRT T0365 185 :A 1wkbA 772 :E T0365 188 :SELNPVDVMFLYKTIEWVGGLA 1wkbA 773 :GRDDEAKRYVLRTLADVWVRLM Number of specific fragments extracted= 8 number of extra gaps= 0 total=3905 Number of alignments=500 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 2 :PVNSILGVFAKSPIKP 1wkbA 10 :EEKWQKRWLEAKIFEP T0365 18 :LQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEK 1wkbA 27 :IRDKPKEKKFYITVAFPYLSGHLHVGHARTYTIPDVIARFKR T0365 60 :QGDSLKREIRLTLPSGLFMPVE 1wkbA 70 :QGYNVLFPMAWHITGSPIVGIA T0365 82 :RTDLLELLTQQDKIANKAKDISGRV 1wkbA 95 :KNRDPKTIWIYRDVYKVPEEILWTF T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1wkbA 120 :EDPINIVKYFMKAAKETFIRAGFSVDWSREFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVRWDPVV T0365 185 :ALESELNPVDVMFLYKTIEWVG 1wkbA 194 :GDHDLMEGEDVPILDYIIIKFE T0365 212 :AERVGSRLELMLAR 1wkbA 216 :LRENGEVIYLPAAT Number of specific fragments extracted= 7 number of extra gaps= 0 total=3912 Number of alignments=501 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 4 :NSILGVF 1wkbA 12 :KWQKRWL T0365 11 :AKS 1wkbA 31 :PKE T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1wkbA 41 :AFPYLSGHLHVGHARTYTIPDVIARFK T0365 41 :TGNW 1wkbA 69 :MQGY T0365 45 :DDAVQIRKQISLAEKQGDSLKREI 1wkbA 85 :SPIVGIAERIKNRDPKTIWIYRDV T0365 69 :RLTLPSGLFMPVE 1wkbA 112 :PEEILWTFEDPIN Number of specific fragments extracted= 6 number of extra gaps= 0 total=3918 Number of alignments=502 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 2 :PVN 1wkbA 5 :NFK T0365 6 :ILGVFAKSPIK 1wkbA 23 :FEPNIRDKPKE T0365 24 :KVYDCASL 1wkbA 62 :VIARFKRM T0365 32 :LVPFFEATITGNWDDAVQIRK 1wkbA 87 :IVGIAERIKNRDPKTIWIYRD T0365 62 :DSLKR 1wkbA 113 :EEILW T0365 67 :EIRLTL 1wkbA 127 :KYFMKA T0365 84 :DLLELLTQQDKIAN 1wkbA 537 :AYYTISRHINKLRQ T0365 100 :KDISGRVIGR 1wkbA 561 :PEFFDYIFLE T0365 110 :QLLIPQALQVPFIAYLQR 1wkbA 583 :KTGIPAEIIHEMKEEFEY T0365 128 :CIDAVGL 1wkbA 661 :FIDAIEE T0365 135 :AQQVINELDDLLEA 1wkbA 697 :LRKQIERFYELISQ T0365 150 :FRGREV 1wkbA 711 :FAEYEV T0365 156 :DFVAKMINELDIIEEDTDDLQ 1wkbA 724 :DIDRWMLHRLNKAIKETTNAL T0365 177 :IQLRRQLFALESELNPVDVMFLYKTIEWVGGLA 1wkbA 762 :NDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLM T0365 214 :RVGSRLE 1wkbA 800 :HICEELW T0365 224 :AR 1wkbA 807 :EK Number of specific fragments extracted= 16 number of extra gaps= 0 total=3934 Number of alignments=503 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Warning: unaligning (T0365)K12 because first residue in template chain is (1wkbA)L4 T0365 13 :SPIKPLQEHMDKVYD 1wkbA 5 :NFKAIEEKWQKRWLE T0365 29 :ASLLV 1wkbA 59 :IPDVI T0365 37 :EATITGNWDDAVQI 1wkbA 91 :AERIKNRDPKTIWI T0365 51 :RKQISLA 1wkbA 122 :PINIVKY T0365 58 :EKQGDSLKREI 1wkbA 130 :MKAAKETFIRA T0365 73 :PSGLFM 1wkbA 147 :SREFYT T0365 79 :PVER 1wkbA 158 :PFSK T0365 84 :DLLELLTQQDKIAN 1wkbA 537 :AYYTISRHINKLRQ T0365 100 :KDISGRVIGRQLL 1wkbA 561 :PEFFDYIFLEEFS T0365 115 :QALQVPFIAYLQ 1wkbA 574 :EDKEKELEKKTG T0365 127 :RCIDAVGLA 1wkbA 590 :IIHEMKEEF T0365 136 :QQVINE 1wkbA 662 :IDAIEE T0365 142 :LD 1wkbA 675 :LY T0365 145 :LLEAGFRG 1wkbA 677 :IMSLAEHD T0365 153 :REVDFVAKMINELDII 1wkbA 689 :WRRKEVGKLRKQIERF T0365 169 :EEDTDDLQIQLRRQLFALESELNPVDVMFL 1wkbA 726 :DRWMLHRLNKAIKETTNALEEFRTRTAVQW T0365 199 :YKTIEWVGGLADL 1wkbA 758 :YSIMNDLRWYLRR T0365 212 :AERVGSRLELMLAR 1wkbA 783 :LRTLADVWVRLMAP Number of specific fragments extracted= 18 number of extra gaps= 0 total=3952 Number of alignments=504 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 54 :ISLAEKQGDSLKREIRLTLPS 1wkbA 662 :IDAIEENGADVVRLYIMSLAE T0365 75 :GLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQL 1wkbA 684 :DSDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNV T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 1wkbA 721 :ELKDIDRWMLHRLNKAIKETTNALEEFRT T0365 147 :EAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1wkbA 750 :RTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLAD Number of specific fragments extracted= 4 number of extra gaps= 0 total=3956 Number of alignments=505 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 49 :QIRKQISLAEKQGDSLKREIRLTLPS 1wkbA 657 :NVLNFIDAIEENGADVVRLYIMSLAE T0365 76 :LFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQL 1wkbA 685 :SDFDWRRKEVGKLRKQIERFYELISQFAEYEVKGNV T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 1wkbA 721 :ELKDIDRWMLHRLNKAIKETTNALEEFRT T0365 147 :EAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1wkbA 750 :RTAVQWAFYSIMNDLRWYLRRTEGRDDEAKRYVLRTLADV Number of specific fragments extracted= 4 number of extra gaps= 0 total=3960 Number of alignments=506 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 80 :VERTDLLELLTQQDKIANKAKDIS 1wkbA 689 :WRRKEVGKLRKQIERFYELISQFA T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDD 1wkbA 713 :EYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRT T0365 156 :DFVAKM 1wkbA 750 :RTAVQW T0365 174 :DLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLA 1wkbA 759 :SIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRLM Number of specific fragments extracted= 4 number of extra gaps= 0 total=3964 Number of alignments=507 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 80 :VERTDLLELLTQQDKIANKAKDIS 1wkbA 689 :WRRKEVGKLRKQIERFYELISQFA T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1wkbA 713 :EYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFR T0365 161 :MINELDIIEEDTDDLQIQLRRQ 1wkbA 749 :TRTAVQWAFYSIMNDLRWYLRR T0365 186 :LESELNPVDVMFLYKTIEWVGGLA 1wkbA 771 :TEGRDDEAKRYVLRTLADVWVRLM Number of specific fragments extracted= 4 number of extra gaps= 0 total=3968 Number of alignments=508 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Warning: unaligning (T0365)L31 because first residue in template chain is (1wkbA)L4 T0365 32 :LVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1wkbA 5 :NFKAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHART T0365 102 :ISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1wkbA 57 :YTIPDVIARFKRMQGYNVLFPMAWHITGSPIVGIAERIKNR T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1wkbA 98 :DPKTIWIYRDVYKVPEEILWTFEDPINIVKYFMKAAK T0365 190 :LNPVDVMFLYKTIEWVGGLA 1wkbA 135 :ETFIRAGFSVDWSREFYTTS T0365 211 :LAERVGSRLELMLARV 1wkbA 155 :LFPPFSKFIEWQFWKL Number of specific fragments extracted= 5 number of extra gaps= 0 total=3973 Number of alignments=509 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1wkbA)L4 T0365 5 :SI 1wkbA 5 :NF T0365 34 :PFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1wkbA 7 :KAIEEKWQKRWLEAKIFEPNIRDKPKEKKFYITVAFPYLSGHLHVGHART T0365 84 :D 1wkbA 61 :D T0365 85 :LLELLTQQ 1wkbA 63 :IARFKRMQ T0365 93 :DK 1wkbA 85 :SP T0365 99 :AKDISGRVIGRQLL 1wkbA 87 :IVGIAERIKNRDPK T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQQVINEL 1wkbA 111 :VPEEILWTFEDPINIVKYFMKAAKETFIRA T0365 143 :DDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQL 1wkbA 148 :REFYTTSLFPPFSKFIEWQFWKLKEKGYIVKGAHRVR T0365 198 :LYKTIEWVGGLADLAER 1wkbA 185 :WDPVVGTPLGDHDLMEG T0365 216 :GSRLELMLARV 1wkbA 204 :VPILDYIIIKF Number of specific fragments extracted= 10 number of extra gaps= 0 total=3983 Number of alignments=510 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1wkbA)L4 T0365 5 :S 1wkbA 5 :N T0365 6 :ILGVFAK 1wkbA 28 :RDKPKEK T0365 13 :SPIKPLQEHMDKVYDCASL 1wkbA 121 :DPINIVKYFMKAAKETFIR T0365 32 :LVP 1wkbA 170 :LKE T0365 42 :GNWDDAVQIRKQISLAEKQ 1wkbA 388 :KDKEKLEQATKTIYKAEYH T0365 63 :SLKREIRLTLPSGLFMPVERT 1wkbA 473 :EWKEKARKALERMKILPETRR T0365 84 :DLLELLTQ 1wkbA 495 :QFEAIIDW T0365 92 :QDKIANKAK 1wkbA 541 :ISRHINKLR T0365 101 :DISGRVIGRQLL 1wkbA 562 :EFFDYIFLEEFS T0365 113 :IPQALQVPFIAYLQRC 1wkbA 586 :IPAEIIHEMKEEFEYW T0365 130 :DAVGLAQQVINELDDLLEA 1wkbA 692 :KEVGKLRKQIERFYELISQ T0365 149 :GFRGR 1wkbA 715 :EVKGN T0365 154 :EVDFVAKMINELDIIEEDTDD 1wkbA 722 :LKDIDRWMLHRLNKAIKETTN T0365 175 :LQIQLRRQLFALESELNPVDVMFLYKTIEWVGGL 1wkbA 760 :IMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVRL T0365 214 :RVGSRLELML 1wkbA 800 :HICEELWEKL Number of specific fragments extracted= 15 number of extra gaps= 0 total=3998 Number of alignments=511 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 3 :VNSILGVFAK 1wkbA 25 :PNIRDKPKEK T0365 15 :IKPLQE 1wkbA 102 :IWIYRD T0365 21 :HMDKVYDCA 1wkbA 129 :FMKAAKETF T0365 30 :SLLVPFFEATI 1wkbA 157 :PPFSKFIEWQF T0365 47 :AVQIRKQ 1wkbA 397 :TKTIYKA T0365 54 :ISLAEKQGDS 1wkbA 420 :VQEVKEAIAK T0365 64 :LKREIRLTLPSGLFMP 1wkbA 474 :WKEKARKALERMKILP T0365 82 :RTDLLELLT 1wkbA 493 :RAQFEAIID T0365 91 :QQDKIAN 1wkbA 544 :HINKLRQ T0365 102 :ISGRVIGR 1wkbA 563 :FFDYIFLE T0365 112 :LIPQALQVPFIA 1wkbA 571 :EFSEDKEKELEK T0365 124 :YLQRCIDAVGLA 1wkbA 590 :IIHEMKEEFEYW T0365 136 :QQVINELDD 1wkbA 662 :IDAIEENGA T0365 145 :LLEAGFRG 1wkbA 677 :IMSLAEHD T0365 154 :EVDFVAKMINELDI 1wkbA 690 :RRKEVGKLRKQIER T0365 168 :IEEDTDDLQIQLRRQLFALESELNPVDVMFL 1wkbA 725 :IDRWMLHRLNKAIKETTNALEEFRTRTAVQW T0365 199 :YKTIEWVGGLADL 1wkbA 758 :YSIMNDLRWYLRR T0365 212 :AERVGSRLELMLAR 1wkbA 783 :LRTLADVWVRLMAP Number of specific fragments extracted= 18 number of extra gaps= 0 total=4016 Number of alignments=512 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 165 :LDIIEEDTDDLQIQLRRQLFALESELNP 1wkbA 662 :IDAIEENGADVVRLYIMSLAEHDSDFDW Number of specific fragments extracted= 1 number of extra gaps= 0 total=4017 Number of alignments=513 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 162 :INELDIIEEDTDDLQIQLRRQLFALESELNPV 1wkbA 659 :LNFIDAIEENGADVVRLYIMSLAEHDSDFDWR Number of specific fragments extracted= 1 number of extra gaps= 0 total=4018 Number of alignments=514 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 78 :MPVERTDLLELLTQQDKIANKAKDISGRVI 1wkbA 687 :FDWRRKEVGKLRKQIERFYELISQFAEYEV T0365 109 :RQLLIPQALQVPFIAYL 1wkbA 717 :KGNVELKDIDRWMLHRL T0365 129 :IDAVGLAQQVINEL 1wkbA 734 :NKAIKETTNALEEF T0365 153 :R 1wkbA 748 :R T0365 155 :VDFVAKMI 1wkbA 749 :TRTAVQWA T0365 174 :DLQIQLRRQLFALESELNPVDVMFLYKTIEWVGG 1wkbA 759 :SIMNDLRWYLRRTEGRDDEAKRYVLRTLADVWVR Number of specific fragments extracted= 6 number of extra gaps= 0 total=4024 Number of alignments=515 # 1wkbA read from 1wkbA/merged-a2m # found chain 1wkbA in template set T0365 78 :MPVERTDLLELLTQQDKIANKAKDISG 1wkbA 687 :FDWRRKEVGKLRKQIERFYELISQFAE T0365 109 :RQLL 1wkbA 714 :YEVK T0365 113 :IPQALQVPFIAYLQRC 1wkbA 721 :ELKDIDRWMLHRLNKA T0365 132 :VGLAQQVINEL 1wkbA 737 :IKETTNALEEF T0365 153 :R 1wkbA 748 :R T0365 165 :LDIIEEDTDDLQIQLRRQLFALESELN 1wkbA 749 :TRTAVQWAFYSIMNDLRWYLRRTEGRD T0365 192 :PVDVMFLYKTIEWVGGLA 1wkbA 777 :EAKRYVLRTLADVWVRLM Number of specific fragments extracted= 7 number of extra gaps= 0 total=4031 Number of alignments=516 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hw1A/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1hw1A/merged-a2m # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 5 :SILGVFAKSPIKPLQEH 1hw1A 7 :SPAGFAEEYIIESIWNN T0365 34 :PFFEATI 1hw1A 24 :RFPPGTI T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFI 1hw1A 32 :PAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNFWETSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFI T0365 123 :AYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1hw1A 119 :QHPDKAQEVLATANEVADHADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFA T0365 187 :ESELNPVDVMFLYKTIEWVG 1hw1A 182 :NPEARSLALGFYHKLSALCS T0365 207 :GLADLAERVGSRLELMLAR 1hw1A 207 :QVYETVRRYGHESGEIWHR T0365 226 :V 1hw1A 227 :Q Number of specific fragments extracted= 7 number of extra gaps= 0 total=4038 Number of alignments=517 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4038 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 1 :MPVNSIL 1hw1A 25 :FPPGTIL T0365 8 :GVFAKSPIKPLQEHM 1hw1A 68 :PTKVNNFWETSGLNI T0365 82 :RTDLLELLTQ 1hw1A 83 :LETLARLDHE T0365 92 :QDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1hw1A 98 :IDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVAD T0365 144 :DLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLY 1hw1A 137 :HADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGF T0365 200 :KTIEWVGGLADLAERVGSRLELMLARV 1hw1A 204 :AHDQVYETVRRYGHESGEIWHRMQKNL Number of specific fragments extracted= 6 number of extra gaps= 0 total=4044 Number of alignments=518 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 1 :MPVNSIL 1hw1A 25 :FPPGTIL T0365 8 :GVFAKSPIKPLQEHM 1hw1A 68 :PTKVNNFWETSGLNI T0365 85 :LLELLTQ 1hw1A 86 :LARLDHE T0365 92 :QDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1hw1A 98 :IDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVAD T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1hw1A 137 :HADAFAELDYNIFRGLAFASGNPIYGLILNGMK T0365 191 :NPVDV 1hw1A 170 :GLYTR T0365 197 :FLYKTIEWVGGLADLA 1hw1A 175 :IGRHYFANPEARSLAL T0365 213 :ERVGSRLELMLARV 1hw1A 217 :HESGEIWHRMQKNL Number of specific fragments extracted= 8 number of extra gaps= 0 total=4052 Number of alignments=519 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 111 :LLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQ 1hw1A 162 :GLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=4053 Number of alignments=520 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 109 :RQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVA 1hw1A 160 :IYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQVYE Number of specific fragments extracted= 1 number of extra gaps= 0 total=4054 Number of alignments=521 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 2 :P 1hw1A 8 :P T0365 4 :NSI 1hw1A 9 :AGF T0365 7 :L 1hw1A 31 :L T0365 8 :GVFAKSPI 1hw1A 68 :PTKVNNFW T0365 72 :LPSGLFMPVERTDLLELLTQ 1hw1A 76 :ETSGLNILETLARLDHESVP T0365 92 :QDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1hw1A 98 :IDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVAD T0365 144 :DLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNP 1hw1A 137 :HADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEA T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1hw1A 197 :SALCSEGAHDQVYETVRRYGHESGEIWHRMQKNL Number of specific fragments extracted= 8 number of extra gaps= 0 total=4062 Number of alignments=522 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 92 :QDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCID 1hw1A 98 :IDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVAD T0365 144 :DLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1hw1A 137 :HADAFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRH T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1hw1A 190 :LGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKNL Number of specific fragments extracted= 3 number of extra gaps= 0 total=4065 Number of alignments=523 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATIT 1hw1A 81 :NILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAF T0365 43 :NWDDAVQIRKQISLAEKQG 1hw1A 118 :RQHPDKAQEVLATANEVAD T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1hw1A 137 :HADAFAELDYNIFRGLAFASGNPI T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDL 1hw1A 161 :YGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRM Number of specific fragments extracted= 4 number of extra gaps= 0 total=4069 Number of alignments=524 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 22 :MDKVYDCASLLVPFFEATIT 1hw1A 98 :IDNLLSVRTNISTIFIRTAF T0365 43 :NWDDAVQIRKQISLAEKQG 1hw1A 118 :RQHPDKAQEVLATANEVAD T0365 84 :DLLELLTQQDKIANKAKDISGRVI 1hw1A 137 :HADAFAELDYNIFRGLAFASGNPI T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEED 1hw1A 161 :YGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEI Number of specific fragments extracted= 4 number of extra gaps= 0 total=4073 Number of alignments=525 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L179 because last residue in template chain is (1hw1A)L230 T0365 1 :MPVNSIL 1hw1A 25 :FPPGTIL T0365 8 :GVFAKSP 1hw1A 68 :PTKVNNF T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGN 1hw1A 95 :PQLIDNLLSVRTNISTIFIRTAFRQHPDK T0365 46 :DAVQIRKQISLAEKQGDSLK 1hw1A 124 :AQEVLATANEVADHADAFAE T0365 78 :MPVERTDLLELLTQQDKIANKAKDISGRVIGRQLL 1hw1A 144 :LDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRH T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQ 1hw1A 179 :YFANPEARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 6 number of extra gaps= 0 total=4079 Number of alignments=526 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 1 :MPVNSIL 1hw1A 6 :QSPAGFA T0365 26 :YD 1hw1A 13 :EE T0365 34 :PFFEATITGNWDDAVQIRKQISLAEKQGD 1hw1A 15 :YIIESIWNNRFPPGTILPAERELSELIGV T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVG 1hw1A 54 :RLARDGWLTIQHGKPTKVNNFWETSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKA T0365 134 :LAQQVIN 1hw1A 137 :HADAFAE T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAERVGS 1hw1A 144 :LDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSE T0365 218 :RLELMLARV 1hw1A 222 :IWHRMQKNL Number of specific fragments extracted= 7 number of extra gaps= 0 total=4086 Number of alignments=527 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 133 :GLAQQVINELDDLLEAG 1hw1A 7 :SPAGFAEEYIIESIWNN Number of specific fragments extracted= 1 number of extra gaps= 0 total=4087 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 130 :DAVGLAQQVINELDDLLEAGFRG 1hw1A 181 :ANPEARSLALGFYHKLSALCSEG Number of specific fragments extracted= 1 number of extra gaps= 0 total=4088 Number of alignments=528 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 72 :LPSGLFMPVER 1hw1A 25 :FPPGTILPAER Number of specific fragments extracted= 1 number of extra gaps= 0 total=4089 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4089 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L183 because last residue in template chain is (1hw1A)L230 T0365 4 :NSILGVFAKS 1hw1A 19 :SIWNNRFPPG T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNW 1hw1A 30 :ILPAERELSELIGVTRTTLREVLQRLARDGW T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDL 1hw1A 77 :TSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAF T0365 86 :LELLTQQDKIANKAKDISGRVIGR 1hw1A 125 :QEVLATANEVADHADAFAELDYNI T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEA 1hw1A 161 :YGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSAL T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQ 1hw1A 200 :CSEGAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 6 number of extra gaps= 0 total=4095 Number of alignments=529 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L183 because last residue in template chain is (1hw1A)L230 T0365 5 :SILGVFAKS 1hw1A 20 :IWNNRFPPG T0365 14 :PI 1hw1A 33 :AE T0365 19 :QEHMDKVYDCASLLVPFFEATITGNW 1hw1A 35 :RELSELIGVTRTTLREVLQRLARDGW T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDL 1hw1A 77 :TSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAF T0365 86 :LELLTQQDKIANKAKDISGRVIGR 1hw1A 125 :QEVLATANEVADHADAFAELDYNI T0365 111 :LLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEA 1hw1A 162 :GLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSAL T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQ 1hw1A 200 :CSEGAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 7 number of extra gaps= 0 total=4102 Number of alignments=530 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)A11 because first residue in template chain is (1hw1A)A5 T0365 12 :KSPIKPLQE 1hw1A 6 :QSPAGFAEE T0365 34 :PFFEATITGNW 1hw1A 15 :YIIESIWNNRF T0365 51 :RKQISLAEKQGDSLKREIRLTLPS 1hw1A 34 :ERELSELIGVTRTTLREVLQRLAR T0365 75 :GLFM 1hw1A 59 :GWLT T0365 83 :TDLLEL 1hw1A 84 :ETLARL T0365 89 :LTQQDKIANKAKDISGRVIGRQLL 1hw1A 95 :PQLIDNLLSVRTNISTIFIRTAFR T0365 116 :ALQVPFIAYLQ 1hw1A 119 :QHPDKAQEVLA T0365 130 :DAVGLAQQVINELD 1hw1A 140 :AFAELDYNIFRGLA T0365 147 :EAG 1hw1A 154 :FAS T0365 152 :GREV 1hw1A 157 :GNPI T0365 161 :MINELD 1hw1A 161 :YGLILN T0365 171 :DTDDLQIQLRRQLFA 1hw1A 167 :GMKGLYTRIGRHYFA T0365 191 :NPVDVMFLYKTIEWVGGLA 1hw1A 182 :NPEARSLALGFYHKLSALC T0365 210 :DLAERVGSRLELMLAR 1hw1A 210 :ETVRRYGHESGEIWHR Number of specific fragments extracted= 14 number of extra gaps= 0 total=4116 Number of alignments=531 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L190 because last residue in template chain is (1hw1A)L230 T0365 5 :SILGVFAKS 1hw1A 20 :IWNNRFPPG T0365 14 :PIKPLQEHM 1hw1A 33 :AERELSELI T0365 23 :DKVYDCASLLVP 1hw1A 46 :TTLREVLQRLAR T0365 35 :FFEATITGNWDDAVQIRKQ 1hw1A 82 :ILETLARLDHESVPQLIDN T0365 54 :ISLAEKQGDSLKREIRLT 1hw1A 102 :LSVRTNISTIFIRTAFRQ T0365 81 :ERTDLLELLTQQ 1hw1A 120 :HPDKAQEVLATA T0365 93 :DKIANKAKDISGRVIGRQLL 1hw1A 139 :DAFAELDYNIFRGLAFASGN T0365 115 :QAL 1hw1A 159 :PIY T0365 119 :VPFIAYLQRCID 1hw1A 166 :NGMKGLYTRIGR T0365 131 :AVGLAQQVINELDDLLEAGFR 1hw1A 185 :ARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQLR 1hw1A 212 :VRRYGHESGEIWHRMQ T0365 188 :SE 1hw1A 228 :KN Number of specific fragments extracted= 13 number of extra gaps= 0 total=4129 Number of alignments=532 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L72 because last residue in template chain is (1hw1A)L230 T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1hw1A 203 :GAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=4130 Number of alignments=533 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L72 because last residue in template chain is (1hw1A)L230 T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLT 1hw1A 201 :SEGAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=4131 Number of alignments=534 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 4 :NSILGVFAKSPIKPLQEHMDKVYDCASLLVPF 1hw1A 84 :ETLARLDHESVPQLIDNLLSVRTNISTIFIRT T0365 39 :TITGNWDDAVQIRKQISLAEKQGDSLKRE 1hw1A 116 :AFRQHPDKAQEVLATANEVADHADAFAEL T0365 85 :LLELLTQQD 1hw1A 145 :DYNIFRGLA T0365 94 :KIANKAKDISGRVIGRQLL 1hw1A 163 :LILNGMKGLYTRIGRHYFA T0365 114 :PQ 1hw1A 182 :NP T0365 130 :DAVGLAQQVINELDDLLEAG 1hw1A 184 :EARSLALGFYHKLSALCSEG T0365 154 :EVDFV 1hw1A 204 :AHDQV T0365 162 :INELDIIEEDTDDLQIQ 1hw1A 209 :YETVRRYGHESGEIWHR Number of specific fragments extracted= 8 number of extra gaps= 0 total=4139 Number of alignments=535 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCA 1hw1A 85 :TLARLDHESVPQLIDNLLSVRTNIS T0365 33 :VPFFEATITGNWDDAVQIRK 1hw1A 110 :TIFIRTAFRQHPDKAQEVLA T0365 71 :TLPS 1hw1A 130 :TANE T0365 78 :MPVERTDL 1hw1A 134 :VADHADAF T0365 96 :ANKAKDISGRVIGRQLL 1hw1A 142 :AELDYNIFRGLAFASGN T0365 115 :QAL 1hw1A 159 :PIY T0365 119 :VPFIAYLQRCID 1hw1A 166 :NGMKGLYTRIGR T0365 131 :AVGLAQQVINELDDLLEAGFR 1hw1A 185 :ARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQLRR 1hw1A 212 :VRRYGHESGEIWHRMQK Number of specific fragments extracted= 10 number of extra gaps= 0 total=4149 Number of alignments=536 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L183 because last residue in template chain is (1hw1A)L230 T0365 5 :SILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNW 1hw1A 21 :WNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGW T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDL 1hw1A 77 :TSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAF T0365 86 :LELLTQQDKIANKAKDISGRVIGR 1hw1A 125 :QEVLATANEVADHADAFAELDYNI T0365 110 :QL 1hw1A 167 :GM T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1hw1A 169 :KGLYTRIGRHYFANPEARSLALGFYHKLSAL T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQ 1hw1A 200 :CSEGAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 6 number of extra gaps= 0 total=4155 Number of alignments=537 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L183 because last residue in template chain is (1hw1A)L230 T0365 5 :SILGVFAKSPIKPL 1hw1A 7 :SPAGFAEEYIIESI T0365 19 :QEHMDKVYDCASLLVPFFEATITGNW 1hw1A 35 :RELSELIGVTRTTLREVLQRLARDGW T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDL 1hw1A 77 :TSGLNILETLARLDHESVPQLIDNLLSVRTNISTIFIRTAF T0365 86 :LELLTQQDKIANKAKDISGRVIGR 1hw1A 125 :QEVLATANEVADHADAFAELDYNI T0365 112 :LIPQALQVPFIAYLQRCI 1hw1A 159 :PIYGLILNGMKGLYTRIG T0365 130 :DAVGLAQQVINELDDLLEA 1hw1A 184 :EARSLALGFYHKLSALCSE T0365 156 :DFVAKMINELDIIEEDTDDLQIQLRRQ 1hw1A 203 :GAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 7 number of extra gaps= 0 total=4162 Number of alignments=538 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)A11 because first residue in template chain is (1hw1A)A5 T0365 12 :KSPIKPLQ 1hw1A 6 :QSPAGFAE T0365 33 :VPFFEATITGNW 1hw1A 14 :EYIIESIWNNRF T0365 51 :RKQISLAEKQGDSLKREIRLTLPS 1hw1A 34 :ERELSELIGVTRTTLREVLQRLAR T0365 75 :GLFM 1hw1A 59 :GWLT T0365 84 :DLLEL 1hw1A 85 :TLARL T0365 89 :LTQQDKIANKAKDISGRVIGRQL 1hw1A 95 :PQLIDNLLSVRTNISTIFIRTAF T0365 115 :QALQVPFIAYLQ 1hw1A 118 :RQHPDKAQEVLA T0365 130 :DAVGLAQQVINELDD 1hw1A 140 :AFAELDYNIFRGLAF T0365 148 :A 1hw1A 155 :A T0365 152 :GREVD 1hw1A 156 :SGNPI T0365 161 :MINELDI 1hw1A 161 :YGLILNG T0365 172 :TDDLQIQLRRQLFA 1hw1A 168 :MKGLYTRIGRHYFA T0365 191 :NPVDVMFLYKTIEWVGGLAD 1hw1A 182 :NPEARSLALGFYHKLSALCS T0365 211 :LAERVGSRLELMLAR 1hw1A 211 :TVRRYGHESGEIWHR Number of specific fragments extracted= 14 number of extra gaps= 0 total=4176 Number of alignments=539 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L190 because last residue in template chain is (1hw1A)L230 T0365 8 :GVFAKSPIKPLQEHMDKV 1hw1A 24 :RFPPGTILPAERELSELI T0365 26 :YDCASLLVP 1hw1A 49 :REVLQRLAR T0365 36 :FEATITGNWDDAVQI 1hw1A 83 :LETLARLDHESVPQL T0365 51 :RKQISLAEKQGDSLKREIRLT 1hw1A 99 :DNLLSVRTNISTIFIRTAFRQ T0365 81 :ERTDLLELLTQQ 1hw1A 120 :HPDKAQEVLATA T0365 93 :DKIANKAKDISGRVIGRQLL 1hw1A 139 :DAFAELDYNIFRGLAFASGN T0365 115 :QA 1hw1A 159 :PI T0365 117 :LQVPFIAYLQRCI 1hw1A 164 :ILNGMKGLYTRIG T0365 130 :DAVGLAQQVINELDDLLEAGFR 1hw1A 184 :EARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQ 1hw1A 212 :VRRYGHESGEIWHR T0365 186 :LESE 1hw1A 226 :MQKN Number of specific fragments extracted= 12 number of extra gaps= 0 total=4188 Number of alignments=540 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L72 because last residue in template chain is (1hw1A)L230 T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1hw1A 203 :GAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=4189 Number of alignments=541 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L72 because last residue in template chain is (1hw1A)L230 T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLT 1hw1A 202 :EGAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=4190 Number of alignments=542 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L190 because last residue in template chain is (1hw1A)L230 T0365 6 :ILGVFAKSPIKPLQEHMDKVYDCASLLVPFF 1hw1A 86 :LARLDHESVPQLIDNLLSVRTNISTIFIRTA T0365 40 :ITGNWDDAVQIR 1hw1A 117 :FRQHPDKAQEVL T0365 73 :PSGLFMPVERTDLLELLT 1hw1A 129 :ATANEVADHADAFAELDY T0365 101 :DISGRVIGR 1hw1A 147 :NIFRGLAFA T0365 110 :QLLIPQALQVPFIAYLQRCI 1hw1A 157 :GNPIYGLILNGMKGLYTRIG T0365 130 :DAVGLAQQVINELDDLLEAG 1hw1A 184 :EARSLALGFYHKLSALCSEG T0365 154 :EVDFVAKM 1hw1A 204 :AHDQVYET T0365 165 :LDIIEEDTDDLQI 1hw1A 212 :VRRYGHESGEIWH T0365 185 :ALESE 1hw1A 225 :RMQKN Number of specific fragments extracted= 9 number of extra gaps= 0 total=4199 Number of alignments=543 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 7 :LGVFAKSPIKPLQEHMDKVYDC 1hw1A 87 :ARLDHESVPQLIDNLLSVRTNI T0365 32 :LVPFFEATITGNWDDAVQIR 1hw1A 109 :STIFIRTAFRQHPDKAQEVL T0365 70 :LTLPS 1hw1A 129 :ATANE T0365 78 :MPVERTDL 1hw1A 134 :VADHADAF T0365 96 :ANKAKDISGRVIGRQLL 1hw1A 142 :AELDYNIFRGLAFASGN T0365 115 :QA 1hw1A 159 :PI T0365 117 :LQVPFIAYLQRCI 1hw1A 164 :ILNGMKGLYTRIG T0365 130 :DAVGLAQQVINELDDLLEAGFR 1hw1A 184 :EARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQLRR 1hw1A 212 :VRRYGHESGEIWHRMQK Number of specific fragments extracted= 10 number of extra gaps= 0 total=4209 Number of alignments=544 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)A11 because first residue in template chain is (1hw1A)A5 T0365 12 :KSPIKPLQEHMDKVYDCASL 1hw1A 6 :QSPAGFAEEYIIESIWNNRF T0365 43 :NWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1hw1A 26 :PPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQ T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAV 1hw1A 88 :RLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVADHA T0365 137 :QVINELDDLLEAGFRGREVDFVAKMIN 1hw1A 139 :DAFAELDYNIFRGLAFASGNPIYGLIL T0365 170 :EDTDDLQIQLRRQLFA 1hw1A 166 :NGMKGLYTRIGRHYFA T0365 191 :NPVDVMFLYKTIEWVGGLA 1hw1A 182 :NPEARSLALGFYHKLSALC T0365 212 :AERVGSRLELMLARV 1hw1A 201 :SEGAHDQVYETVRRY Number of specific fragments extracted= 7 number of extra gaps= 0 total=4216 Number of alignments=545 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 4 :NSILGVFAKSPIKPL 1hw1A 6 :QSPAGFAEEYIIESI T0365 19 :QEHMDKVYDCASLLVPFFEATITGNWDDAVQIR 1hw1A 35 :RELSELIGVTRTTLREVLQRLARDGWLTIQHGK T0365 52 :KQIS 1hw1A 69 :TKVN T0365 63 :SLKREIRLTLPS 1hw1A 73 :NFWETSGLNILE T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAV 1hw1A 85 :TLARLDHESVPQLIDNLLSVRTNISTIFIRTAFRQHPDKAQEVLATANEVADHA T0365 137 :QVINELDDLLEAGFRGREVDFVAKMIN 1hw1A 139 :DAFAELDYNIFRGLAFASGNPIYGLIL T0365 170 :EDTDDLQIQLRRQLFALES 1hw1A 166 :NGMKGLYTRIGRHYFANPE T0365 194 :DVMFLYKTIEWVGGLA 1hw1A 185 :ARSLALGFYHKLSALC T0365 212 :AERVGSRLELMLARV 1hw1A 201 :SEGAHDQVYETVRRY Number of specific fragments extracted= 9 number of extra gaps= 0 total=4225 Number of alignments=546 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)A11 because first residue in template chain is (1hw1A)A5 T0365 12 :KSPIKPLQEH 1hw1A 6 :QSPAGFAEEY T0365 35 :FFEATITGNWDD 1hw1A 16 :IIESIWNNRFPP T0365 51 :RKQISLAEKQGDSLKREIRLTLPSGLFM 1hw1A 34 :ERELSELIGVTRTTLREVLQRLARDGWL T0365 83 :TDLLEL 1hw1A 84 :ETLARL T0365 89 :LTQQDKIANKAKDISGRVIGRQLL 1hw1A 95 :PQLIDNLLSVRTNISTIFIRTAFR T0365 113 :IPQALQVPFI 1hw1A 120 :HPDKAQEVLA T0365 130 :DAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDII 1hw1A 140 :AFAELDYNIFRGLAFASGNPIYGLILNGMKGLYTRIGRH T0365 170 :EDTDDLQIQLRRQLFALESELNPV 1hw1A 183 :PEARSLALGFYHKLSALCSEGAHD T0365 200 :KTIEWVGGLADLAERVGSRLE 1hw1A 207 :QVYETVRRYGHESGEIWHRMQ Number of specific fragments extracted= 9 number of extra gaps= 0 total=4234 Number of alignments=547 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)A11 because first residue in template chain is (1hw1A)A5 Warning: unaligning (T0365)L190 because last residue in template chain is (1hw1A)L230 T0365 12 :KSPIKPLQEH 1hw1A 6 :QSPAGFAEEY T0365 35 :FFEATITGN 1hw1A 16 :IIESIWNNR T0365 45 :DDAVQIRKQI 1hw1A 32 :PAERELSELI T0365 62 :DSLKREIRLTLPSG 1hw1A 45 :RTTLREVLQRLARD T0365 76 :LFM 1hw1A 60 :WLT T0365 82 :RTDLLELLTQQDKIA 1hw1A 95 :PQLIDNLLSVRTNIS T0365 97 :NKAKDISGRV 1hw1A 122 :DKAQEVLATA T0365 110 :QLL 1hw1A 133 :EVA T0365 113 :IPQALQVPFIAYLQRCIDA 1hw1A 137 :HADAFAELDYNIFRGLAFA T0365 132 :VGLAQQVINELDDLLEAG 1hw1A 165 :LNGMKGLYTRIGRHYFAN T0365 152 :GREVDFVAKMINELDIIEED 1hw1A 183 :PEARSLALGFYHKLSALCSE T0365 172 :TDDLQIQLRRQLFALESE 1hw1A 212 :VRRYGHESGEIWHRMQKN Number of specific fragments extracted= 12 number of extra gaps= 0 total=4246 Number of alignments=548 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L72 because last residue in template chain is (1hw1A)L230 T0365 48 :VQIRKQISLAEKQGDSLKREIRLT 1hw1A 206 :DQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=4247 Number of alignments=549 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set Warning: unaligning (T0365)L72 because last residue in template chain is (1hw1A)L230 T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1hw1A 203 :GAHDQVYETVRRYGHESGEIWHRMQKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=4248 Number of alignments=550 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 8 :GVFAKSPIKPLQEHMDKVY 1hw1A 88 :RLDHESVPQLIDNLLSVRT T0365 30 :SLLVPFFEATITGNWDDAVQIRKQISL 1hw1A 107 :NISTIFIRTAFRQHPDKAQEVLATANE T0365 78 :MPVERTDLLELL 1hw1A 134 :VADHADAFAELD T0365 96 :ANKAKDISGR 1hw1A 146 :YNIFRGLAFA T0365 109 :RQLLIPQALQVPFIAYLQRCI 1hw1A 156 :SGNPIYGLILNGMKGLYTRIG T0365 130 :DAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDT 1hw1A 184 :EARSLALGFYHKLSALCSEGAHDQVYETVRRYGHESGEIWHRM Number of specific fragments extracted= 6 number of extra gaps= 0 total=4254 Number of alignments=551 # 1hw1A read from 1hw1A/merged-a2m # found chain 1hw1A in training set T0365 7 :LGVFAKSPIKPLQEHMDKVYD 1hw1A 87 :ARLDHESVPQLIDNLLSVRTN T0365 31 :LLVPFFEATITGNWDDAVQIRKQ 1hw1A 108 :ISTIFIRTAFRQHPDKAQEVLAT T0365 72 :LPS 1hw1A 131 :ANE T0365 78 :MPVERT 1hw1A 134 :VADHAD T0365 87 :ELLTQQDKIANKAKDISG 1hw1A 140 :AFAELDYNIFRGLAFASG T0365 114 :PQALQVPF 1hw1A 158 :NPIYGLIL T0365 122 :IAYLQRCID 1hw1A 169 :KGLYTRIGR T0365 131 :AVGLAQQVINELDDLLEAGFR 1hw1A 185 :ARSLALGFYHKLSALCSEGAH T0365 156 :DFVAKM 1hw1A 206 :DQVYET T0365 165 :LDIIEEDTDDLQIQLRR 1hw1A 212 :VRRYGHESGEIWHRMQK Number of specific fragments extracted= 10 number of extra gaps= 0 total=4264 Number of alignments=552 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1t72A/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1t72A/merged-a2m # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set T0365 169 :EEDTDDLQIQLRRQL 1t72A 156 :DDTVDELYHQLEREL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERV 1t72A 173 :YVLEDPRNIKRAMHLSFVARHYERIADHAENV Number of specific fragments extracted= 2 number of extra gaps= 0 total=4266 Number of alignments=553 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set T0365 89 :LTQQDKIANKAKDISGRVI 1t72A 91 :VSDLERMGDEAENIAERAI Number of specific fragments extracted= 1 number of extra gaps= 0 total=4267 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1t72A)G1 Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQL 1t72A 148 :LAKKVIEKDDTVDELYHQLEREL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1t72A 173 :YVLEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYLS Number of specific fragments extracted= 7 number of extra gaps= 2 total=4274 Number of alignments=554 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1t72A)G1 Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQ 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVI T0365 140 :N 1t72A 140 :S T0365 150 :FRGRE 1t72A 141 :FIQQD T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFA 1t72A 146 :TLLAKKVIEKDDTVDELYHQLERELMT T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1t72A 175 :LEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYLS Number of specific fragments extracted= 9 number of extra gaps= 2 total=4283 Number of alignments=555 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 9 :LFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQL 1t72A 148 :LAKKVIEKDDTVDELYHQLEREL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 1t72A 173 :YVLEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYL Number of specific fragments extracted= 7 number of extra gaps= 2 total=4290 Number of alignments=556 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 13 :SPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 8 :KLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQ 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVI T0365 140 :N 1t72A 140 :S T0365 150 :FRGRE 1t72A 141 :FIQQD T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFA 1t72A 146 :TLLAKKVIEKDDTVDELYHQLERELMT T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLEL 1t72A 175 :LEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIY Number of specific fragments extracted= 9 number of extra gaps= 2 total=4299 Number of alignments=557 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1t72A)G1 Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQLFAL 1t72A 148 :LAKKVIEKDDTVDELYHQLERELMTY T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1t72A 176 :EDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYLSEG Number of specific fragments extracted= 7 number of extra gaps= 2 total=4306 Number of alignments=558 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQ 1t72A 117 :LKPYVNINFMSEIVKEMVNDSV T0365 139 :INELD 1t72A 139 :ISFIQ T0365 153 :REVD 1t72A 144 :QDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQLF 1t72A 148 :LAKKVIEKDDTVDELYHQLERELM T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1t72A 174 :VLEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYLSEG Number of specific fragments extracted= 9 number of extra gaps= 2 total=4315 Number of alignments=559 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 13 :SPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 8 :KLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQLFAL 1t72A 148 :LAKKVIEKDDTVDELYHQLERELMTY T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 1t72A 176 :EDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYL Number of specific fragments extracted= 7 number of extra gaps= 2 total=4322 Number of alignments=560 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)V80 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)E81 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 13 :SPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1t72A 8 :KLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIR T0365 75 :GLFMP 1t72A 72 :ALYQP T0365 82 :RT 1t72A 79 :GD T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQ 1t72A 117 :LKPYVNINFMSEIVKEMVNDSV T0365 139 :INELD 1t72A 139 :ISFIQ T0365 153 :REVD 1t72A 144 :QDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQLF 1t72A 148 :LAKKVIEKDDTVDELYHQLERELM T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 1t72A 174 :VLEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYL Number of specific fragments extracted= 9 number of extra gaps= 2 total=4331 Number of alignments=561 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1t72A)G1 Warning: unaligning (T0365)R82 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)T83 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIRMIALYQP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTLL T0365 162 :INELDIIEEDTDDLQIQLRRQLFA 1t72A 149 :AKKVIEKDDTVDELYHQLERELMT T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 1t72A 175 :LEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYL Number of specific fragments extracted= 5 number of extra gaps= 2 total=4336 Number of alignments=562 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)I6 because first residue in template chain is (1t72A)G1 Warning: unaligning (T0365)R82 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)T83 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 7 :LGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1t72A 2 :GGGGGMKLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIRMIALYQP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQLFA 1t72A 148 :LAKKVIEKDDTVDELYHQLERELMT T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 1t72A 175 :LEDPRNIKRAMHLSFVARHYERIADHAENVAEAAIYL Number of specific fragments extracted= 5 number of extra gaps= 2 total=4341 Number of alignments=563 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 87 :IYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDLL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTLL T0365 162 :INELDIIEEDTDDLQIQLRRQLFA 1t72A 149 :AKKVIEKDDTVDELYHQLERELMT T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGS 1t72A 175 :LEDPRNIKRAMHLSFVARHYERIADHAENVAE Number of specific fragments extracted= 4 number of extra gaps= 1 total=4345 Number of alignments=564 # 1t72A read from 1t72A/merged-a2m # found chain 1t72A in template set Warning: unaligning (T0365)R82 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)A78 Warning: unaligning (T0365)T83 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)A78 Warning: unaligning (T0365)I113 because of BadResidue code BAD_PEPTIDE in next template residue (1t72A)P116 Warning: unaligning (T0365)P114 because of BadResidue code BAD_PEPTIDE at template residue (1t72A)P116 T0365 13 :SPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1t72A 8 :KLFKELEETKEQVIKMAKLVQEAIDKATEALNKQNVELAEEVIKGDDTIDLLEVDIERRCIRMIALYQP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLL 1t72A 86 :GIYKIVSDLERMGDEAENIAERAILLAEE T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDDL 1t72A 117 :LKPYVNINFMSEIVKEMVNDSVISFIQQDTL T0365 161 :MINELDIIEEDTDDLQIQLRRQLFA 1t72A 148 :LAKKVIEKDDTVDELYHQLERELMT T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGS 1t72A 175 :LEDPRNIKRAMHLSFVARHYERIADHAENVAE Number of specific fragments extracted= 5 number of extra gaps= 2 total=4350 Number of alignments=565 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ku1A/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ku1A expands to /projects/compbio/data/pdb/1ku1.pdb.gz 1ku1A:# T0365 read from 1ku1A/merged-a2m # 1ku1A read from 1ku1A/merged-a2m # adding 1ku1A to template set # found chain 1ku1A in template set Warning: unaligning (T0365)H21 because first residue in template chain is (1ku1A)G-9 Warning: unaligning (T0365)E220 because of BadResidue code BAD_PEPTIDE in next template residue (1ku1A)M758 Warning: unaligning (T0365)L221 because of BadResidue code BAD_PEPTIDE at template residue (1ku1A)M758 Warning: unaligning (T0365)M222 because last residue in template chain is (1ku1A)P759 T0365 22 :MDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKR 1ku1A -8 :LVPRGSHMDRKTEFIECTNAFNEKPKKGIPMLIEKGFIASDSDKD T0365 67 :EIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIP 1ku1A 605 :RMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLP T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVI 1ku1A 656 :QQIERIIEAFSSAYCENQDYDPSKI T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGGLADLAER 1ku1A 681 :SDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQVKEHMSFEDYSGNLKGCCNH T0365 215 :VGSRL 1ku1A 752 :RDKEI Number of specific fragments extracted= 5 number of extra gaps= 1 total=4355 Number of alignments=566 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)M222 because of BadResidue code BAD_PEPTIDE in next template residue (1ku1A)M758 Warning: unaligning (T0365)L223 because of BadResidue code BAD_PEPTIDE at template residue (1ku1A)M758 T0365 5 :SILGVFA 1ku1A 565 :ECTNAFN T0365 12 :KSPIKPLQEH 1ku1A 575 :KKGIPMLIEK T0365 22 :MDKVYDCASLLVPFFE 1ku1A 589 :SDSDKDIAEFLFNNNN T0365 38 :ATITGNW 1ku1A 608 :KKTIGLL T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1ku1A 619 :DKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLP T0365 80 :V 1ku1A 653 :G T0365 81 :ERTDLLELLT 1ku1A 657 :QIERIIEAFS T0365 183 :LFALESELNPVDVMFLYKTIEWVGGLADLAERVGSR 1ku1A 705 :IIMLNTDLHNPQVKEHMSFEDYSGNLKGCCNHKDFP T0365 219 :L 1ku1A 744 :L T0365 220 :EL 1ku1A 755 :EI Number of specific fragments extracted= 10 number of extra gaps= 1 total=4365 Number of alignments=567 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 121 :FIAYLQRCIDAVGLAQQVINEL 1ku1A 726 :YSGNLKGCCNHKDFPFWYLDRV Number of specific fragments extracted= 1 number of extra gaps= 0 total=4366 Number of alignments=568 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4366 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)L221 because of BadResidue code BAD_PEPTIDE in next template residue (1ku1A)M758 Warning: unaligning (T0365)M222 because of BadResidue code BAD_PEPTIDE at template residue (1ku1A)M758 Warning: unaligning (T0365)L223 because last residue in template chain is (1ku1A)P759 T0365 1 :MPVNSILGVFAKSPIKPLQEHM 1ku1A 561 :TEFIECTNAFNEKPKKGIPMLI T0365 23 :DKVYDCASLLVPFFE 1ku1A 590 :DSDKDIAEFLFNNNN T0365 38 :ATITGNWDDAVQIRKQISLAEKQGDSLKREIR 1ku1A 612 :GLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIR T0365 71 :TLPSGLFMPVERTDLLELLT 1ku1A 644 :ILLTKFRLPGESQQIERIIE T0365 91 :QQDKI 1ku1A 676 :DPSKI T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 1ku1A 681 :SDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQV T0365 197 :FLYKTIEWVGG 1ku1A 726 :YSGNLKGCCNH T0365 208 :LADLAERVGSRLE 1ku1A 744 :LDRVYCSIRDKEI Number of specific fragments extracted= 8 number of extra gaps= 1 total=4374 Number of alignments=569 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)L221 because of BadResidue code BAD_PEPTIDE in next template residue (1ku1A)M758 Warning: unaligning (T0365)M222 because of BadResidue code BAD_PEPTIDE at template residue (1ku1A)M758 Warning: unaligning (T0365)L223 because last residue in template chain is (1ku1A)P759 T0365 2 :P 1ku1A -8 :L T0365 3 :VNSILGVFAKSPIKPLQEHM 1ku1A 563 :FIECTNAFNEKPKKGIPMLI T0365 23 :DKV 1ku1A 590 :DSD T0365 83 :TDLL 1ku1A 593 :KDIA T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKTIEWVGG 1ku1A 681 :SDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQVKEHMSFEDYSGN T0365 208 :LADLAERVGSRLE 1ku1A 744 :LDRVYCSIRDKEI Number of specific fragments extracted= 6 number of extra gaps= 1 total=4380 Number of alignments=570 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 3 :VNSILGVFAKSPIKPLQEHMDKV 1ku1A 658 :IERIIEAFSSAYCENQDYDPSKI T0365 188 :SELNPVDVMFLYKTIEWVGGLA 1ku1A 681 :SDNAEDDISTVQPDADSVFILS Number of specific fragments extracted= 2 number of extra gaps= 0 total=4382 Number of alignments=571 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4382 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 1 :MPVNSILGV 1ku1A 593 :KDIAEFLFN T0365 10 :FAKSPIKPLQEHMDKVYDCA 1ku1A 603 :NNRMNKKTIGLLLCHPDKVS T0365 31 :LLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLE 1ku1A 623 :LLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQDYDPSK T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 1ku1A 680 :ISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQV T0365 196 :MFLYKTIEWVGGLADLAERVGSRLELMLARV 1ku1A 721 :MSFEDYSGNLKGCCNHKDFPFWYLDRVYCSI Number of specific fragments extracted= 5 number of extra gaps= 0 total=4387 Number of alignments=572 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 1 :MP 1ku1A -9 :GL T0365 3 :VNSILGVFAKSPIKPLQEH 1ku1A 563 :FIECTNAFNEKPKKGIPML T0365 22 :MDKVYDCASLLVP 1ku1A 589 :SDSDKDIAEFLFN T0365 35 :FFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1ku1A 609 :KTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTK T0365 76 :LFMPVER 1ku1A 649 :FRLPGES T0365 83 :TDLLELLTQQDKIANK 1ku1A 659 :ERIIEAFSSAYCENQD T0365 178 :QLRRQLFALESELNPVDV 1ku1A 700 :ILSYSIIMLNTDLHNPQV T0365 196 :MFLYKTIEWVGGLADLAERVGSRLELMLARV 1ku1A 721 :MSFEDYSGNLKGCCNHKDFPFWYLDRVYCSI Number of specific fragments extracted= 8 number of extra gaps= 0 total=4395 Number of alignments=573 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 3 :VNSILGVFAK 1ku1A 658 :IERIIEAFSS Number of specific fragments extracted= 1 number of extra gaps= 0 total=4396 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4396 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 65 :KREIRLTLPSGLFMPVERTDLLELLTQQDKIANK 1ku1A 575 :KKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNK Number of specific fragments extracted= 1 number of extra gaps= 0 total=4397 Number of alignments=574 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 59 :KQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANK 1ku1A 569 :AFNEKPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNK T0365 105 :RVIGRQLLIPQ 1ku1A 609 :KTIGLLLCHPD T0365 118 :QVPFIAYLQRCIDAVG 1ku1A 620 :KVSLLNEYIRLFDFSG Number of specific fragments extracted= 3 number of extra gaps= 0 total=4400 Number of alignments=575 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ku1A)G-9 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFE 1ku1A -6 :PRGSHMDRKTEFIECTNAFNEKPK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPV 1ku1A 576 :KGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLL T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1ku1A 619 :DKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQD T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNP 1ku1A 675 :YDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNP T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1ku1A 718 :KEHMSFEDYSGNLKGCCNHKDFPFWYLDRVYCSI Number of specific fragments extracted= 5 number of extra gaps= 0 total=4405 Number of alignments=576 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ku1A)G-9 Warning: unaligning (T0365)L223 because of BadResidue code BAD_PEPTIDE in next template residue (1ku1A)M758 Warning: unaligning (T0365)A224 because of BadResidue code BAD_PEPTIDE at template residue (1ku1A)M758 Warning: unaligning (T0365)R225 because last residue in template chain is (1ku1A)P759 T0365 14 :PIK 1ku1A -6 :PRG T0365 20 :EHMDKVYDCASLL 1ku1A -3 :SHMDRKTEFIECT T0365 34 :PFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1ku1A 568 :NAFNEKPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIG T0365 79 :P 1ku1A 618 :P T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1ku1A 619 :DKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQD T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNP 1ku1A 675 :YDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNP T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRL 1ku1A 718 :KEHMSFEDYSGNLKGCCNHKDFPFWYL T0365 220 :E 1ku1A 755 :E T0365 222 :M 1ku1A 756 :I Number of specific fragments extracted= 9 number of extra gaps= 1 total=4414 Number of alignments=577 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ku1A)G-9 T0365 14 :PIK 1ku1A -6 :PRG T0365 42 :GNWDDAVQIRKQISLAEKQ 1ku1A -3 :SHMDRKTEFIECTNAFNEK T0365 64 :LKREIRLTLPSGLFMPVERTDLLELLTQ 1ku1A 574 :PKKGIPMLIEKGFIASDSDKDIAEFLFN T0365 100 :KDISGRVI 1ku1A 608 :KKTIGLLL T0365 113 :IPQALQVPFIAYLQ 1ku1A 616 :CHPDKVSLLNEYIR T0365 128 :CIDAVGLA 1ku1A 638 :VDEAIRIL T0365 136 :QQVINELDDLLEAG 1ku1A 659 :ERIIEAFSSAYCEN T0365 154 :EVDFVAKMINELDIIEEDT 1ku1A 694 :DADSVFILSYSIIMLNTDL T0365 176 :QIQLRRQLFALESELN 1ku1A 723 :FEDYSGNLKGCCNHKD T0365 192 :P 1ku1A 741 :F T0365 203 :EWVGGLADLAER 1ku1A 742 :WYLDRVYCSIRD Number of specific fragments extracted= 11 number of extra gaps= 0 total=4425 Number of alignments=578 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ku1A)G-9 T0365 14 :PI 1ku1A -8 :LV T0365 16 :K 1ku1A 558 :D T0365 17 :PLQEHMDKVYD 1ku1A 562 :EFIECTNAFNE T0365 28 :CASLLVP 1ku1A 577 :GIPMLIE T0365 42 :GNWDDAVQIR 1ku1A 590 :DSDKDIAEFL T0365 73 :PSG 1ku1A 603 :NNR T0365 80 :VERTDLLELL 1ku1A 606 :MNKKTIGLLL T0365 90 :TQQDKIAN 1ku1A 622 :SLLNEYIR T0365 99 :AKDISGRVIG 1ku1A 638 :VDEAIRILLT T0365 110 :QLLIPQA 1ku1A 648 :KFRLPGE T0365 119 :VPFI 1ku1A 655 :SQQI T0365 126 :QRCIDAV 1ku1A 659 :ERIIEAF T0365 133 :GLAQQ 1ku1A 667 :SAYCE T0365 151 :RGR 1ku1A 685 :EDD T0365 154 :EVDFVAKMINELDIIEEDT 1ku1A 694 :DADSVFILSYSIIMLNTDL T0365 184 :F 1ku1A 713 :H T0365 185 :ALESELNPVDVMF 1ku1A 716 :QVKEHMSFEDYSG T0365 203 :EWVGGLADLAER 1ku1A 742 :WYLDRVYCSIRD Number of specific fragments extracted= 18 number of extra gaps= 0 total=4443 Number of alignments=579 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 62 :DSLKREIRLTLPSGLFMPVERTDLLELL 1ku1A 572 :EKPKKGIPMLIEKGFIASDSDKDIAEFL Number of specific fragments extracted= 1 number of extra gaps= 0 total=4444 Number of alignments=580 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 96 :ANKAKDISGRVIGRQLL 1ku1A 589 :SDSDKDIAEFLFNNNNR T0365 117 :LQVPFIAYLQRCIDAVGLAQQVINELD 1ku1A 606 :MNKKTIGLLLCHPDKVSLLNEYIRLFD T0365 150 :FRGREVDFVAKM 1ku1A 633 :FSGLRVDEAIRI Number of specific fragments extracted= 3 number of extra gaps= 0 total=4447 Number of alignments=581 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 11 :AKS 1ku1A -6 :PRG T0365 42 :GNWDDAVQIRKQISLAEKQ 1ku1A -3 :SHMDRKTEFIECTNAFNEK T0365 64 :LKREIRLTLPSGLFMPVERTDLLELLTQQD 1ku1A 574 :PKKGIPMLIEKGFIASDSDKDIAEFLFNNN T0365 100 :KDISGRVI 1ku1A 608 :KKTIGLLL T0365 113 :IPQALQVPFIAYLQ 1ku1A 616 :CHPDKVSLLNEYIR T0365 135 :AQQVINEL 1ku1A 638 :VDEAIRIL T0365 147 :EAGFR 1ku1A 646 :LTKFR T0365 152 :GRE 1ku1A 652 :PGE T0365 169 :EEDTDDLQIQLRRQLFALESEL 1ku1A 655 :SQQIERIIEAFSSAYCENQDYD T0365 191 :NPVDVMFLYKTIEWV 1ku1A 694 :DADSVFILSYSIIML Number of specific fragments extracted= 10 number of extra gaps= 0 total=4457 Number of alignments=582 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 9 :VFAKS 1ku1A -8 :LVPRG T0365 14 :PIK 1ku1A -2 :HMD T0365 17 :PLQEHMDKVYD 1ku1A 562 :EFIECTNAFNE T0365 28 :CASLLVP 1ku1A 577 :GIPMLIE T0365 42 :GNWDDAVQIR 1ku1A 590 :DSDKDIAEFL T0365 58 :EKQGDSLK 1ku1A 608 :KKTIGLLL T0365 66 :R 1ku1A 629 :R T0365 67 :EIRLTLPSGLFMPVERTDLLELLTQQDK 1ku1A 640 :EAIRILLTKFRLPGESQQIERIIEAFSS T0365 98 :KAKD 1ku1A 668 :AYCE T0365 110 :QLLIPQALQ 1ku1A 672 :NQDYDPSKI T0365 119 :VPFIAYLQRCIDAVGLA 1ku1A 696 :DSVFILSYSIIMLNTDL T0365 149 :GFRGR 1ku1A 716 :QVKEH T0365 154 :EVDFVAK 1ku1A 722 :SFEDYSG T0365 174 :DLQIQLRRQLFA 1ku1A 742 :WYLDRVYCSIRD Number of specific fragments extracted= 14 number of extra gaps= 0 total=4471 Number of alignments=583 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ku1A)G-9 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFE 1ku1A -6 :PRGSHMDRKTEFIECTNAFNEKPK T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1ku1A 576 :KGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNK T0365 75 :GLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1ku1A 613 :LLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQD T0365 153 :REVDFVAKMINE 1ku1A 675 :YDPSKISDNAED T0365 165 :LDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLY 1ku1A 688 :ISTVQPDADSVFILSYSIIMLNTDLHNPQVKEHMS T0365 212 :AERVGSRLELMLAR 1ku1A 723 :FEDYSGNLKGCCNH Number of specific fragments extracted= 6 number of extra gaps= 0 total=4477 Number of alignments=584 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1ku1A)G-9 T0365 15 :IKPLQEHMDKVYDCASLL 1ku1A -8 :LVPRGSHMDRKTEFIECT T0365 34 :PFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1ku1A 568 :NAFNEKPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNK T0365 75 :GLFM 1ku1A 612 :GLLL T0365 79 :P 1ku1A 618 :P T0365 81 :ERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLA 1ku1A 619 :DKVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQ T0365 152 :GREVDFVAKMIN 1ku1A 674 :DYDPSKISDNAE T0365 164 :ELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLY 1ku1A 687 :DISTVQPDADSVFILSYSIIMLNTDLHNPQVKEHMS T0365 200 :KTIEWVGGLADLA 1ku1A 725 :DYSGNLKGCCNHK T0365 221 :LMLAR 1ku1A 741 :FWYLD Number of specific fragments extracted= 9 number of extra gaps= 0 total=4486 Number of alignments=585 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1ku1A)G-9 T0365 9 :VFAKS 1ku1A -8 :LVPRG T0365 42 :GNWDDAVQIRKQISLAEK 1ku1A -3 :SHMDRKTEFIECTNAFNE T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDK 1ku1A 573 :KPKKGIPMLIEKGFIASDSDKDIAEFLFNNNN T0365 100 :KDISGRVIG 1ku1A 608 :KKTIGLLLC T0365 114 :PQALQVPFIAYLQ 1ku1A 617 :HPDKVSLLNEYIR T0365 135 :AQQVINELD 1ku1A 638 :VDEAIRILL T0365 148 :AGFR 1ku1A 647 :TKFR T0365 152 :GRE 1ku1A 652 :PGE T0365 169 :EEDTDDLQIQLRRQLFALESEL 1ku1A 655 :SQQIERIIEAFSSAYCENQDYD T0365 191 :NPVDVMFLYKTIEWVGG 1ku1A 694 :DADSVFILSYSIIMLNT T0365 210 :DLAER 1ku1A 725 :DYSGN T0365 217 :SRLELMLAR 1ku1A 745 :DRVYCSIRD Number of specific fragments extracted= 12 number of extra gaps= 0 total=4498 Number of alignments=586 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1ku1A)G-9 T0365 9 :VFAKS 1ku1A -8 :LVPRG T0365 14 :PIKP 1ku1A -2 :HMDR T0365 18 :LQEHMDKVYD 1ku1A 563 :FIECTNAFNE T0365 28 :CASLLVP 1ku1A 577 :GIPMLIE T0365 42 :GNWDDAVQI 1ku1A 590 :DSDKDIAEF T0365 51 :RKQISLA 1ku1A 608 :KKTIGLL T0365 59 :KQGDSLKR 1ku1A 622 :SLLNEYIR T0365 67 :EIRLTLPSGLFMPVERTDLLELLTQQDKIA 1ku1A 640 :EAIRILLTKFRLPGESQQIERIIEAFSSAY T0365 108 :GRQLLIPQA 1ku1A 670 :CENQDYDPS T0365 118 :QVPFIAYLQRCIDAVGLAQ 1ku1A 695 :ADSVFILSYSIIMLNTDLH T0365 152 :G 1ku1A 716 :Q T0365 153 :REVDFVA 1ku1A 721 :MSFEDYS T0365 181 :RQLFALESELN 1ku1A 728 :GNLKGCCNHKD T0365 203 :EWVGGLADLAER 1ku1A 742 :WYLDRVYCSIRD Number of specific fragments extracted= 14 number of extra gaps= 0 total=4512 Number of alignments=587 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 62 :DSLKREIRLTLPSGLFMPVERTDLLELL 1ku1A 572 :EKPKKGIPMLIEKGFIASDSDKDIAEFL Number of specific fragments extracted= 1 number of extra gaps= 0 total=4513 Number of alignments=588 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 130 :DAVGLAQQVINELD 1ku1A 619 :DKVSLLNEYIRLFD T0365 150 :FRGREVDFVAKMIN 1ku1A 633 :FSGLRVDEAIRILL Number of specific fragments extracted= 2 number of extra gaps= 0 total=4515 Number of alignments=589 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1ku1A)G-9 T0365 9 :VFAKS 1ku1A -8 :LVPRG T0365 42 :GNWDDAVQIRKQISLAEK 1ku1A -3 :SHMDRKTEFIECTNAFNE T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDK 1ku1A 573 :KPKKGIPMLIEKGFIASDSDKDIAEFLFNNNN T0365 100 :KDISGRVIG 1ku1A 608 :KKTIGLLLC T0365 114 :PQALQVPFIAYLQ 1ku1A 617 :HPDKVSLLNEYIR T0365 135 :AQQVINELD 1ku1A 638 :VDEAIRILL T0365 148 :AGFR 1ku1A 647 :TKFR T0365 152 :GRE 1ku1A 652 :PGE T0365 169 :EEDTDDLQIQLRRQLFALESEL 1ku1A 655 :SQQIERIIEAFSSAYCENQDYD T0365 191 :NPVDVMFLYKTIEWVG 1ku1A 694 :DADSVFILSYSIIMLN Number of specific fragments extracted= 10 number of extra gaps= 0 total=4525 Number of alignments=590 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1ku1A)G-9 T0365 9 :VFAKS 1ku1A -8 :LVPRG T0365 14 :PIKP 1ku1A -2 :HMDR T0365 18 :LQEHMDKVYD 1ku1A 563 :FIECTNAFNE T0365 28 :CASLLVP 1ku1A 577 :GIPMLIE T0365 42 :GNWDDAVQI 1ku1A 590 :DSDKDIAEF T0365 51 :RKQISLA 1ku1A 608 :KKTIGLL T0365 59 :KQGDSLKR 1ku1A 622 :SLLNEYIR T0365 67 :EIRLTLPSGLFMPVERTDLLELLTQQDKIA 1ku1A 640 :EAIRILLTKFRLPGESQQIERIIEAFSSAY T0365 108 :GRQLLIPQA 1ku1A 670 :CENQDYDPS T0365 118 :QVPFIAYLQRCIDAVGLAQ 1ku1A 695 :ADSVFILSYSIIMLNTDLH T0365 152 :G 1ku1A 716 :Q T0365 153 :REVDFVAK 1ku1A 721 :MSFEDYSG T0365 174 :DLQIQLRRQLFA 1ku1A 742 :WYLDRVYCSIRD T0365 188 :SE 1ku1A 754 :KE Number of specific fragments extracted= 14 number of extra gaps= 0 total=4539 Number of alignments=591 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)P14 because first residue in template chain is (1ku1A)G-9 T0365 15 :IKPLQEHMDKVYDCASLLVPFFE 1ku1A -8 :LVPRGSHMDRKTEFIECTNAFNE T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1ku1A 573 :KPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILL T0365 137 :QVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELN 1ku1A 660 :RIIEAFSSAYCENQDYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHN T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1ku1A 717 :VKEHMSFEDYSGNLKGCCNHKDFPFWYLDRVYCSI Number of specific fragments extracted= 4 number of extra gaps= 0 total=4543 Number of alignments=592 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)P14 because first residue in template chain is (1ku1A)G-9 T0365 15 :IKPLQEHMDKVYDCASLLVPFFE 1ku1A -8 :LVPRGSHMDRKTEFIECTNAFNE T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQ 1ku1A 573 :KPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLT T0365 138 :VINELDDLLEAGF 1ku1A 657 :QIERIIEAFSSAY T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELN 1ku1A 674 :DYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHN T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELM 1ku1A 717 :VKEHMSFEDYSGNLKGCCNHKDFPFWYLDRV Number of specific fragments extracted= 5 number of extra gaps= 0 total=4548 Number of alignments=593 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)L7 because first residue in template chain is (1ku1A)G-9 T0365 8 :GVFAKSPIK 1ku1A -8 :LVPRGSHMD T0365 43 :NWDDAVQIRKQISL 1ku1A 559 :RKTEFIECTNAFNE T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELL 1ku1A 573 :KPKKGIPMLIEKGFIASDSDKDIAEFL T0365 94 :KIANKA 1ku1A 622 :SLLNEY T0365 100 :KDISGRVIGRQLLIPQALQVPFIAYLQRCI 1ku1A 640 :EAIRILLTKFRLPGESQQIERIIEAFSSAY T0365 130 :DAVGLAQQVINELDDLLEAGFRGREV 1ku1A 696 :DSVFILSYSIIMLNTDLHNPQVKEHM T0365 176 :QIQLRRQLFALESELN 1ku1A 723 :FEDYSGNLKGCCNHKD T0365 195 :VMFLYKTIEWVGG 1ku1A 741 :FWYLDRVYCSIRD Number of specific fragments extracted= 8 number of extra gaps= 0 total=4556 Number of alignments=594 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set Warning: unaligning (T0365)L7 because first residue in template chain is (1ku1A)G-9 T0365 8 :GVFAKSPIK 1ku1A -8 :LVPRGSHMD T0365 17 :PLQEHMDKVYD 1ku1A 562 :EFIECTNAFNE T0365 28 :CASLLVP 1ku1A 577 :GIPMLIE T0365 42 :GNWDDAVQIR 1ku1A 590 :DSDKDIAEFL T0365 70 :LTLPSG 1ku1A 600 :FNNNNR T0365 80 :VERTDLLELL 1ku1A 606 :MNKKTIGLLL T0365 94 :KIANKAKDI 1ku1A 622 :SLLNEYIRL T0365 103 :SGRVIGRQLLIP 1ku1A 641 :AIRILLTKFRLP T0365 115 :QALQVPFIAYL 1ku1A 655 :SQQIERIIEAF T0365 132 :VGLAQQ 1ku1A 666 :SSAYCE T0365 147 :EAGFRGR 1ku1A 672 :NQDYDPS T0365 154 :EVDFVAKMINELDIIEEDT 1ku1A 694 :DADSVFILSYSIIMLNTDL T0365 178 :QLRRQLFALESELN 1ku1A 725 :DYSGNLKGCCNHKD T0365 196 :MFLYKTIEWVGG 1ku1A 742 :WYLDRVYCSIRD Number of specific fragments extracted= 14 number of extra gaps= 0 total=4570 Number of alignments=595 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 63 :SLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVIN 1ku1A 573 :KPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLLLCHPDKVSLLNEYIRLFDFSGLRVDEAIRILLTKFR Number of specific fragments extracted= 1 number of extra gaps= 0 total=4571 Number of alignments=596 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1ku1A 620 :KVSLLNEYIRLFDFSGLRVDEAIRILLTKFRL Number of specific fragments extracted= 1 number of extra gaps= 0 total=4572 Number of alignments=597 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 140 :NELDDLLEAGFRGREVDF 1ku1A 576 :KGIPMLIEKGFIASDSDK T0365 178 :QLRRQLFALESELNPVDVMFLY 1ku1A 594 :DIAEFLFNNNNRMNKKTIGLLL Number of specific fragments extracted= 2 number of extra gaps= 0 total=4574 Number of alignments=598 # 1ku1A read from 1ku1A/merged-a2m # found chain 1ku1A in template set T0365 8 :GVFAKSPIK 1ku1A -8 :LVPRGSHMD T0365 17 :PLQEHMDKVYD 1ku1A 562 :EFIECTNAFNE T0365 28 :CASLLVP 1ku1A 577 :GIPMLIE T0365 42 :GNWDDAVQIR 1ku1A 590 :DSDKDIAEFL T0365 70 :LTLPSG 1ku1A 600 :FNNNNR T0365 80 :VERTDLLELL 1ku1A 606 :MNKKTIGLLL T0365 94 :KIANKAKDI 1ku1A 622 :SLLNEYIRL T0365 103 :SGRVIGRQLLIP 1ku1A 641 :AIRILLTKFRLP T0365 115 :QALQVPFIAYL 1ku1A 655 :SQQIERIIEAF T0365 132 :VGLAQQ 1ku1A 666 :SSAYCE T0365 147 :EAGFRGR 1ku1A 672 :NQDYDPS T0365 154 :EVDFVAKMINELDIIEEDT 1ku1A 694 :DADSVFILSYSIIMLNTDL T0365 178 :QLRRQLFALESELN 1ku1A 725 :DYSGNLKGCCNHKD T0365 196 :MFLYKTIEWVGG 1ku1A 742 :WYLDRVYCSIRD Number of specific fragments extracted= 14 number of extra gaps= 0 total=4588 Number of alignments=599 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1j1vA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1j1vA/merged-a2m # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)V80 because first residue in template chain is (1j1vA)V374 Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 81 :ERTDLLELLTQQDKI 1j1vA 375 :TIDNIQKTVAEYYKI T0365 98 :KAKDISGRVIGRQLLIPQAL 1j1vA 390 :KVADLLSKRRSRSVARPRQM T0365 131 :AVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 410 :AMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 3 number of extra gaps= 0 total=4591 Number of alignments=600 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 15 :IKPLQEHMDKVY 1j1vA 376 :IDNIQKTVAEYY T0365 53 :QISLAEKQGDSLKREI 1j1vA 388 :KIKVADLLSKRRSRSV T0365 71 :TLPSGLFMPVER 1j1vA 404 :ARPRQMAMALAK T0365 98 :KAKDISGRVIGRQ 1j1vA 416 :ELTNHSLPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEEDTD 1j1vA 429 :FGGRDHTTVLHACRKIEQLREESH T0365 178 :QLRRQLFALESEL 1j1vA 453 :DIKEDFSNLIRTL Number of specific fragments extracted= 6 number of extra gaps= 0 total=4597 Number of alignments=601 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 95 :IANKAKDISGRVIGRQL 1j1vA 413 :LAKELTNHSLPEIGDAF Number of specific fragments extracted= 1 number of extra gaps= 0 total=4598 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4598 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)V80 because first residue in template chain is (1j1vA)V374 Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 81 :ERTDLLELLTQQDKI 1j1vA 375 :TIDNIQKTVAEYYKI T0365 98 :KAKDISGRVIGRQLLIPQAL 1j1vA 390 :KVADLLSKRRSRSVARPRQM T0365 131 :AVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 410 :AMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 3 number of extra gaps= 0 total=4601 Number of alignments=602 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 1 :MPVNSILGVFAK 1j1vA 374 :VTIDNIQKTVAE T0365 25 :VY 1j1vA 386 :YY T0365 53 :QISLAEKQGDSLKREI 1j1vA 388 :KIKVADLLSKRRSRSV T0365 71 :TLPSGLFMPV 1j1vA 404 :ARPRQMAMAL T0365 96 :ANKAKDISGRVIGRQL 1j1vA 414 :AKELTNHSLPEIGDAF T0365 126 :QRCIDAVGLAQQVINEL 1j1vA 431 :GRDHTTVLHACRKIEQL T0365 169 :EEDTD 1j1vA 448 :REESH T0365 178 :QLRRQLFALESEL 1j1vA 453 :DIKEDFSNLIRTL Number of specific fragments extracted= 8 number of extra gaps= 0 total=4609 Number of alignments=603 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 95 :IANKAKDISGRVIGRQL 1j1vA 413 :LAKELTNHSLPEIGDAF Number of specific fragments extracted= 1 number of extra gaps= 0 total=4610 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4610 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)Q115 because last residue in template chain is (1j1vA)S467 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDK 1j1vA 374 :VTIDNIQKTVAEYYKIKVADLLSK T0365 49 :QIRKQISLAEKQGDSLKREI 1j1vA 398 :RRSRSVARPRQMAMALAKEL T0365 69 :RLTLPS 1j1vA 419 :NHSLPE T0365 75 :GLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIP 1j1vA 427 :DAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 4 number of extra gaps= 0 total=4614 Number of alignments=604 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDK 1j1vA 374 :VTIDNIQKTVAEYYKIKVADLLSK T0365 42 :GNWDDAVQIRKQIS 1j1vA 398 :RRSRSVARPRQMAM T0365 56 :LAEKQGDSLKREI 1j1vA 413 :LAKELTNHSLPEI T0365 74 :SGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLI 1j1vA 426 :GDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTL Number of specific fragments extracted= 4 number of extra gaps= 0 total=4618 Number of alignments=605 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLR 1j1vA 429 :FGGRDHTTVLHACRKIEQLREESHDIKEDFS Number of specific fragments extracted= 1 number of extra gaps= 0 total=4619 Number of alignments=606 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4619 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 131 :AVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 410 :AMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 1 number of extra gaps= 0 total=4620 Number of alignments=607 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 132 :VGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQL 1j1vA 411 :MALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDF Number of specific fragments extracted= 1 number of extra gaps= 0 total=4621 Number of alignments=608 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)T39 because first residue in template chain is (1j1vA)V374 Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 40 :ITGNWDDAVQIRKQIS 1j1vA 375 :TIDNIQKTVAEYYKIK T0365 102 :ISGRVIGRQLLIPQALQVPFIAYLQ 1j1vA 391 :VADLLSKRRSRSVARPRQMAMALAK T0365 133 :GLAQQVINELDDL 1j1vA 416 :ELTNHSLPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 429 :FGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 4 number of extra gaps= 0 total=4625 Number of alignments=609 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 1 :MPVNSILG 1j1vA 374 :VTIDNIQK T0365 28 :C 1j1vA 382 :T T0365 60 :QGDSLKREI 1j1vA 383 :VAEYYKIKV T0365 103 :SGRVIGRQLLIPQALQVPFIAYLQ 1j1vA 392 :ADLLSKRRSRSVARPRQMAMALAK T0365 133 :GLAQQVINELDD 1j1vA 416 :ELTNHSLPEIGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 6 number of extra gaps= 0 total=4631 Number of alignments=610 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 1 :MP 1j1vA 374 :VT T0365 18 :LQEHMDKVY 1j1vA 376 :IDNIQKTVA T0365 38 :ATITGNWDDAV 1j1vA 385 :EYYKIKVADLL T0365 74 :SG 1j1vA 396 :SK T0365 79 :PVERT 1j1vA 398 :RRSRS T0365 98 :KAKDISGRVIGRQLLIPQAL 1j1vA 403 :VARPRQMAMALAKELTNHSL T0365 119 :VPFI 1j1vA 423 :PEIG T0365 148 :AGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 427 :DAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 8 number of extra gaps= 0 total=4639 Number of alignments=611 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)A185 because last residue in template chain is (1j1vA)S467 T0365 1 :MP 1j1vA 374 :VT T0365 18 :LQEHMDKVYD 1j1vA 376 :IDNIQKTVAE T0365 39 :TITGNWDDAV 1j1vA 386 :YYKIKVADLL T0365 79 :PVERT 1j1vA 398 :RRSRS T0365 96 :ANKAKDISGRVIGRQLL 1j1vA 403 :VARPRQMAMALAKELTN T0365 116 :ALQVPFIAY 1j1vA 420 :HSLPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQLF 1j1vA 454 :IKEDFSNLIRTLS Number of specific fragments extracted= 8 number of extra gaps= 0 total=4647 Number of alignments=612 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 146 :LEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQL 1j1vA 425 :IGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI Number of specific fragments extracted= 1 number of extra gaps= 0 total=4648 Number of alignments=613 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 137 :QVINELDD 1j1vA 420 :HSLPEIGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQLR 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIKEDFS Number of specific fragments extracted= 2 number of extra gaps= 0 total=4650 Number of alignments=614 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 140 :NELD 1j1vA 423 :PEIG T0365 148 :AGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQL 1j1vA 427 :DAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLI Number of specific fragments extracted= 2 number of extra gaps= 0 total=4652 Number of alignments=615 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 47 :AVQIRKQISLAEK 1j1vA 376 :IDNIQKTVAEYYK T0365 80 :VERTDLL 1j1vA 389 :IKVADLL T0365 115 :QALQVPFIAYLQRCIDAVGLA 1j1vA 397 :KRRSRSVARPRQMAMALAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL Number of specific fragments extracted= 6 number of extra gaps= 0 total=4658 Number of alignments=616 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)T90 because first residue in template chain is (1j1vA)V374 Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 91 :QQDKIANK 1j1vA 375 :TIDNIQKT T0365 105 :RVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1j1vA 383 :VAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTN T0365 142 :LDDLLEA 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 429 :FGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 4 number of extra gaps= 0 total=4662 Number of alignments=617 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 6 :ILGVFAK 1j1vA 375 :TIDNIQK T0365 59 :KQGDSLKREIRLTLPSG 1j1vA 382 :TVAEYYKIKVADLLSKR T0365 103 :SGRV 1j1vA 399 :RSRS T0365 111 :L 1j1vA 403 :V T0365 115 :QALQVPFIAY 1j1vA 404 :ARPRQMAMAL T0365 131 :AVGLAQQVINELDD 1j1vA 414 :AKELTNHSLPEIGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRT T0365 224 :ARV 1j1vA 465 :LSS Number of specific fragments extracted= 8 number of extra gaps= 0 total=4670 Number of alignments=618 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)K16 because first residue in template chain is (1j1vA)V374 T0365 17 :PLQEHMDKVYD 1j1vA 375 :TIDNIQKTVAE T0365 39 :TITGNWDDAV 1j1vA 386 :YYKIKVADLL T0365 74 :SGL 1j1vA 396 :SKR T0365 80 :VER 1j1vA 399 :RSR T0365 97 :NKAKDISGRVIGRQLLIPQALQV 1j1vA 402 :SVARPRQMAMALAKELTNHSLPE T0365 142 :LDD 1j1vA 425 :IGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLF 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIR T0365 223 :LARV 1j1vA 464 :TLSS Number of specific fragments extracted= 8 number of extra gaps= 0 total=4678 Number of alignments=619 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 1 :MP 1j1vA 374 :VT T0365 18 :LQEHMDKVYDC 1j1vA 376 :IDNIQKTVAEY T0365 40 :ITGNWDDA 1j1vA 387 :YKIKVADL T0365 86 :L 1j1vA 395 :L T0365 110 :QLLIPQALQVPFIAYLQRCIDA 1j1vA 396 :SKRRSRSVARPRQMAMALAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL T0365 188 :S 1j1vA 466 :S Number of specific fragments extracted= 9 number of extra gaps= 0 total=4687 Number of alignments=620 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 146 :LEAGFRGREVDFVAKMINELDIIEEDTDDLQIQL 1j1vA 425 :IGDAFGGRDHTTVLHACRKIEQLREESHDIKEDF Number of specific fragments extracted= 1 number of extra gaps= 0 total=4688 Number of alignments=621 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 134 :LAQQVINELDD 1j1vA 417 :LTNHSLPEIGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQL 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIKEDF Number of specific fragments extracted= 2 number of extra gaps= 0 total=4690 Number of alignments=622 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 130 :DAVGLAQQV 1j1vA 409 :MAMALAKEL T0365 139 :INELDD 1j1vA 422 :LPEIGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTL Number of specific fragments extracted= 3 number of extra gaps= 0 total=4693 Number of alignments=623 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 100 :KDISGRVIGR 1j1vA 377 :DNIQKTVAEY T0365 110 :QLLIPQALQVPFIAYLQRCIDA 1j1vA 396 :SKRRSRSVARPRQMAMALAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL Number of specific fragments extracted= 5 number of extra gaps= 0 total=4698 Number of alignments=624 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)E20 because first residue in template chain is (1j1vA)V374 Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 21 :HMDKVYDCASLLVPFFE 1j1vA 375 :TIDNIQKTVAEYYKIKV T0365 106 :VIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1j1vA 392 :ADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 3 number of extra gaps= 0 total=4701 Number of alignments=625 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)A224 because last residue in template chain is (1j1vA)S467 T0365 1 :M 1j1vA 374 :V T0365 21 :HMDKVYDCASLLVP 1j1vA 375 :TIDNIQKTVAEYYK T0365 66 :REIRLTLPSG 1j1vA 389 :IKVADLLSKR T0365 107 :IGRQLLIPQALQVPFI 1j1vA 399 :RSRSVARPRQMAMALA T0365 129 :IDAVGLAQQVINE 1j1vA 415 :KELTNHSLPEIGD T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQ 1j1vA 428 :AFGGRDHTTVLHACRKIEQLREESHDIK T0365 213 :ERVGSRLELML 1j1vA 456 :EDFSNLIRTLS Number of specific fragments extracted= 7 number of extra gaps= 0 total=4708 Number of alignments=626 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1j1vA)V374 Warning: unaligning (T0365)S188 because last residue in template chain is (1j1vA)S467 T0365 14 :PIKPLQE 1j1vA 375 :TIDNIQK T0365 35 :FFEATITGNWD 1j1vA 382 :TVAEYYKIKVA T0365 84 :DL 1j1vA 393 :DL T0365 109 :RQLLIPQALQVPFIAYLQRCIDA 1j1vA 395 :LSKRRSRSVARPRQMAMALAKEL T0365 136 :QQVINEL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1j1vA 429 :FGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLS Number of specific fragments extracted= 6 number of extra gaps= 0 total=4714 Number of alignments=627 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 1 :M 1j1vA 374 :V T0365 46 :DAVQIRKQISLA 1j1vA 375 :TIDNIQKTVAEY T0365 80 :VERTDLL 1j1vA 389 :IKVADLL T0365 111 :LLIPQALQVPFIAYLQ 1j1vA 397 :KRRSRSVARPRQMAMA T0365 128 :CIDAV 1j1vA 413 :LAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :T 1j1vA 454 :I T0365 177 :IQLRRQLFALES 1j1vA 455 :KEDFSNLIRTLS Number of specific fragments extracted= 9 number of extra gaps= 0 total=4723 Number of alignments=628 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE Number of specific fragments extracted= 1 number of extra gaps= 0 total=4724 Number of alignments=629 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 146 :LEAGFRGREVDFVAKMINELDIIEEDTDDLQI 1j1vA 425 :IGDAFGGRDHTTVLHACRKIEQLREESHDIKE Number of specific fragments extracted= 1 number of extra gaps= 0 total=4725 Number of alignments=630 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 107 :IGRQLLIPQALQVPFIAYLQRCIDA 1j1vA 393 :DLLSKRRSRSVARPRQMAMALAKEL T0365 136 :QQVINEL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFAL 1j1vA 429 :FGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTL Number of specific fragments extracted= 3 number of extra gaps= 0 total=4728 Number of alignments=631 # 1j1vA read from 1j1vA/merged-a2m # found chain 1j1vA in template set T0365 47 :AVQIRKQISLA 1j1vA 376 :IDNIQKTVAEY T0365 80 :VERTDLL 1j1vA 389 :IKVADLL T0365 111 :LLIPQALQVPFIAYLQ 1j1vA 397 :KRRSRSVARPRQMAMA T0365 128 :CIDAV 1j1vA 413 :LAKEL T0365 139 :INELDDL 1j1vA 422 :LPEIGDA T0365 150 :FRGREVDFVAKMINELDIIEED 1j1vA 429 :FGGRDHTTVLHACRKIEQLREE T0365 172 :TDDLQIQLRRQL 1j1vA 454 :IKEDFSNLIRTL Number of specific fragments extracted= 7 number of extra gaps= 0 total=4735 Number of alignments=632 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2c6cA/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2c6cA expands to /projects/compbio/data/pdb/2c6c.pdb.gz 2c6cA:# T0365 read from 2c6cA/merged-a2m # 2c6cA read from 2c6cA/merged-a2m # adding 2c6cA to template set # found chain 2c6cA in template set T0365 1 :MPVNSILGVFAKSPIKPLQE 2c6cA 292 :IPVHPIGYYDAQKLLEKMGG T0365 21 :HMDKV 2c6cA 377 :HRDSW T0365 40 :ITGNWDDAVQIRKQISLAEKQGD 2c6cA 382 :VFGGIDPQSGAAVVHEIVRSFGT T0365 63 :SLKREIRLTLPS 2c6cA 411 :RPRRTILFASWD T0365 75 :GLFMPVERT 2c6cA 430 :GSTEWAEEN T0365 84 :DLLELLTQQDKIA 2c6cA 444 :ERGVAYINADSSI T0365 97 :NKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLL 2c6cA 459 :NYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSG T0365 148 :AGFR 2c6cA 509 :MPRI T0365 173 :DDLQIQLRRQLFALESELNPVDVMFL 2c6cA 513 :SKLGSGNDFEVFFQRLGIASGRARYT T0365 199 :YKTIEW 2c6cA 556 :YETYEL T0365 205 :VGGLAD 2c6cA 579 :VRGGMV T0365 211 :LAERVGSRLELMLARV 2c6cA 604 :LRKYADKIYSISMKHP Number of specific fragments extracted= 12 number of extra gaps= 0 total=4747 Number of alignments=633 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)N97 because of BadResidue code BAD_PEPTIDE in next template residue (2c6cA)G458 Warning: unaligning (T0365)K98 because of BadResidue code BAD_PEPTIDE at template residue (2c6cA)G458 Warning: unaligning (T0365)G216 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E220 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 1 :MPVNSILGV 2c6cA 289 :LPSIPVHPI T0365 11 :AKSPIKPLQE 2c6cA 298 :GYYDAQKLLE T0365 21 :HMDKV 2c6cA 377 :HRDSW T0365 40 :ITGNWDDAVQIRKQISLAEK 2c6cA 382 :VFGGIDPQSGAAVVHEIVRS T0365 60 :QGDSLKREIRLTLPS 2c6cA 408 :EGWRPRRTILFASWD T0365 75 :GLFMPVERT 2c6cA 430 :GSTEWAEEN T0365 84 :DLLELLTQQDKIA 2c6cA 444 :ERGVAYINADSSI T0365 99 :AKDI 2c6cA 459 :NYTL T0365 104 :GRVIGR 2c6cA 463 :RVDCTP T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLL 2c6cA 472 :SLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSG T0365 148 :AGFR 2c6cA 509 :MPRI T0365 166 :DIIEEDTDDLQIQLRRQLFALESEL 2c6cA 599 :DYAVVLRKYADKIYSISMKHPQEMK T0365 192 :PVDVMFLYKTIEWV 2c6cA 624 :TYSVSFDSLFSAVK T0365 207 :GLADLAERV 2c6cA 645 :KFSERLQDF T0365 221 :LMLAR 2c6cA 658 :PIVLR T0365 226 :V 2c6cA 704 :S Number of specific fragments extracted= 16 number of extra gaps= 1 total=4763 Number of alignments=634 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 21 :HMDKV 2c6cA 377 :HRDSW T0365 205 :VGGLAD 2c6cA 382 :VFGGID Number of specific fragments extracted= 2 number of extra gaps= 0 total=4765 Number of alignments=635 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)F184 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 T0365 148 :AGFRGREVDFVAKMINELDIIEEDT 2c6cA 484 :PDEGFEGKSLYESWTKKSPSPEFSG T0365 173 :DDLQIQLRRQL 2c6cA 643 :ASKFSERLQDF Number of specific fragments extracted= 2 number of extra gaps= 0 total=4767 Number of alignments=636 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)A11 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)S338 Warning: unaligning (T0365)I107 because of BadResidue code BAD_PEPTIDE in next template residue (2c6cA)G458 Warning: unaligning (T0365)G108 because of BadResidue code BAD_PEPTIDE at template residue (2c6cA)G458 Warning: unaligning (T0365)E220 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)L221 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 1 :MPVNSILG 2c6cA 325 :VPYNVGPG T0365 12 :KSPIKPLQE 2c6cA 339 :TQKVKMHIH T0365 21 :HMDKV 2c6cA 377 :HRDSW T0365 40 :ITGNWDDAVQIRKQISLAEK 2c6cA 382 :VFGGIDPQSGAAVVHEIVRS T0365 60 :QGDSLKREIRL 2c6cA 408 :EGWRPRRTILF T0365 71 :TLPSGLFMPVERTDLLELLT 2c6cA 437 :ENSRLLQERGVAYINADSSI T0365 109 :RQLLIPQAL 2c6cA 459 :NYTLRVDCT T0365 126 :QRCIDAVGLAQQVINELDDL 2c6cA 468 :PLMYSLVHNLTKELKSPDEG T0365 146 :LEAGFRGR 2c6cA 511 :RISKLGSG T0365 154 :EVDFV 2c6cA 558 :TYELV T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESELNP 2c6cA 584 :VFELANSIVLPFDCRDYAVVLRKYADKIYSISMK T0365 193 :VDVMFLYKTIEWVGGLADLAERVGSRL 2c6cA 627 :VSFDSLFSAVKNFTEIASKFSERLQDF T0365 222 :MLARV 2c6cA 658 :PIVLR Number of specific fragments extracted= 13 number of extra gaps= 1 total=4780 Number of alignments=637 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)I107 because of BadResidue code BAD_PEPTIDE in next template residue (2c6cA)G458 Warning: unaligning (T0365)G108 because of BadResidue code BAD_PEPTIDE at template residue (2c6cA)G458 T0365 2 :PV 2c6cA 293 :PV T0365 4 :N 2c6cA 328 :N T0365 5 :SILGVFAKS 2c6cA 354 :RIYNVIGTL T0365 14 :PI 2c6cA 364 :GA T0365 16 :KPL 2c6cA 367 :EPD T0365 21 :HMDKV 2c6cA 377 :HRDSW T0365 40 :ITGNWDDAVQIRKQISLAE 2c6cA 382 :VFGGIDPQSGAAVVHEIVR T0365 59 :KQGDSLKREIRLTLPSG 2c6cA 407 :KEGWRPRRTILFASWDA T0365 76 :LFMPV 2c6cA 433 :EWAEE T0365 81 :ERTDL 2c6cA 444 :ERGVA T0365 86 :LELLT 2c6cA 452 :ADSSI T0365 126 :QRCIDAVGLAQQVINELDDLL 2c6cA 468 :PLMYSLVHNLTKELKSPDEGF T0365 147 :EAGFRGR 2c6cA 512 :ISKLGSG T0365 155 :VDFV 2c6cA 519 :NDFE T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKT 2c6cA 584 :VFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYS T0365 202 :IEWVGG 2c6cA 661 :LRMMND T0365 208 :LADLAERVGSRLELMLARV 2c6cA 718 :KVDPSKAWGEVKRQIYVAA Number of specific fragments extracted= 17 number of extra gaps= 1 total=4797 Number of alignments=638 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNW 2c6cA 481 :LKSPDEGFEGKSLYESWTKKSPSPEFSGMP T0365 201 :TIEWVGGLADLA 2c6cA 511 :RISKLGSGNDFE Number of specific fragments extracted= 2 number of extra gaps= 0 total=4799 Number of alignments=639 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4799 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)A11 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)I130 Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)I130 Warning: unaligning (T0365)L223 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)A224 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 1 :MPVNSILGVF 2c6cA 119 :YPNKTHPNYI T0365 13 :SPIK 2c6cA 131 :INED T0365 17 :PLQEHM 2c6cA 273 :PANEYA T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQ 2c6cA 279 :YRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPP T0365 61 :GDSLKREIRLTL 2c6cA 409 :GWRPRRTILFAS T0365 73 :PSGLFMPVERTDLLELLTQQDKIANKAKD 2c6cA 462 :LRVDCTPLMYSLVHNLTKELKSPDEGFEG T0365 102 :ISGRVIGRQLLIPQALQVPFIAY 2c6cA 505 :EFSGMPRISKLGSGNDFEVFFQR T0365 125 :LQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAK 2c6cA 591 :IVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYS T0365 196 :MFLYKTIEWVGGLADLAERVGSRLELM 2c6cA 627 :VSFDSLFSAVKNFTEIASKFSERLQDF T0365 225 :RV 2c6cA 658 :PI Number of specific fragments extracted= 10 number of extra gaps= 1 total=4809 Number of alignments=640 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)I139 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)S547 Warning: unaligning (T0365)E147 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)Y549 Warning: unaligning (T0365)A148 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)Y549 T0365 1 :MPVNSILGVFAKSPIKP 2c6cA 91 :QLAKQIQSQWKEFGLDS T0365 18 :LQEHMD 2c6cA 185 :FFKLER T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQISLAE 2c6cA 279 :YRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSA T0365 59 :KQGDSLKREIRLTLPSG 2c6cA 407 :KEGWRPRRTILFASWDA T0365 77 :F 2c6cA 434 :W T0365 78 :M 2c6cA 441 :L T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQ 2c6cA 461 :TLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESW T0365 116 :ALQVPFIAYLQRCIDAVGLAQQ 2c6cA 506 :FSGMPRISKLGSGNDFEVFFQR T0365 138 :V 2c6cA 539 :K T0365 149 :GFRGREVDFVAKMINELD 2c6cA 550 :PLYHSVYETYELVEKFYD T0365 167 :IIEEDTDDLQIQLRRQLFALESELNPVDVMFLYKT 2c6cA 592 :VLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYS T0365 209 :ADLAERVGSRLELMLA 2c6cA 634 :SAVKNFTEIASKFSER T0365 225 :RV 2c6cA 748 :EV Number of specific fragments extracted= 13 number of extra gaps= 1 total=4822 Number of alignments=641 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)L190 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)N191 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAK 2c6cA 594 :PFDCRDYAVVLRKYADKIYSISMKHPQEMKTYS T0365 163 :NELDIIEEDTDDLQIQLRRQLFALESE 2c6cA 627 :VSFDSLFSAVKNFTEIASKFSERLQDF T0365 192 :PVDVMFL 2c6cA 658 :PIVLRMM Number of specific fragments extracted= 3 number of extra gaps= 0 total=4825 Number of alignments=642 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 128 :CIDAVGLAQQVINELDDLLEAGFRGREVDFVAK 2c6cA 594 :PFDCRDYAVVLRKYADKIYSISMKHPQEMKTYS Number of specific fragments extracted= 1 number of extra gaps= 0 total=4826 Number of alignments=643 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 183 :LFALESELNP 2c6cA 712 :LFDIESKVDP Number of specific fragments extracted= 1 number of extra gaps= 0 total=4827 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Number of specific fragments extracted= 0 number of extra gaps= 0 total=4827 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P2 because first residue in template chain is (2c6cA)N57 Warning: unaligning (T0365)S55 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)I130 Warning: unaligning (T0365)L56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)I130 T0365 3 :VNSILGVFAKS 2c6cA 58 :MKAFLDELKAE T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATITGNWDDA 2c6cA 70 :IKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEF T0365 48 :VQIRKQI 2c6cA 122 :KTHPNYI T0365 57 :AEKQGDSLKREIRLTLPS 2c6cA 131 :INEDGNEIFNTSLFEPPP T0365 75 :GLFMPVER 2c6cA 162 :SAFSPQGM T0365 83 :TDLLELLTQQD 2c6cA 183 :EDFFKLERDMK T0365 96 :ANKAKDISGRVIGR 2c6cA 194 :INCSGKIVIARYGK T0365 110 :QLL 2c6cA 213 :KVK T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDD 2c6cA 216 :NAQLAGAKGVILYSDPADYFAPGVKSYPD T0365 145 :LLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 2c6cA 248 :LPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPS T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 2c6cA 292 :IPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVP T0365 226 :V 2c6cA 329 :V Number of specific fragments extracted= 12 number of extra gaps= 1 total=4839 Number of alignments=644 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)L86 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)I130 Warning: unaligning (T0365)E87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)I130 Warning: unaligning (T0365)I122 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)V175 Warning: unaligning (T0365)A123 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)V175 T0365 14 :PIKPLQEH 2c6cA 58 :MKAFLDEL T0365 22 :MDKVY 2c6cA 67 :AENIK T0365 30 :SLLVPFFEA 2c6cA 72 :KFLYNFTQI T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 2c6cA 81 :PHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYP T0365 82 :RTDL 2c6cA 125 :PNYI T0365 88 :LLTQQDKIAN 2c6cA 131 :INEDGNEIFN T0365 98 :KAKDISGRVIGRQLLIPQALQVPF 2c6cA 150 :GYENVSDIVPPFSAFSPQGMPEGD T0365 124 :YLQRCID 2c6cA 176 :YVNYART T0365 131 :AVGLAQQVINELDDL 2c6cA 194 :INCSGKIVIARYGKV T0365 150 :FRGREVDFVA 2c6cA 209 :FRGNKVKNAQ T0365 160 :KMINELDIIEEDTDDLQ 2c6cA 220 :AGAKGVILYSDPADYFA T0365 180 :RRQLFALESELNPVDVMFLYKTIEWVGG 2c6cA 255 :RGNILNLNGAGDPLTPGYPANEYAYRRG T0365 215 :VGSRL 2c6cA 283 :IAEAV Number of specific fragments extracted= 13 number of extra gaps= 2 total=4852 Number of alignments=645 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 T0365 15 :IKPLQEH 2c6cA 58 :MKAFLDE T0365 22 :MDKVYDCASLL 2c6cA 67 :AENIKKFLYNF T0365 44 :WDDAVQIRKQISLAEKQ 2c6cA 86 :TEQNFQLAKQIQSQWKE T0365 66 :REIRLTLPSGLFM 2c6cA 182 :TEDFFKLERDMKI T0365 86 :LELLTQQD 2c6cA 471 :YSLVHNLT T0365 95 :IANKAKD 2c6cA 493 :LYESWTK T0365 103 :SGRVIGR 2c6cA 521 :FEVFFQR T0365 122 :IAYLQR 2c6cA 559 :YELVEK T0365 128 :CIDAVGLAQQVINELDDLL 2c6cA 597 :CRDYAVVLRKYADKIYSIS T0365 147 :EAGFRGREVDFVAKMINELDIIEEDTDDLQ 2c6cA 621 :EMKTYSVSFDSLFSAVKNFTEIASKFSERL T0365 179 :LRRQLFALESELNPVDV 2c6cA 708 :IYDALFDIESKVDPSKA T0365 198 :LYKTIEWVGGLADLAERVGSRLE 2c6cA 725 :WGEVKRQIYVAAFTVQAAAETLS T0365 225 :R 2c6cA 748 :E Number of specific fragments extracted= 13 number of extra gaps= 0 total=4865 Number of alignments=646 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 T0365 15 :IKPLQEH 2c6cA 58 :MKAFLDE T0365 22 :MDKVYDC 2c6cA 67 :AENIKKF T0365 36 :FEATITGN 2c6cA 74 :LYNFTQIP T0365 44 :WDDAVQIRKQISLAEKQ 2c6cA 86 :TEQNFQLAKQIQSQWKE T0365 62 :DSLKREIRLTL 2c6cA 182 :TEDFFKLERDM T0365 77 :FMPVERTDLLELLTQ 2c6cA 294 :VHPIGYYDAQKLLEK T0365 95 :IANKAKDISGRVIGR 2c6cA 391 :GAAVVHEIVRSFGTL T0365 110 :QLLIP 2c6cA 480 :ELKSP T0365 115 :QALQVPFIA 2c6cA 491 :KSLYESWTK T0365 128 :CIDAVGLAQQVINELDDL 2c6cA 597 :CRDYAVVLRKYADKIYSI T0365 146 :LEAG 2c6cA 622 :MKTY T0365 152 :GREVDFVAKMINELDIIEEDTDDLQ 2c6cA 626 :SVSFDSLFSAVKNFTEIASKFSERL T0365 177 :IQLRRQLFALE 2c6cA 662 :RMMNDQLMFLE T0365 191 :NPVD 2c6cA 720 :DPSK T0365 197 :FLYKTIEWVGGLADLAERVGSRL 2c6cA 724 :AWGEVKRQIYVAAFTVQAAAETL T0365 225 :R 2c6cA 747 :S Number of specific fragments extracted= 16 number of extra gaps= 0 total=4881 Number of alignments=647 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 38 :ATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 2c6cA 553 :HSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFD T0365 82 :RTDLLELLTQQDKI 2c6cA 598 :RDYAVVLRKYADKI Number of specific fragments extracted= 2 number of extra gaps= 0 total=4883 Number of alignments=648 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)E169 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 39 :TITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDL 2c6cA 554 :SVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDY T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 2c6cA 602 :VVLRKYADKIYSISMKHPQEMKTYSVS T0365 132 :VGLAQQVINELDDL 2c6cA 629 :FDSLFSAVKNFTEI T0365 158 :VAKMINELDII 2c6cA 643 :ASKFSERLQDF T0365 173 :DDLQIQ 2c6cA 658 :PIVLRM Number of specific fragments extracted= 5 number of extra gaps= 0 total=4888 Number of alignments=649 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)R151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 75 :GLFMPVERTDLLELLTQQ 2c6cA 590 :SIVLPFDCRDYAVVLRKY T0365 96 :ANKAKDI 2c6cA 608 :ADKIYSI T0365 110 :QLLIPQALQV 2c6cA 615 :SMKHPQEMKT T0365 133 :GLAQQVINELDDLLE 2c6cA 630 :DSLFSAVKNFTEIAS T0365 148 :AGF 2c6cA 651 :QDF T0365 155 :VDFVAKMINELDIIEE 2c6cA 658 :PIVLRMMNDQLMFLER T0365 179 :LRRQLFALESELNPVDV 2c6cA 708 :IYDALFDIESKVDPSKA T0365 198 :LYKTIEWVGGLADLAERVGS 2c6cA 725 :WGEVKRQIYVAAFTVQAAAE Number of specific fragments extracted= 8 number of extra gaps= 0 total=4896 Number of alignments=650 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)R151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 75 :GLFMPVERTDLLELLTQQ 2c6cA 590 :SIVLPFDCRDYAVVLRKY T0365 96 :ANKAKDISG 2c6cA 608 :ADKIYSISM T0365 105 :RVIGRQLL 2c6cA 621 :EMKTYSVS T0365 118 :QVPFIAYLQRCIDAVGLAQQVIN 2c6cA 629 :FDSLFSAVKNFTEIASKFSERLQ T0365 149 :GF 2c6cA 652 :DF T0365 155 :VDFVAKMINELDIIE 2c6cA 658 :PIVLRMMNDQLMFLE T0365 179 :LRRQLFALESELNPVD 2c6cA 708 :IYDALFDIESKVDPSK T0365 197 :FLYKTIEWVGGLADLAERVGSR 2c6cA 724 :AWGEVKRQIYVAAFTVQAAAET Number of specific fragments extracted= 8 number of extra gaps= 0 total=4904 Number of alignments=651 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)E67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)I130 Warning: unaligning (T0365)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)I130 Warning: unaligning (T0365)V132 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)A135 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 Warning: unaligning (T0365)L223 because last residue in template chain is (2c6cA)A750 T0365 1 :M 2c6cA 58 :M T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDA 2c6cA 59 :KAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEF T0365 48 :VQIRKQISLAEKQGDSLKR 2c6cA 110 :LAHYDVLLSYPNKTHPNYI T0365 69 :RLT 2c6cA 131 :INE T0365 72 :LPSGLFMPVERT 2c6cA 139 :FNTSLFEPPPPG T0365 84 :DLLELLTQQDKIANKAKDISGRVIGR 2c6cA 596 :DCRDYAVVLRKYADKIYSISMKHPQE T0365 110 :QLLIPQALQVPFIAYLQRCIDA 2c6cA 632 :LFSAVKNFTEIASKFSERLQDF T0365 136 :QQVINELDD 2c6cA 658 :PIVLRMMND T0365 145 :LLEAGFRG 2c6cA 670 :FLERAFID T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNPVDV 2c6cA 682 :PDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKA T0365 198 :LYKTIEWVGGLADLAERVGSRLELM 2c6cA 725 :WGEVKRQIYVAAFTVQAAAETLSEV Number of specific fragments extracted= 11 number of extra gaps= 1 total=4915 Number of alignments=652 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)E67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)I130 Warning: unaligning (T0365)I68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)I130 T0365 1 :MP 2c6cA 58 :MK T0365 4 :NSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDA 2c6cA 60 :AFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEF T0365 48 :VQIRKQISLAEKQGDSLKR 2c6cA 110 :LAHYDVLLSYPNKTHPNYI T0365 69 :RLT 2c6cA 131 :INE T0365 72 :LPSGLFMPVERT 2c6cA 139 :FNTSLFEPPPPG T0365 165 :LDIIEEDTDDLQIQLRRQLFA 2c6cA 432 :TEWAEENSRLLQERGVAYINA Number of specific fragments extracted= 6 number of extra gaps= 1 total=4921 Number of alignments=653 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 T0365 15 :IKPLQEH 2c6cA 58 :MKAFLDE T0365 22 :MDKVYDCASLL 2c6cA 67 :AENIKKFLYNF T0365 42 :GNWDDAVQIRKQISLAEKQ 2c6cA 84 :AGTEQNFQLAKQIQSQWKE T0365 73 :PS 2c6cA 132 :NE T0365 75 :GLFMPVERT 2c6cA 142 :SLFEPPPPG T0365 86 :LELLTQQDK 2c6cA 559 :YELVEKFYD T0365 95 :IANKAKDISGR 2c6cA 576 :VAQVRGGMVFE T0365 108 :GRQLLIPQ 2c6cA 587 :LANSIVLP T0365 120 :P 2c6cA 596 :D T0365 128 :CIDAVGLAQQVINELDDLL 2c6cA 597 :CRDYAVVLRKYADKIYSIS T0365 147 :EAGFRGREVDFVAKMINELDIIEEDTDDLQ 2c6cA 621 :EMKTYSVSFDSLFSAVKNFTEIASKFSERL T0365 179 :LRRQLFALESELNPVDV 2c6cA 708 :IYDALFDIESKVDPSKA T0365 198 :LYKTIEWVGGLADLAERVGSRLE 2c6cA 725 :WGEVKRQIYVAAFTVQAAAETLS T0365 225 :R 2c6cA 748 :E Number of specific fragments extracted= 14 number of extra gaps= 0 total=4935 Number of alignments=654 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 T0365 15 :IKPLQEH 2c6cA 58 :MKAFLDE T0365 22 :MDKVYDCASLL 2c6cA 67 :AENIKKFLYNF T0365 42 :GNWDDAVQIRKQISLAEKQ 2c6cA 84 :AGTEQNFQLAKQIQSQWKE T0365 86 :LELL 2c6cA 559 :YELV T0365 90 :TQQDKIANKAKDISGRVIGRQLLIP 2c6cA 571 :KYHLTVAQVRGGMVFELANSIVLPF T0365 120 :PFIAYLQRCIDAVGLAQQVI 2c6cA 596 :DCRDYAVVLRKYADKIYSIS T0365 141 :E 2c6cA 621 :E T0365 146 :LEA 2c6cA 622 :MKT T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQ 2c6cA 625 :YSVSFDSLFSAVKNFTEIASKFSERL T0365 177 :IQLRRQLFALE 2c6cA 662 :RMMNDQLMFLE T0365 191 :NPVD 2c6cA 720 :DPSK T0365 197 :FLYKTIEWVGGLADLAERVGSRL 2c6cA 724 :AWGEVKRQIYVAAFTVQAAAETL T0365 225 :R 2c6cA 747 :S Number of specific fragments extracted= 13 number of extra gaps= 0 total=4948 Number of alignments=655 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 38 :ATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 2c6cA 553 :HSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFD T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLI 2c6cA 598 :RDYAVVLRKYADKIYSISMKHPQEMKTYSVSF T0365 115 :QALQVPFIAYLQRCIDAVGLAQQ 2c6cA 630 :DSLFSAVKNFTEIASKFSERLQD Number of specific fragments extracted= 3 number of extra gaps= 0 total=4951 Number of alignments=656 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)E169 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 38 :ATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 2c6cA 553 :HSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFD T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLI 2c6cA 598 :RDYAVVLRKYADKIYSISMKHPQEMKTYSVSF T0365 133 :GLAQQVINELDDL 2c6cA 630 :DSLFSAVKNFTEI T0365 158 :VAKMINELDII 2c6cA 643 :ASKFSERLQDF T0365 173 :DDLQIQLRRQLF 2c6cA 658 :PIVLRMMNDQLM Number of specific fragments extracted= 5 number of extra gaps= 0 total=4956 Number of alignments=657 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)R151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 75 :GLFMPVERTDLLELLTQQ 2c6cA 590 :SIVLPFDCRDYAVVLRKY T0365 96 :ANKA 2c6cA 608 :ADKI T0365 107 :IGRQLLIPQALQV 2c6cA 612 :YSISMKHPQEMKT T0365 133 :GLAQQVINELDDLLE 2c6cA 630 :DSLFSAVKNFTEIAS T0365 148 :AGF 2c6cA 651 :QDF T0365 155 :VDFVAKMINELDIIEE 2c6cA 658 :PIVLRMMNDQLMFLER T0365 179 :LRRQLFALESELNPVDV 2c6cA 708 :IYDALFDIESKVDPSKA T0365 198 :LYKTIEWVGGLADLAERVGSR 2c6cA 725 :WGEVKRQIYVAAFTVQAAAET Number of specific fragments extracted= 8 number of extra gaps= 0 total=4964 Number of alignments=658 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)R151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 76 :LFMPVERTDLL 2c6cA 591 :IVLPFDCRDYA T0365 90 :TQQDKIANKAKDISG 2c6cA 602 :VVLRKYADKIYSISM T0365 105 :RVIGRQLLI 2c6cA 621 :EMKTYSVSF T0365 119 :VPFIAYLQRCIDAVGLAQQVI 2c6cA 630 :DSLFSAVKNFTEIASKFSERL T0365 148 :AGF 2c6cA 651 :QDF T0365 155 :VDFVAKMINELDIIE 2c6cA 658 :PIVLRMMNDQLMFLE T0365 179 :LRRQLFALESELNPVDV 2c6cA 708 :IYDALFDIESKVDPSKA T0365 198 :LYKTIEWVGGLADLAERVGSR 2c6cA 725 :WGEVKRQIYVAAFTVQAAAET Number of specific fragments extracted= 8 number of extra gaps= 0 total=4972 Number of alignments=659 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 Warning: unaligning (T0365)S55 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)I130 Warning: unaligning (T0365)L56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)I130 Warning: unaligning (T0365)F77 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)V175 Warning: unaligning (T0365)M78 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)V175 T0365 15 :IKPLQE 2c6cA 58 :MKAFLD T0365 21 :HMDKVYDCASLLVPFFEATITGNWDDAVQIRKQ 2c6cA 82 :HLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYD T0365 54 :I 2c6cA 128 :I T0365 57 :AEKQGDSLKREIRLT 2c6cA 131 :INEDGNEIFNTSLFE T0365 72 :LPSGL 2c6cA 169 :MPEGD T0365 79 :PVE 2c6cA 176 :YVN T0365 82 :RTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELN 2c6cA 182 :TEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPS T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 2c6cA 293 :PVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPY Number of specific fragments extracted= 8 number of extra gaps= 2 total=4980 Number of alignments=660 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 Warning: unaligning (T0365)S55 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2c6cA)I130 Warning: unaligning (T0365)L56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2c6cA)I130 T0365 15 :IKPLQE 2c6cA 58 :MKAFLD T0365 21 :HMDKVYDCASLLVPFFEATITGNWDDAVQIRKQ 2c6cA 82 :HLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYD T0365 54 :I 2c6cA 128 :I T0365 57 :AEKQGDSLKREIRLT 2c6cA 131 :INEDGNEIFNTSLFE T0365 73 :PSGLFMP 2c6cA 160 :PFSAFSP T0365 83 :TDLLELLTQQ 2c6cA 183 :EDFFKLERDM T0365 95 :IANKAKDI 2c6cA 193 :KINCSGKI T0365 103 :SGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQ 2c6cA 217 :AQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGG T0365 138 :VINELDDLLEAGFRGREVDFVAKMINELDIIEE 2c6cA 260 :NLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSI T0365 192 :PVDVMFLYKTIEWVGG 2c6cA 293 :PVHPIGYYDAQKLLEK Number of specific fragments extracted= 10 number of extra gaps= 1 total=4990 Number of alignments=661 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 Warning: unaligning (T0365)R151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 Warning: unaligning (T0365)L223 because last residue in template chain is (2c6cA)A750 T0365 15 :IKPLQEH 2c6cA 58 :MKAFLDE T0365 22 :MDKVY 2c6cA 67 :AENIK T0365 27 :DCASLLVPFFEATIT 2c6cA 88 :QNFQLAKQIQSQWKE T0365 42 :GNWDD 2c6cA 149 :PGYEN T0365 51 :RKQISLAEKQ 2c6cA 182 :TEDFFKLERD T0365 72 :LPSGLFMPVERTDLLELL 2c6cA 289 :LPSIPVHPIGYYDAQKLL T0365 98 :KAKDISGRV 2c6cA 434 :WAEENSRLL T0365 107 :IGRQLLIPQA 2c6cA 477 :LTKELKSPDE T0365 118 :QVPFIAYLQRCIDAV 2c6cA 597 :CRDYAVVLRKYADKI T0365 133 :GLAQQVINELDDLLE 2c6cA 630 :DSLFSAVKNFTEIAS T0365 148 :AGF 2c6cA 651 :QDF T0365 155 :VDFVAKMINEL 2c6cA 658 :PIVLRMMNDQL T0365 179 :LRRQLFALESELNPVD 2c6cA 708 :IYDALFDIESKVDPSK T0365 197 :FLYKTIEWVGGLADLAERVGSRLELM 2c6cA 724 :AWGEVKRQIYVAAFTVQAAAETLSEV Number of specific fragments extracted= 14 number of extra gaps= 0 total=5004 Number of alignments=662 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)P14 because first residue in template chain is (2c6cA)N57 T0365 15 :IKPLQEHMDK 2c6cA 58 :MKAFLDELKA T0365 30 :SLLVPFFEATITGN 2c6cA 68 :ENIKKFLYNFTQIP T0365 44 :WDDAVQIRKQISLAEKQ 2c6cA 86 :TEQNFQLAKQIQSQWKE T0365 63 :SLKREIRLT 2c6cA 183 :EDFFKLERD T0365 72 :LPSGLFMPVERTDLLELL 2c6cA 289 :LPSIPVHPIGYYDAQKLL T0365 96 :ANKAKDISGRVIGR 2c6cA 392 :AAVVHEIVRSFGTL T0365 115 :QALQVP 2c6cA 440 :RLLQER T0365 121 :FIAYLQR 2c6cA 493 :LYESWTK T0365 128 :CIDAVGLAQQVINELDDLLEAG 2c6cA 597 :CRDYAVVLRKYADKIYSISMKH T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQ 2c6cA 625 :YSVSFDSLFSAVKNFTEIASKFSERL T0365 177 :IQLRRQLFALE 2c6cA 662 :RMMNDQLMFLE T0365 190 :LNPVD 2c6cA 719 :VDPSK T0365 197 :FLYKTIEWVGGLADLAERVGSRL 2c6cA 724 :AWGEVKRQIYVAAFTVQAAAETL Number of specific fragments extracted= 13 number of extra gaps= 0 total=5017 Number of alignments=663 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEAT 2c6cA 664 :MNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKY T0365 43 :NWDDAVQIRKQISLAEKQGDSLK 2c6cA 701 :AGESFPGIYDALFDIESKVDPSK Number of specific fragments extracted= 2 number of extra gaps= 0 total=5019 Number of alignments=664 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set T0365 44 :WDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLT 2c6cA 559 :YELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLR T0365 94 :KIANKAKDISGRV 2c6cA 606 :KYADKIYSISMKH T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 2c6cA 619 :PQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDF Number of specific fragments extracted= 3 number of extra gaps= 0 total=5022 Number of alignments=665 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)R151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 76 :LFMPVERTDLLE 2c6cA 591 :IVLPFDCRDYAV T0365 98 :KAKDISGRVIGRQLLIPQALQV 2c6cA 603 :VLRKYADKIYSISMKHPQEMKT T0365 126 :QRCIDAVGLAQQVINELDDLL 2c6cA 630 :DSLFSAVKNFTEIASKFSERL T0365 148 :AGF 2c6cA 651 :QDF T0365 155 :VDFVAKMINEL 2c6cA 658 :PIVLRMMNDQL T0365 179 :LRRQLFALESELNPVD 2c6cA 708 :IYDALFDIESKVDPSK T0365 197 :FLYKTIEWVGGLADLAERVGSRL 2c6cA 724 :AWGEVKRQIYVAAFTVQAAAETL Number of specific fragments extracted= 7 number of extra gaps= 0 total=5029 Number of alignments=666 # 2c6cA read from 2c6cA/merged-a2m # found chain 2c6cA in template set Warning: unaligning (T0365)R151 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2c6cA)N657 Warning: unaligning (T0365)E154 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2c6cA)N657 T0365 77 :FMPVERTDLLELLT 2c6cA 592 :VLPFDCRDYAVVLR T0365 94 :KIANKAKDISG 2c6cA 606 :KYADKIYSISM T0365 113 :IPQALQVP 2c6cA 617 :KHPQEMKT T0365 127 :RCIDAVGLAQQVINELDDLL 2c6cA 631 :SLFSAVKNFTEIASKFSERL T0365 148 :AGF 2c6cA 651 :QDF T0365 155 :VDFVAKMINELDIIE 2c6cA 658 :PIVLRMMNDQLMFLE T0365 179 :LRRQLFALESELNPVD 2c6cA 708 :IYDALFDIESKVDPSK T0365 197 :FLYKTIEWVGGLADLAERVGSRL 2c6cA 724 :AWGEVKRQIYVAAFTVQAAAETL Number of specific fragments extracted= 8 number of extra gaps= 0 total=5037 Number of alignments=667 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sumB/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0365 read from 1sumB/merged-a2m # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEI T0365 69 :RLTLP 1sumB 61 :EKAME T0365 74 :SGLFMPVER 1sumB 67 :LGLFSPIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINELDII 1sumB 137 :FADVNVEKSFEVCRMDSKV T0365 173 :DDLQIQLRRQLFA 1sumB 156 :DDLYEKVREELLL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1sumB 171 :MESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMV T0365 224 :ARV 1sumB 220 :LLL Number of specific fragments extracted= 8 number of extra gaps= 0 total=5045 Number of alignments=668 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEI T0365 69 :RLTLP 1sumB 61 :EKAME T0365 74 :SGLFMPVER 1sumB 67 :LGLFSPIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINELDII 1sumB 137 :FADVNVEKSFEVCRMDSKV T0365 173 :DDLQIQLRRQLFA 1sumB 156 :DDLYEKVREELLL T0365 186 :LESELNPV 1sumB 171 :MESPKYVK T0365 194 :DVMFLYKTIEWVGGL 1sumB 182 :LLLEIAGNIEIIADY T0365 209 :ADLAERV 1sumB 198 :TNIVEVS T0365 216 :GSRLELMLARV 1sumB 210 :GEAYKCYHDEL Number of specific fragments extracted= 10 number of extra gaps= 0 total=5055 Number of alignments=669 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEI T0365 69 :RLTLP 1sumB 61 :EKAME T0365 74 :SGLFMPVER 1sumB 67 :LGLFSPIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALESELNP 1sumB 137 :FADVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPKYVKR T0365 193 :VDVMFLYKTIEWVGGLA 1sumB 181 :LLLLEIAGNIEIIADYA Number of specific fragments extracted= 6 number of extra gaps= 1 total=5061 Number of alignments=670 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREI 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEI T0365 69 :RLTLP 1sumB 61 :EKAME T0365 74 :SGLFMPVER 1sumB 67 :LGLFSPIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINELDII 1sumB 137 :FADVNVEKSFEVCRMDSKV T0365 173 :DDLQIQLRRQLFA 1sumB 156 :DDLYEKVREELLL T0365 186 :LESELNP 1sumB 171 :MESPKYV T0365 193 :VDVMFLYKTIEWVGGL 1sumB 181 :LLLLEIAGNIEIIADY Number of specific fragments extracted= 8 number of extra gaps= 0 total=5069 Number of alignments=671 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVLGL T0365 79 :PVERT 1sumB 72 :PIGKP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1sumB 82 :AGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVN T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESEL 1sumB 142 :VEKSFEVCRMDSKVDDLYEKVREELLLYMMES T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1sumB 174 :PKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMV Number of specific fragments extracted= 5 number of extra gaps= 0 total=5074 Number of alignments=672 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVLGL T0365 79 :PVER 1sumB 72 :PIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVN T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESE 1sumB 142 :VEKSFEVCRMDSKVDDLYEKVREELLLYMME T0365 190 :LNP 1sumB 175 :KYV T0365 193 :VDVMFLYKTIEWVGGLA 1sumB 181 :LLLLEIAGNIEIIADYA T0365 210 :DLAERV 1sumB 199 :NIVEVS T0365 216 :GSRLELMLARV 1sumB 210 :GEAYKCYHDEL Number of specific fragments extracted= 8 number of extra gaps= 0 total=5082 Number of alignments=673 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVLGL T0365 79 :PVERT 1sumB 72 :PIGKP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1sumB 82 :AGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVN T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFAL 1sumB 142 :VEKSFEVCRMDSKVDDLYEKVREELLLY T0365 187 :ESELNPVDVMFLYKTIEWVGGLA 1sumB 175 :KYVKRALLLLEIAGNIEIIADYA Number of specific fragments extracted= 5 number of extra gaps= 1 total=5087 Number of alignments=674 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 23 :DKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1sumB 14 :KGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVLGL T0365 79 :PVER 1sumB 72 :PIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINELD 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVN T0365 159 :AKMINELDIIEEDTDDLQIQLRRQLFALESE 1sumB 142 :VEKSFEVCRMDSKVDDLYEKVREELLLYMME T0365 190 :LN 1sumB 175 :KY T0365 192 :PVDVMFLYKTIEWVGGLA 1sumB 180 :ALLLLEIAGNIEIIADYA Number of specific fragments extracted= 6 number of extra gaps= 0 total=5093 Number of alignments=675 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)M1 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)P2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 4 :N 1sumB 6 :N T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIR 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQ T0365 70 :LTLPSGLFMPVERT 1sumB 63 :AMEVLGLFSPIGKP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 82 :AGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINEL 1sumB 137 :FADVNVEKSFEVCRMD T0365 170 :EDTDDLQIQLRRQLFAL 1sumB 153 :SKVDDLYEKVREELLLY T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRL 1sumB 172 :ESPKYVKRALLLLEIAGNIEIIADYATNIVEVS T0365 220 :ELMLARV 1sumB 220 :LLLFKKS Number of specific fragments extracted= 8 number of extra gaps= 1 total=5101 Number of alignments=676 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)M1 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)P2 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 4 :N 1sumB 6 :N T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIR 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQ T0365 70 :LTLPSGLFMPVERT 1sumB 63 :AMEVLGLFSPIGKP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 82 :AGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINEL 1sumB 137 :FADVNVEKSFEVCRMD T0365 170 :EDTDDLQIQLRRQLFAL 1sumB 153 :SKVDDLYEKVREELLLY T0365 187 :ES 1sumB 172 :ES T0365 189 :ELNPVDVMFLYKTIEWVGGLA 1sumB 177 :VKRALLLLEIAGNIEIIADYA T0365 210 :DLAERV 1sumB 199 :NIVEVS T0365 216 :GS 1sumB 210 :GE T0365 218 :RLELMLARV 1sumB 218 :DELLLFKKS Number of specific fragments extracted= 11 number of extra gaps= 1 total=5112 Number of alignments=677 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIR 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQ T0365 70 :LTLPSGLFMPVERT 1sumB 63 :AMEVLGLFSPIGKP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 82 :AGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINEL 1sumB 137 :FADVNVEKSFEVCRMD T0365 170 :EDTDDLQIQLRRQLFAL 1sumB 153 :SKVDDLYEKVREELLLY T0365 187 :ESELNPVDVMFLYKTIEWVGGLA 1sumB 175 :KYVKRALLLLEIAGNIEIIADYA Number of specific fragments extracted= 6 number of extra gaps= 0 total=5118 Number of alignments=678 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 22 :MDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIR 1sumB 13 :KKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQ T0365 70 :LTLPSGLFMPVERT 1sumB 63 :AMEVLGLFSPIGKP T0365 84 :DLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQV 1sumB 82 :AGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRM T0365 150 :FRGREVDFVAKMINEL 1sumB 137 :FADVNVEKSFEVCRMD T0365 170 :EDTDDLQIQLRRQLFAL 1sumB 153 :SKVDDLYEKVREELLLY T0365 187 :ESELNPVDVMFLYKTIEWVGGLA 1sumB 175 :KYVKRALLLLEIAGNIEIIADYA Number of specific fragments extracted= 6 number of extra gaps= 0 total=5124 Number of alignments=679 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 5 :SILGVFAKSPIKPLQE 1sumB 103 :NVLELMEEPPLKPLED Number of specific fragments extracted= 1 number of extra gaps= 0 total=5125 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 93 :DKIANKAKDISG 1sumB 91 :ENIADKCHDIAK Number of specific fragments extracted= 1 number of extra gaps= 0 total=5126 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)I6 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)L7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 8 :G 1sumB 6 :N T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEE T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDL 1sumB 111 :PPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQL 1sumB 141 :NVEKSFEVCRMDSKVDDLYEKVREEL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 169 :YMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 7 number of extra gaps= 0 total=5133 Number of alignments=680 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)I6 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)L7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 8 :G 1sumB 6 :N T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEE T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDL 1sumB 111 :PPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 154 :E 1sumB 141 :N T0365 159 :AKMINELDIIEEDTDDLQIQLRRQL 1sumB 142 :VEKSFEVCRMDSKVDDLYEKVREEL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 169 :YMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 8 number of extra gaps= 0 total=5141 Number of alignments=681 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQ 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMAN T0365 130 :DAVGLAQQVINELD 1sumB 125 :QTSEMLKFALRMFA T0365 152 :GREVDFV 1sumB 139 :DVNVEKS T0365 163 :NELDIIEEDTDDLQIQLRRQL 1sumB 146 :FEVCRMDSKVDDLYEKVREEL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 169 :YMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 7 number of extra gaps= 0 total=5148 Number of alignments=682 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRKQ 1sumB 36 :ERNESLAREVIAD T0365 54 :ISLAEKQGDSLKREIRLTLP 1sumB 52 :VDQMEVEIQEKAMEVLGLFS T0365 79 :PVER 1sumB 72 :PIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVI 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQAL 1sumB 107 :LMEEPPLKPL T0365 119 :VPFIAYLQRCIDAVGLAQQVIN 1sumB 117 :EDIPAMANQTSEMLKFALRMFA T0365 152 :GREVDFVAK 1sumB 139 :DVNVEKSFE T0365 165 :LDIIEEDTDDLQIQLRRQLFAL 1sumB 148 :VCRMDSKVDDLYEKVREELLLY T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 172 :ESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 10 number of extra gaps= 0 total=5158 Number of alignments=683 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEE T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDL 1sumB 111 :PPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQL 1sumB 141 :NVEKSFEVCRMDSKVDDLYEKVREEL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1sumB 169 :YMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMV Number of specific fragments extracted= 6 number of extra gaps= 0 total=5164 Number of alignments=684 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 18 :LQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 9 :VEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEE T0365 116 :ALQVPFIAYLQRCIDAVGLAQQVINELDDL 1sumB 111 :PPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 154 :E 1sumB 141 :N T0365 159 :AKMINELDIIEEDTDDLQIQLRRQL 1sumB 142 :VEKSFEVCRMDSKVDDLYEKVREEL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELM 1sumB 169 :YMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYM Number of specific fragments extracted= 7 number of extra gaps= 0 total=5171 Number of alignments=685 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQ 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMAN T0365 130 :DAVGLAQQVINELD 1sumB 125 :QTSEMLKFALRMFA T0365 152 :GREVDFV 1sumB 139 :DVNVEKS T0365 163 :NELDIIEEDTDDLQIQLRRQL 1sumB 146 :FEVCRMDSKVDDLYEKVREEL T0365 184 :FALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1sumB 169 :YMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMV Number of specific fragments extracted= 7 number of extra gaps= 0 total=5178 Number of alignments=686 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATI 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRKQ 1sumB 36 :ERNESLAREVIAD T0365 54 :ISLAEKQGDSLKREIRLTLP 1sumB 52 :VDQMEVEIQEKAMEVLGLFS T0365 79 :PVER 1sumB 72 :PIGK T0365 83 :TDLLELLTQQDKIANKAKDISGRVI 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQAL 1sumB 107 :LMEEPPLKPL T0365 119 :VPFIAYLQRCIDAVGLAQQVIN 1sumB 117 :EDIPAMANQTSEMLKFALRMFA T0365 152 :GREVDFVAK 1sumB 139 :DVNVEKSFE T0365 165 :LDIIEEDTDDLQIQLRRQLFAL 1sumB 148 :VCRMDSKVDDLYEKVREELLLY T0365 187 :ESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 172 :ESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 10 number of extra gaps= 0 total=5188 Number of alignments=687 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 6 :ILG 1sumB 6 :NEK T0365 18 :LQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 9 :VEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELME T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1sumB 110 :EPPLKPLEDIPAMANQTSEMLKFALRMFAD T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 140 :VNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 7 number of extra gaps= 0 total=5195 Number of alignments=688 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)I6 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)L7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELME T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1sumB 110 :EPPLKPLEDIPAMANQTSEMLKFALRMFAD T0365 153 :REVDFVAKM 1sumB 140 :VNVEKSFEV T0365 166 :DIIEEDTDDLQIQLRRQLF 1sumB 149 :CRMDSKVDDLYEKVREELL T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 170 :MMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 7 number of extra gaps= 0 total=5202 Number of alignments=689 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQR 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQ T0365 131 :AVGLAQQVINELD 1sumB 126 :TSEMLKFALRMFA T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 139 :DVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 6 number of extra gaps= 0 total=5208 Number of alignments=690 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)V3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)N4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRK 1sumB 36 :ERNESLAREVIA T0365 53 :QISLAEKQGDSLKREIRLTLP 1sumB 51 :VVDQMEVEIQEKAMEVLGLFS T0365 79 :PVERT 1sumB 72 :PIGKP T0365 86 :LELLTQQDKIANKAKDISGRVI 1sumB 84 :IRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQALQ 1sumB 107 :LMEEPPLKPLE T0365 120 :PFIAYLQRCIDAVGLAQQVI 1sumB 118 :DIPAMANQTSEMLKFALRMF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 138 :ADVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG T0365 226 :V 1sumB 212 :A Number of specific fragments extracted= 10 number of extra gaps= 0 total=5218 Number of alignments=691 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELME T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1sumB 110 :EPPLKPLEDIPAMANQTSEMLKFALRMFAD T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 140 :VNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 6 number of extra gaps= 0 total=5224 Number of alignments=692 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 17 :PLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 8 :KVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELME T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINELDD 1sumB 110 :EPPLKPLEDIPAMANQTSEMLKFALRMFAD T0365 153 :REVDFVAKM 1sumB 140 :VNVEKSFEV T0365 166 :DIIEEDTDDLQIQLRRQLF 1sumB 149 :CRMDSKVDDLYEKVREELL T0365 185 :ALESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1sumB 170 :MMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMV Number of specific fragments extracted= 7 number of extra gaps= 0 total=5231 Number of alignments=693 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQR 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQ T0365 131 :AVGLAQQVINELD 1sumB 126 :TSEMLKFALRMFA T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 139 :DVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 6 number of extra gaps= 0 total=5237 Number of alignments=694 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRK 1sumB 36 :ERNESLAREVIA T0365 53 :QISLAEKQGDSLKREIRLTLP 1sumB 51 :VVDQMEVEIQEKAMEVLGLFS T0365 79 :PVERT 1sumB 72 :PIGKP T0365 86 :LELLTQQDKIANKAKDISGRVI 1sumB 84 :IRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQALQ 1sumB 107 :LMEEPPLKPLE T0365 120 :PFIAYLQRCIDAVGLAQQVI 1sumB 118 :DIPAMANQTSEMLKFALRMF T0365 151 :RGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1sumB 138 :ADVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPK T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 176 :YVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 9 number of extra gaps= 0 total=5246 Number of alignments=695 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)A11 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)K12 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)S13 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFA 1sumB 141 :NVEKSFEVCRMDSKVDDLYEKVREELLL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLARV 1sumB 171 :MESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQGE Number of specific fragments extracted= 5 number of extra gaps= 0 total=5251 Number of alignments=696 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)I6 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)L7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 8 :G 1sumB 6 :N T0365 16 :KPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 7 :EKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFA 1sumB 141 :NVEKSFEVCRMDSKVDDLYEKVREELLL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 171 :MESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 6 number of extra gaps= 0 total=5257 Number of alignments=697 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)I6 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)L7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 8 :GVFAKSPIKPLQEHMDKVYDCASLLVPFFE 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSISSLV T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1sumB 36 :ERNESLAREVIADEEVVDQMEVEIQEK T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFAD T0365 153 :REVDFV 1sumB 140 :VNVEKS T0365 163 :NELDIIEEDTDDLQIQLRRQLFA 1sumB 146 :FEVCRMDSKVDDLYEKVREELLL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELMLA 1sumB 171 :MESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=5264 Number of alignments=698 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P2 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)I6 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRKQ 1sumB 36 :ERNESLAREVIAD T0365 54 :ISLAEKQGDSLKREIRLTLP 1sumB 52 :VDQMEVEIQEKAMEVLGLFS T0365 83 :TDLLELLTQQDKIANKAKDISGRVI 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQAL 1sumB 107 :LMEEPPLKPL T0365 120 :PFIAYLQRCIDAVGLAQQVIN 1sumB 118 :DIPAMANQTSEMLKFALRMFA T0365 152 :GREVDFVAKMI 1sumB 139 :DVNVEKSFEVC T0365 167 :IIEEDTDDLQIQLRRQLFALESE 1sumB 150 :RMDSKVDDLYEKVREELLLYMME T0365 191 :N 1sumB 173 :S T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELMLAR 1sumB 177 :VKRALLLLEIAGNIEIIADYATNIVEVSVYMVQG Number of specific fragments extracted= 10 number of extra gaps= 0 total=5274 Number of alignments=699 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 25 :VYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 16 :VLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFA 1sumB 141 :NVEKSFEVCRMDSKVDDLYEKVREELLL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERV 1sumB 171 :MESPKYVKRALLLLEIAGNIEIIADYATNI Number of specific fragments extracted= 5 number of extra gaps= 0 total=5279 Number of alignments=700 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set T0365 21 :HMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1sumB 12 :FKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAME T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADV T0365 158 :VAKMINELDIIEEDTDDLQIQLRRQLFA 1sumB 141 :NVEKSFEVCRMDSKVDDLYEKVREELLL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGS 1sumB 171 :MESPKYVKRALLLLEIAGNIEIIADYATNIVE Number of specific fragments extracted= 5 number of extra gaps= 0 total=5284 Number of alignments=701 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)N4 because first residue in template chain is (1sumB)N2 Warning: unaligning (T0365)S5 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1sumB)L4 Warning: unaligning (T0365)I6 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L4 Warning: unaligning (T0365)L7 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 8 :GVFAKSPIKPLQEHMDKVYDCASL 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRN T0365 35 :FFEATI 1sumB 30 :SISSLV T0365 45 :DDAVQIRKQISLAEKQGDSLKREIRLT 1sumB 36 :ERNESLAREVIADEEVVDQMEVEIQEK T0365 75 :GLFMPVERTDL 1sumB 68 :GLFSPIGKPLL T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINE 1sumB 84 :IRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFAD T0365 153 :REVDFV 1sumB 140 :VNVEKS T0365 163 :NELDIIEEDTDDLQIQLRRQLFA 1sumB 146 :FEVCRMDSKVDDLYEKVREELLL T0365 186 :LESELNPVDVMFLYKTIEWVGGLADLAERVGSRLELML 1sumB 171 :MESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMV Number of specific fragments extracted= 8 number of extra gaps= 0 total=5292 Number of alignments=702 # 1sumB read from 1sumB/merged-a2m # found chain 1sumB in template set Warning: unaligning (T0365)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1sumB)L5 T0365 15 :IKPLQEHMDKVYDCASLLVPFFEATI 1sumB 6 :NEKVEEFKKGVLKAGWFIEKMFRNSI T0365 41 :TGNWDDAVQIRKQ 1sumB 36 :ERNESLAREVIAD T0365 54 :ISLAEKQGDSLKREIRLTLP 1sumB 52 :VDQMEVEIQEKAMEVLGLFS T0365 83 :TDLLELLTQQDKIANKAKDISGRVI 1sumB 81 :TAGIRVAELIENIADKCHDIAKNVL T0365 108 :GRQLLIPQAL 1sumB 107 :LMEEPPLKPL T0365 120 :PFIAYLQRCIDAVGLAQQVIN 1sumB 118 :DIPAMANQTSEMLKFALRMFA T0365 152 :GREVDFVAKMI 1sumB 139 :DVNVEKSFEVC T0365 167 :IIEEDTDDLQIQLRRQLFALESE 1sumB 150 :RMDSKVDDLYEKVREELLLYMME T0365 191 :N 1sumB 173 :S T0365 192 :PVDVMFLYKTIEWVGGLADLAERVGSRLELML 1sumB 177 :VKRALLLLEIAGNIEIIADYATNIVEVSVYMV Number of specific fragments extracted= 10 number of extra gaps= 1 total=5302 Number of alignments=703 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1z72A/merged-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1z72A expands to /projects/compbio/data/pdb/1z72.pdb.gz 1z72A:Skipped atom 11, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 13, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 15, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 17, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 55, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 57, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 59, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 61, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 63, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 65, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 67, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 69, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 71, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 84, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 86, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 88, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 90, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 92, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 94, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 96, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 98, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 143, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 145, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 147, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 149, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 151, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 153, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 155, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 157, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 159, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 161, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 163, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 165, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 167, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 169, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 171, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 188, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 190, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 192, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 194, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 196, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 198, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 200, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 202, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 204, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 302, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 304, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 306, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 308, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 310, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 312, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 372, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 374, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 376, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 378, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 380, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 382, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 384, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 386, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 388, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 398, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 400, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 402, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 404, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 406, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 408, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 410, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 412, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 414, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 431, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 433, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 435, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 437, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 439, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 441, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 443, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 445, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 447, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1z72A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 661, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 663, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 665, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 667, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 669, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 671, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 673, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 675, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 677, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 746, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 748, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 750, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 752, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 754, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 756, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 758, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 760, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 762, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 951, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 953, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 955, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 957, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 959, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 961, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 963, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 965, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 967, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1067, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1069, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1071, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1073, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1075, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1077, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1079, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1081, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1083, because occupancy 0.500 <= existing 0.500 in 1z72A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1342, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1344, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1346, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1348, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1350, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1352, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1384, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1386, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1388, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1390, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1392, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1394, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1396, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1398, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1407, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1409, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1411, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1413, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1415, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1417, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1419, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1421, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1423, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1432, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1434, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1436, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1438, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1440, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1442, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1444, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1446, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1448, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1450, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1452, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1454, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1511, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1513, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1515, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1517, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1519, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1521, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1523, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1525, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1723, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1725, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1727, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1729, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1731, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1733, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1735, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1737, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1739, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1741, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1743, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1745, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1747, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1749, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1751, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1753, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1755, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1757, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1759, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1761, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1763, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1765, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1767, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1769, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1771, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1773, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1775, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1777, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1779, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1781, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1783, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1785, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1787, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1789, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1791, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1793, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1802, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1804, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1806, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1808, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1810, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1812, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1814, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1816, because occupancy 0.500 <= existing 0.500 in 1z72A Skipped atom 1818, because occupancy 0.500 <= existing 0.500 in 1z72A # T0365 read from 1z72A/merged-a2m # 1z72A read from 1z72A/merged-a2m # adding 1z72A to template set # found chain 1z72A in template set Warning: unaligning (T0365)E170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)F197 because last residue in template chain is (1z72A)Y220 T0365 1 :MPVNSILGVFAKSPIKPLQEHM 1z72A 8 :FQPGLTVGELLKSSQKDWQAAI T0365 23 :DKVYDCASLLVPFFEATITGNWDDAVQIRKQI 1z72A 54 :DYHFFDAFLSMLGACVAHADKLESKLRFAKQL T0365 61 :GDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1z72A 86 :GFLEADEDGYFQKAFKELKVAENDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPE T0365 139 :INELDDLLEAGFRGREVDFVAKMINELDIIE 1z72A 162 :VYIHSEWINLHRGPFFAEWVQFLVDELNRVG T0365 173 :DDLQIQLRRQLFALESELNPVDVM 1z72A 196 :EDLTELQQRWNQAVALELAFFDIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=5307 Number of alignments=704 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)F197 because last residue in template chain is (1z72A)Y220 T0365 1 :MPVNSILGVFAKSPIKPLQEHMD 1z72A 8 :FQPGLTVGELLKSSQKDWQAAIN T0365 24 :KVYDCASLLVPFFEATITGNWDDAVQIRKQI 1z72A 55 :YHFFDAFLSMLGACVAHADKLESKLRFAKQL T0365 61 :GDSLKREIRLTLPSGLFMPVERTDLLEL 1z72A 86 :GFLEADEDGYFQKAFKELKVAENDYLEV T0365 114 :PQALQVPFIAYLQRCIDAVGLAQQVINELDDLLEAGF 1z72A 132 :SSDYAHLLVMLVIAEGLYLDWGSKDLALPEVYIHSEW T0365 151 :RGREVDFVAKMINELDIIE 1z72A 174 :GPFFAEWVQFLVDELNRVG T0365 173 :DDLQIQLRRQLFALESELNPVDVM 1z72A 196 :EDLTELQQRWNQAVALELAFFDIG Number of specific fragments extracted= 6 number of extra gaps= 0 total=5313 Number of alignments=705 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQIQL 1z72A 87 :FLEADEDGYFQKAFKELKVAENDYLEVTLHP Number of specific fragments extracted= 1 number of extra gaps= 0 total=5314 Number of alignments=706 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 148 :AGFRGREVDFVAKMINELDIIEEDTDDLQIQ 1z72A 86 :GFLEADEDGYFQKAFKELKVAENDYLEVTLH Number of specific fragments extracted= 1 number of extra gaps= 0 total=5315 Number of alignments=707 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)F197 because last residue in template chain is (1z72A)Y220 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYD 1z72A 4 :QDYAFQPGLTVGELLKSSQKDWQAAIN T0365 33 :VPFFEATITGNWDDAV 1z72A 31 :HRFVKELFAGTIENKV T0365 49 :QIRKQISLAEKQGD 1z72A 61 :FLSMLGACVAHADK T0365 66 :REIRLTLPSGLFMPVE 1z72A 75 :LESKLRFAKQLGFLEA T0365 93 :DKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAV 1z72A 91 :DEDGYFQKAFKELKVAENDYLEVTLHPVTKAFQDLMYSAV T0365 133 :GLAQQVINELDDLLE 1z72A 147 :GLYLDWGSKDLALPE T0365 149 :GFRGRE 1z72A 162 :VYIHSE T0365 155 :VDFVAKMINELDIIE 1z72A 178 :AEWVQFLVDELNRVG T0365 173 :DDLQIQLRRQLFALESELNPVDVM 1z72A 196 :EDLTELQQRWNQAVALELAFFDIG Number of specific fragments extracted= 9 number of extra gaps= 0 total=5324 Number of alignments=708 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)F197 because last residue in template chain is (1z72A)Y220 T0365 1 :MPVNS 1z72A 4 :QDYAF T0365 10 :FAKSPIKPLQEHMDKVYD 1z72A 9 :QPGLTVGELLKSSQKDWQ T0365 29 :ASLLVPFFEATITGNWDDAV 1z72A 27 :AAINHRFVKELFAGTIENKV T0365 49 :QIRKQISLAEKQGD 1z72A 61 :FLSMLGACVAHADK T0365 120 :PFIAYLQRCIDAVGL 1z72A 91 :DEDGYFQKAFKELKV T0365 135 :AQQVINELDDLLEAGF 1z72A 153 :GSKDLALPEVYIHSEW T0365 151 :RGRE 1z72A 173 :RGPF T0365 155 :VDFVAKMINELDIIE 1z72A 178 :AEWVQFLVDELNRVG T0365 173 :DDLQIQLRRQLFALESELNPVDVM 1z72A 196 :EDLTELQQRWNQAVALELAFFDIG Number of specific fragments extracted= 9 number of extra gaps= 0 total=5333 Number of alignments=709 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E170 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 155 :VDFVAKMINELDIIE 1z72A 178 :AEWVQFLVDELNRVG T0365 173 :DDLQIQLRRQLFALESELNPVD 1z72A 196 :EDLTELQQRWNQAVALELAFFD Number of specific fragments extracted= 2 number of extra gaps= 0 total=5335 Number of alignments=710 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 143 :DDLL 1z72A 86 :GFLE T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQ 1z72A 91 :DEDGYFQKAFKELKVAENDYLEVTLH T0365 179 :LRRQLFALESELNPVDVMFLYKTIEW 1z72A 122 :FQDLMYSAVASSDYAHLLVMLVIAEG Number of specific fragments extracted= 3 number of extra gaps= 0 total=5338 Number of alignments=711 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)T172 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)F197 because last residue in template chain is (1z72A)Y220 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDC 1z72A 4 :QDYAFQPGLTVGELLKSSQKDWQAAINH T0365 34 :PFFEATITGNWDDAV 1z72A 32 :RFVKELFAGTIENKV T0365 49 :QIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQQDKIANKAKDISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGLA 1z72A 74 :KLESKLRFAKQLGFLEADEDGYFQKAFKELKVAENDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALP T0365 138 :VINELDDLLEAGFRGREVDFVAKMINELDIIE 1z72A 161 :EVYIHSEWINLHRGPFFAEWVQFLVDELNRVG T0365 173 :DDLQIQLRRQLFALESELNPVDVM 1z72A 196 :EDLTELQQRWNQAVALELAFFDIG Number of specific fragments extracted= 5 number of extra gaps= 0 total=5343 Number of alignments=712 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYD 1z72A 4 :QDYAFQPGLTVGELLKSSQKDWQAAIN T0365 33 :VPFFEATITGNWDDAV 1z72A 31 :HRFVKELFAGTIENKV T0365 85 :LLELLTQQDKIANKAKDISGRVIGRQLL 1z72A 58 :FDAFLSMLGACVAHADKLESKLRFAKQL T0365 127 :RCIDAVGLAQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQL 1z72A 108 :NDYLEVTLHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALP T0365 194 :DVMF 1z72A 161 :EVYI T0365 198 :LYKTIEWVGGLADLAERV 1z72A 174 :GPFFAEWVQFLVDELNRV T0365 216 :GSRLELMLARV 1z72A 208 :AVALELAFFDI Number of specific fragments extracted= 7 number of extra gaps= 0 total=5350 Number of alignments=713 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 124 :YLQRCIDAVGLAQQVINELDDLLEA 1z72A 57 :FFDAFLSMLGACVAHADKLESKLRF T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQI 1z72A 87 :FLEADEDGYFQKAFKELKVAENDYLEVTL Number of specific fragments extracted= 2 number of extra gaps= 0 total=5352 Number of alignments=714 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 123 :AYLQRCIDAVGLAQQVINELDDLLEA 1z72A 56 :HFFDAFLSMLGACVAHADKLESKLRF T0365 149 :GFRGREVDFVAKMINELDIIEEDTDDLQI 1z72A 87 :FLEADEDGYFQKAFKELKVAENDYLEVTL Number of specific fragments extracted= 2 number of extra gaps= 0 total=5354 Number of alignments=715 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)S217 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)L219 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 203 :EWVGGLADLAERVG 1z72A 179 :EWVQFLVDELNRVG T0365 220 :E 1z72A 196 :E Number of specific fragments extracted= 2 number of extra gaps= 0 total=5356 Number of alignments=716 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 144 :DLLEAGFRGREVDFVAKMINELD 1z72A 170 :NLHRGPFFAEWVQFLVDELNRVG Number of specific fragments extracted= 1 number of extra gaps= 0 total=5357 Number of alignments=717 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)F197 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)Y199 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFM 1z72A 12 :LTVGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLE T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGRQLL 1z72A 90 :ADEDGYFQKAFKELKVAENDYLEVTLHPVT T0365 116 :ALQVPFIAYLQRCIDAVGLAQ 1z72A 120 :KAFQDLMYSAVASSDYAHLLV T0365 138 :VINELDDLLEAG 1z72A 141 :MLVIAEGLYLDW T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFA 1z72A 153 :GSKDLALPEVYIHSEWINLHRGPFFAEWVQFLVD T0365 191 :NPVDVM 1z72A 187 :ELNRVG T0365 200 :KTIEWVGGLADLA 1z72A 196 :EDLTELQQRWNQA T0365 215 :VGSRLELMLAR 1z72A 209 :VALELAFFDIG Number of specific fragments extracted= 8 number of extra gaps= 0 total=5365 Number of alignments=718 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)F197 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)Y199 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVE 1z72A 12 :LTVGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADE T0365 86 :LELLTQQDKIANKAKDISGRVIGRQLL 1z72A 93 :DGYFQKAFKELKVAENDYLEVTLHPVT T0365 116 :ALQVPFIAYLQRCIDAVGLAQ 1z72A 120 :KAFQDLMYSAVASSDYAHLLV T0365 138 :VINELDDLL 1z72A 141 :MLVIAEGLY T0365 148 :AGFRGREVDFVAKMINE 1z72A 150 :LDWGSKDLALPEVYIHS T0365 166 :DIIEEDTDDLQIQLRRQLFA 1z72A 167 :EWINLHRGPFFAEWVQFLVD T0365 191 :NPVDVM 1z72A 187 :ELNRVG T0365 200 :KTIEWVGGLA 1z72A 196 :EDLTELQQRW T0365 212 :AERVGSRLELMLAR 1z72A 206 :NQAVALELAFFDIG Number of specific fragments extracted= 9 number of extra gaps= 0 total=5374 Number of alignments=719 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)G152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)S188 because last residue in template chain is (1z72A)Y220 T0365 3 :VNSILGVFAKS 1z72A 31 :HRFVKELFAGT T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1z72A 43 :ENKVLKDYLIQDYHFFDAFLSMLGACV T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1z72A 72 :ADKLESKLRFAKQLGFLEADEDGYFQKAFKELK T0365 75 :GLFMPVE 1z72A 113 :VTLHPVT T0365 86 :LELLTQQDKIAN 1z72A 120 :KAFQDLMYSAVA T0365 98 :KAKDISGRVIGR 1z72A 135 :YAHLLVMLVIAE T0365 110 :QLLIPQA 1z72A 156 :DLALPEV T0365 119 :VPF 1z72A 163 :YIH T0365 126 :QRCID 1z72A 166 :SEWIN T0365 131 :AVGLAQQVINELDDLL 1z72A 177 :FAEWVQFLVDELNRVG T0365 153 :REVDFVAKMINE 1z72A 196 :EDLTELQQRWNQ T0365 176 :QIQLRRQLFALE 1z72A 208 :AVALELAFFDIG Number of specific fragments extracted= 12 number of extra gaps= 0 total=5386 Number of alignments=720 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)K12 because first residue in template chain is (1z72A)Q4 T0365 13 :S 1z72A 5 :D T0365 14 :PIKP 1z72A 7 :AFQP T0365 35 :FFEATITGNWDDAVQIR 1z72A 13 :TVGELLKSSQKDWQAAI T0365 63 :SLKREIRLT 1z72A 32 :RFVKELFAG T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQL 1z72A 41 :TIENKVLKDYLIQDYHFFDAFLSMLGACVAHAD T0365 114 :PQALQVPFIAYLQRCID 1z72A 74 :KLESKLRFAKQLGFLEA T0365 133 :GLAQQVINEL 1z72A 94 :GYFQKAFKEL T0365 152 :GRE 1z72A 104 :KVA T0365 155 :VDFVA 1z72A 116 :HPVTK T0365 171 :DTDDLQIQLRRQ 1z72A 121 :AFQDLMYSAVAS T0365 188 :S 1z72A 133 :S T0365 191 :NPVDVMFLYKTI 1z72A 134 :DYAHLLVMLVIA T0365 203 :EWVGGLADLAERVG 1z72A 179 :EWVQFLVDELNRVG T0365 217 :SRLELMLAR 1z72A 206 :NQAVALELA Number of specific fragments extracted= 14 number of extra gaps= 0 total=5400 Number of alignments=721 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYFQKAFKELKVAEN T0365 191 :NPVDV 1z72A 109 :DYLEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=5402 Number of alignments=722 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 116 :ALQVPFIAYLQRCIDAV 1z72A 56 :HFFDAFLSMLGACVAHA T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYFQKAFKELKVAEN T0365 191 :NPVDV 1z72A 109 :DYLEV Number of specific fragments extracted= 3 number of extra gaps= 0 total=5405 Number of alignments=723 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)G152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 5 :SILGVFAKS 1z72A 33 :FVKELFAGT T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1z72A 43 :ENKVLKDYLIQDYHFFDAFLSMLGACV T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1z72A 72 :ADKLESKLRFAKQLGFLEADEDGYFQKAFKELK T0365 75 :GLFMPVE 1z72A 113 :VTLHPVT T0365 86 :LELLTQQDKIAN 1z72A 120 :KAFQDLMYSAVA T0365 98 :KAKDISGRVIGR 1z72A 135 :YAHLLVMLVIAE T0365 110 :QLLIPQA 1z72A 156 :DLALPEV T0365 119 :VPF 1z72A 163 :YIH T0365 126 :QRCID 1z72A 166 :SEWIN T0365 131 :AVGLAQQVINELDDLL 1z72A 177 :FAEWVQFLVDELNRVG T0365 153 :REVDFVAKMINEL 1z72A 196 :EDLTELQQRWNQA T0365 177 :IQLRRQLFAL 1z72A 209 :VALELAFFDI Number of specific fragments extracted= 12 number of extra gaps= 0 total=5417 Number of alignments=724 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)G149 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 10 :FAKS 1z72A 38 :FAGT T0365 14 :PIKPLQEH 1z72A 43 :ENKVLKDY T0365 22 :MDKVYDCASLLVPFF 1z72A 58 :FDAFLSMLGACVAHA T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYFQKAFKELK T0365 80 :VERTDLLELLTQQDKIAN 1z72A 114 :TLHPVTKAFQDLMYSAVA T0365 98 :KAKDISGRVIG 1z72A 135 :YAHLLVMLVIA T0365 110 :QLLIPQ 1z72A 156 :DLALPE T0365 118 :QVPFIAYLQ 1z72A 162 :VYIHSEWIN T0365 131 :AVGLAQQVINELDDLL 1z72A 177 :FAEWVQFLVDELNRVG T0365 153 :REVDFVAKMINELDIIE 1z72A 196 :EDLTELQQRWNQAVALE Number of specific fragments extracted= 10 number of extra gaps= 0 total=5427 Number of alignments=725 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)R153 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)V155 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 2 :PVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERT 1z72A 13 :TVGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDG T0365 84 :DLLELLTQQDKIANKA 1z72A 114 :TLHPVTKAFQDLMYSA T0365 100 :KDISGRVIGR 1z72A 133 :SDYAHLLVML T0365 110 :QLLIPQALQVPFIAYLQRCIDAVGLAQQVINELDDL 1z72A 156 :DLALPEVYIHSEWINLHRGPFFAEWVQFLVDELNRV T0365 152 :G 1z72A 192 :G T0365 156 :DFVAKMINELDII 1z72A 196 :EDLTELQQRWNQA T0365 215 :VGSRLELMLAR 1z72A 209 :VALELAFFDIG Number of specific fragments extracted= 7 number of extra gaps= 0 total=5434 Number of alignments=726 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)D210 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)A212 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 3 :VNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSGLFMPVERTDLLELLTQ 1z72A 14 :VGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLGFLEADEDGYFQKAFKE T0365 96 :ANKAKDISGRVIG 1z72A 103 :LKVAENDYLEVTL T0365 115 :QALQVPFIAYLQRCIDAVGLAQQVINE 1z72A 116 :HPVTKAFQDLMYSAVASSDYAHLLVML T0365 142 :LDDLL 1z72A 145 :AEGLY T0365 148 :AGFRGREVDFVAKM 1z72A 150 :LDWGSKDLALPEVY T0365 163 :NELDII 1z72A 164 :IHSEWI T0365 185 :ALES 1z72A 170 :NLHR T0365 191 :NPVDVMFLYKTIEWVGGLA 1z72A 174 :GPFFAEWVQFLVDELNRVG T0365 213 :ER 1z72A 196 :ED T0365 215 :VGSRLELMLAR 1z72A 209 :VALELAFFDIG Number of specific fragments extracted= 10 number of extra gaps= 0 total=5444 Number of alignments=727 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)G152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)S188 because last residue in template chain is (1z72A)Y220 T0365 4 :NSILGVFAKS 1z72A 32 :RFVKELFAGT T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1z72A 43 :ENKVLKDYLIQDYHFFDAFLSMLGACV T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1z72A 72 :ADKLESKLRFAKQLGFLEADEDGYFQKAFKELKV T0365 75 :GLFMPVE 1z72A 113 :VTLHPVT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGR 1z72A 120 :KAFQDLMYSAVASSDYAHLLVMLVIAE T0365 110 :QLLIPQ 1z72A 156 :DLALPE T0365 116 :ALQVPFIAY 1z72A 163 :YIHSEWINL T0365 131 :AVGLAQQVINELDDLL 1z72A 177 :FAEWVQFLVDELNRVG T0365 153 :REVDFVAKMINE 1z72A 196 :EDLTELQQRWNQ T0365 176 :QIQLRRQLFALE 1z72A 208 :AVALELAFFDIG Number of specific fragments extracted= 10 number of extra gaps= 0 total=5454 Number of alignments=728 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)S13 because first residue in template chain is (1z72A)Q4 T0365 14 :PIKP 1z72A 7 :AFQP T0365 35 :FFEATITGNWDDAVQIR 1z72A 13 :TVGELLKSSQKDWQAAI T0365 63 :SLKREIRLT 1z72A 32 :RFVKELFAG T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGR 1z72A 41 :TIENKVLKDYLIQDYHFFDAFLSMLGACVAH T0365 110 :QL 1z72A 73 :DK T0365 115 :QALQVPFIAYLQRCIDAV 1z72A 75 :LESKLRFAKQLGFLEADE T0365 133 :GLAQQVINEL 1z72A 94 :GYFQKAFKEL T0365 152 :GRE 1z72A 104 :KVA T0365 155 :VDFVAKMINELDIIEEDTDDLQ 1z72A 116 :HPVTKAFQDLMYSAVASSDYAH T0365 179 :LRRQLFALES 1z72A 164 :IHSEWINLHR T0365 191 :NPVDVMFLYKTIEWVGGLA 1z72A 174 :GPFFAEWVQFLVDELNRVG T0365 211 :LAERVGSRLELMLAR 1z72A 200 :ELQQRWNQAVALELA Number of specific fragments extracted= 12 number of extra gaps= 0 total=5466 Number of alignments=729 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 117 :LQVPFIAYLQRCIDAVGLAQQVINELDDL 1z72A 47 :LKDYLIQDYHFFDAFLSMLGACVAHADKL T0365 156 :DFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1z72A 76 :ESKLRFAKQLGFLEADEDGYFQKAFKELKVAEN T0365 191 :NPVDVMF 1z72A 109 :DYLEVTL Number of specific fragments extracted= 3 number of extra gaps= 0 total=5469 Number of alignments=730 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 116 :ALQVPFIAYLQRCIDAVG 1z72A 56 :HFFDAFLSMLGACVAHAD T0365 154 :EVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1z72A 74 :KLESKLRFAKQLGFLEADEDGYFQKAFKELKVAEN T0365 191 :NPVDVM 1z72A 109 :DYLEVT Number of specific fragments extracted= 3 number of extra gaps= 0 total=5472 Number of alignments=731 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)G152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 9 :VFAKS 1z72A 37 :LFAGT T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATI 1z72A 43 :ENKVLKDYLIQDYHFFDAFLSMLGACV T0365 41 :TGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPS 1z72A 72 :ADKLESKLRFAKQLGFLEADEDGYFQKAFKELKV T0365 75 :GLFMPVE 1z72A 113 :VTLHPVT T0365 83 :TDLLELLTQQDKIANKAKDISGRVIGR 1z72A 120 :KAFQDLMYSAVASSDYAHLLVMLVIAE T0365 110 :QLLIPQ 1z72A 156 :DLALPE T0365 116 :ALQVPFIAY 1z72A 163 :YIHSEWINL T0365 131 :AVGLAQQVINELDDLL 1z72A 177 :FAEWVQFLVDELNRVG T0365 153 :REVDFVAKMINELD 1z72A 196 :EDLTELQQRWNQAV T0365 178 :QLR 1z72A 210 :ALE Number of specific fragments extracted= 10 number of extra gaps= 0 total=5482 Number of alignments=732 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)E147 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)G149 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 14 :PIKPLQEHMDKVYDCASLLVPFFEATIT 1z72A 43 :ENKVLKDYLIQDYHFFDAFLSMLGACVA T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLP 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYFQKAFKELK T0365 80 :VERTDLLELLTQQDKIAN 1z72A 114 :TLHPVTKAFQDLMYSAVA T0365 101 :DISGRVIG 1z72A 138 :LLVMLVIA T0365 110 :QLLIPQ 1z72A 156 :DLALPE T0365 119 :VPFIAYLQ 1z72A 163 :YIHSEWIN T0365 131 :AVGLAQQVINELDDLL 1z72A 177 :FAEWVQFLVDELNRVG T0365 153 :REVDFVAKMINELDIIE 1z72A 196 :EDLTELQQRWNQAVALE Number of specific fragments extracted= 8 number of extra gaps= 0 total=5490 Number of alignments=733 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)S217 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)L219 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIR 1z72A 12 :LTVGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLR T0365 102 :ISGRVIGRQLLIPQALQVPFIAYLQRCIDAVGL 1z72A 81 :FAKQLGFLEADEDGYFQKAFKELKVAENDYLEV T0365 135 :AQQVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALE 1z72A 115 :LHPVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDLALPEVYIHSE T0365 192 :PVDVMFLYKTIEWVGGLADLAERVG 1z72A 168 :WINLHRGPFFAEWVQFLVDELNRVG T0365 220 :ELML 1z72A 196 :EDLT Number of specific fragments extracted= 5 number of extra gaps= 0 total=5495 Number of alignments=734 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)S217 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)L219 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 T0365 1 :MPVNSILGVFAKSPIKPLQEHMDKVYDCASLLVPFFEATITGNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSG 1z72A 12 :LTVGELLKSSQKDWQAAINHRFVKELFAGTIENKVLKDYLIQDYHFFDAFLSMLGACVAHADKLESKLRFAKQLG T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQ 1z72A 87 :FLEADEDGYFQKAFKELKVAENDYLEVTL T0365 137 :QVINELDDLLEAGFRGREVDFVAKMINELDIIEEDTDDLQI 1z72A 117 :PVTKAFQDLMYSAVASSDYAHLLVMLVIAEGLYLDWGSKDL T0365 179 :LRRQLFALE 1z72A 158 :ALPEVYIHS T0365 191 :NPVDVMFLYKTIEWVGGLADLAERVG 1z72A 167 :EWINLHRGPFFAEWVQFLVDELNRVG T0365 220 :ELML 1z72A 196 :EDLT Number of specific fragments extracted= 6 number of extra gaps= 0 total=5501 Number of alignments=735 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)L7 because first residue in template chain is (1z72A)Q4 Warning: unaligning (T0365)F150 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1z72A)R195 Warning: unaligning (T0365)G152 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1z72A)R195 Warning: unaligning (T0365)S188 because last residue in template chain is (1z72A)Y220 T0365 8 :G 1z72A 5 :D T0365 11 :AKSPI 1z72A 30 :NHRFV T0365 16 :KPLQEHMDKVYDCASLLVPFFEATIT 1z72A 45 :KVLKDYLIQDYHFFDAFLSMLGACVA T0365 42 :GNWDDAVQIRKQISLAEKQGDSLKREIRLTLPSG 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYFQKAFKELKVA T0365 83 :TDLL 1z72A 108 :NDYL T0365 87 :ELLTQQDKIA 1z72A 121 :AFQDLMYSAV T0365 97 :NK 1z72A 134 :DY T0365 99 :AKDISGRVIGRQLLIPQ 1z72A 145 :AEGLYLDWGSKDLALPE T0365 116 :ALQVPFIAY 1z72A 163 :YIHSEWINL T0365 127 :RCIDAVGLAQQVINEL 1z72A 176 :FFAEWVQFLVDELNRV T0365 149 :G 1z72A 192 :G T0365 153 :REVDFVAKMINEL 1z72A 196 :EDLTELQQRWNQA T0365 177 :IQLRRQLFALE 1z72A 209 :VALELAFFDIG Number of specific fragments extracted= 13 number of extra gaps= 0 total=5514 Number of alignments=736 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set Warning: unaligning (T0365)G8 because first residue in template chain is (1z72A)Q4 T0365 9 :VFAKSPIKPLQEHMD 1z72A 5 :DYAFQPGLTVGELLK T0365 42 :GNWDDAVQIR 1z72A 20 :SSQKDWQAAI T0365 63 :SLKREIRLT 1z72A 32 :RFVKELFAG T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQ 1z72A 41 :TIENKVLKDYLIQDYHFFDAFLSMLGACVAHA T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQ 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYF T0365 137 :QVINE 1z72A 98 :KAFKE T0365 148 :AGFRGREV 1z72A 103 :LKVAENDY T0365 156 :DFVAKM 1z72A 117 :PVTKAF T0365 173 :DDLQIQLRRQ 1z72A 123 :QDLMYSAVAS T0365 188 :S 1z72A 133 :S T0365 191 :NPVDVMFLYKTI 1z72A 134 :DYAHLLVMLVIA T0365 203 :EWVGGLADLAERVG 1z72A 179 :EWVQFLVDELNRVG T0365 217 :SRLELMLA 1z72A 203 :QRWNQAVA Number of specific fragments extracted= 13 number of extra gaps= 0 total=5527 Number of alignments=737 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 153 :REVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYFQKAFKELKVAEN T0365 191 :NPVDV 1z72A 109 :DYLEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=5529 Number of alignments=738 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 125 :LQRCIDA 1z72A 65 :LGACVAH T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1z72A 72 :ADKLESKLRFAKQLGFLEADEDGYFQKAFKELKVAEN T0365 191 :NPVDV 1z72A 109 :DYLEV Number of specific fragments extracted= 3 number of extra gaps= 0 total=5532 Number of alignments=739 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 108 :GRQLLIPQALQVPFIAYLQRCIDAVGLAQQVINEL 1z72A 37 :LFAGTIENKVLKDYLIQDYHFFDAFLSMLGACVAH T0365 152 :GREVDFVAKMINELDIIEEDTDDLQIQLRRQLFALES 1z72A 72 :ADKLESKLRFAKQLGFLEADEDGYFQKAFKELKVAEN T0365 189 :ELNPVDVMFLYKTIEWVG 1z72A 114 :TLHPVTKAFQDLMYSAVA Number of specific fragments extracted= 3 number of extra gaps= 0 total=5535 Number of alignments=740 # 1z72A read from 1z72A/merged-a2m # found chain 1z72A in template set T0365 35 :FFEATITGNWDDAVQIR 1z72A 13 :TVGELLKSSQKDWQAAI T0365 63 :SLKREIRLT 1z72A 32 :RFVKELFAG T0365 79 :PVERTDLLELLTQQDKIANKAKDISGRVIGRQ 1z72A 41 :TIENKVLKDYLIQDYHFFDAFLSMLGACVAHA T0365 113 :IPQALQVPFIAYLQRCIDAVGLAQ 1z72A 73 :DKLESKLRFAKQLGFLEADEDGYF T0365 137 :QVINE 1z72A 98 :KAFKE T0365 148 :AGFRGREV 1z72A 103 :LKVAENDY T0365 156 :DF 1z72A 117 :PV T0365 169 :EEDTDDLQIQLRRQ 1z72A 119 :TKAFQDLMYSAVAS T0365 188 :S 1z72A 133 :S T0365 191 :NPVDVMFLYKTI 1z72A 134 :DYAHLLVMLVIA T0365 203 :EWVG 1z72A 167 :EWIN T0365 207 :GLADLAERVGSRLELM 1z72A 176 :FFAEWVQFLVDELNRV Number of specific fragments extracted= 12 number of extra gaps= 0 total=5547 Number of alignments=741 # command:NUMB_ALIGNS: 741 evalue: 0 0.0000, weight 12.7865 evalue: 1 0.0001, weight 9.3929 evalue: 2 0.0218, weight 4.3804 evalue: 3 0.2226, weight 2.1655 evalue: 4 0.2697, weight 1.9977 evalue: 5 0.7915, weight 1.1540 evalue: 6 1.1613, weight 0.9081 evalue: 7 2.1795, weight 0.5813 evalue: 8 2.2410, weight 0.5691 evalue: 9 2.6717, weight 0.4966 evalue: 10 0.0000, weight 19.3046 evalue: 11 0.0000, weight 15.9824 evalue: 12 0.0158, weight 4.6969 evalue: 13 0.5521, weight 1.4140 evalue: 14 1.2504, weight 0.8647 evalue: 15 1.5300, weight 0.7529 evalue: 16 2.0262, weight 0.6141 evalue: 17 2.3025, weight 0.5575 evalue: 18 2.4266, weight 0.5354 evalue: 19 2.7065, weight 0.4916 evalue: 20 0.0002, weight 9.2820 evalue: 21 0.0051, weight 5.8223 evalue: 22 0.1884, weight 2.3145 evalue: 23 1.5799, weight 0.7360 evalue: 24 2.7204, weight 0.4896 evalue: 25 2.9911, weight 0.4539 evalue: 26 3.1356, weight 0.4370 evalue: 27 3.6747, weight 0.3836 evalue: 28 3.6852, weight 0.3827 evalue: 29 4.8701, weight 0.3022 evalue: 30 0.0000, weight 13.5515 evalue: 31 0.0001, weight 10.1570 evalue: 32 0.1899, weight 2.3073 evalue: 33 0.6539, weight 1.2886 evalue: 34 0.6581, weight 1.2840 evalue: 35 1.8098, weight 0.6675 evalue: 36 2.8053, weight 0.4778 evalue: 37 4.3053, weight 0.3358 evalue: 38 4.8062, weight 0.3057 evalue: 39 5.0465, weight 0.2930 evalue: 40 6.7282, weight 0.2274 evalue: 41 6.7282, weight 0.2274 evalue: 42 6.7282, weight 0.2274 evalue: 43 6.7282, weight 0.2274 evalue: 44 6.7282, weight 0.2274 evalue: 45 6.7282, weight 0.2274 evalue: 46 6.7282, weight 0.2274 evalue: 47 6.7282, weight 0.2274 evalue: 48 6.7282, weight 0.2274 evalue: 49 6.7282, weight 0.2274 evalue: 50 6.7282, weight 0.2274 evalue: 51 6.7282, weight 0.2274 evalue: 52 6.7282, weight 0.2274 evalue: 53 6.7282, weight 0.2274 evalue: 54 6.7282, weight 0.2274 evalue: 55 6.7282, weight 0.2274 evalue: 56 6.7282, weight 0.2274 evalue: 57 6.7282, weight 0.2274 evalue: 58 6.7282, weight 0.2274 evalue: 59 6.7282, weight 0.2274 evalue: 60 6.7282, weight 0.2274 evalue: 61 6.7282, weight 0.2274 evalue: 62 6.7282, weight 0.2274 evalue: 63 6.7282, weight 0.2274 evalue: 64 6.7282, weight 0.2274 evalue: 65 6.7282, weight 0.2274 evalue: 66 6.7282, weight 0.2274 evalue: 67 6.7282, weight 0.2274 evalue: 68 6.7282, weight 0.2274 evalue: 69 6.7282, weight 0.2274 evalue: 70 6.7282, weight 0.2274 evalue: 71 6.7282, weight 0.2274 evalue: 72 6.7282, weight 0.2274 evalue: 73 6.7282, weight 0.2274 evalue: 74 6.8461, weight 0.2239 evalue: 75 6.8461, weight 0.2239 evalue: 76 6.8461, weight 0.2239 evalue: 77 6.8461, weight 0.2239 evalue: 78 6.8461, weight 0.2239 evalue: 79 6.8461, weight 0.2239 evalue: 80 6.8461, weight 0.2239 evalue: 81 6.8461, weight 0.2239 evalue: 82 6.8461, weight 0.2239 evalue: 83 6.8461, weight 0.2239 evalue: 84 6.8461, weight 0.2239 evalue: 85 6.8461, weight 0.2239 evalue: 86 6.8461, weight 0.2239 evalue: 87 6.8461, weight 0.2239 evalue: 88 6.8461, weight 0.2239 evalue: 89 6.8461, weight 0.2239 evalue: 90 6.8461, weight 0.2239 evalue: 91 6.8461, weight 0.2239 evalue: 92 6.8461, weight 0.2239 evalue: 93 6.8461, weight 0.2239 evalue: 94 6.8461, weight 0.2239 evalue: 95 6.8461, weight 0.2239 evalue: 96 6.8461, weight 0.2239 evalue: 97 6.8461, weight 0.2239 evalue: 98 6.8461, weight 0.2239 evalue: 99 6.8461, weight 0.2239 evalue: 100 6.8461, weight 0.2239 evalue: 101 6.8461, weight 0.2239 evalue: 102 6.8461, weight 0.2239 evalue: 103 6.8461, weight 0.2239 evalue: 104 6.8461, weight 0.2239 evalue: 105 6.8461, weight 0.2239 evalue: 106 6.8461, weight 0.2239 evalue: 107 0.6581, weight 1.2840 evalue: 108 0.6581, weight 1.2840 evalue: 109 0.6581, weight 1.2840 evalue: 110 0.6581, weight 1.2840 evalue: 111 0.6581, weight 1.2840 evalue: 112 0.6581, weight 1.2840 evalue: 113 0.6581, weight 1.2840 evalue: 114 0.6581, weight 1.2840 evalue: 115 0.6581, weight 1.2840 evalue: 116 0.6581, weight 1.2840 evalue: 117 0.6581, weight 1.2840 evalue: 118 0.6581, weight 1.2840 evalue: 119 0.6581, weight 1.2840 evalue: 120 0.6581, weight 1.2840 evalue: 121 0.6581, weight 1.2840 evalue: 122 0.6581, weight 1.2840 evalue: 123 0.6581, weight 1.2840 evalue: 124 0.6581, weight 1.2840 evalue: 125 0.6581, weight 1.2840 evalue: 126 0.6581, weight 1.2840 evalue: 127 0.6581, weight 1.2840 evalue: 128 0.6581, weight 1.2840 evalue: 129 0.6581, weight 1.2840 evalue: 130 0.6581, weight 1.2840 evalue: 131 0.6581, weight 1.2840 evalue: 132 0.6581, weight 1.2840 evalue: 133 0.6581, weight 1.2840 evalue: 134 0.6581, weight 1.2840 evalue: 135 0.6581, weight 1.2840 evalue: 136 0.6581, weight 1.2840 evalue: 137 0.6581, weight 1.2840 evalue: 138 0.6581, weight 1.2840 evalue: 139 0.6581, weight 1.2840 evalue: 140 8.4418, weight 0.1853 evalue: 141 8.4418, weight 0.1853 evalue: 142 8.4418, weight 0.1853 evalue: 143 8.4418, weight 0.1853 evalue: 144 8.4418, weight 0.1853 evalue: 145 8.4418, weight 0.1853 evalue: 146 8.4418, weight 0.1853 evalue: 147 8.4418, weight 0.1853 evalue: 148 8.4418, weight 0.1853 evalue: 149 8.4418, weight 0.1853 evalue: 150 8.4418, weight 0.1853 evalue: 151 8.4418, weight 0.1853 evalue: 152 8.4418, weight 0.1853 evalue: 153 8.4418, weight 0.1853 evalue: 154 8.4418, weight 0.1853 evalue: 155 8.4418, weight 0.1853 evalue: 156 8.4418, weight 0.1853 evalue: 157 8.4418, weight 0.1853 evalue: 158 8.4418, weight 0.1853 evalue: 159 8.4418, weight 0.1853 evalue: 160 8.4418, weight 0.1853 evalue: 161 8.4418, weight 0.1853 evalue: 162 8.4418, weight 0.1853 evalue: 163 8.4418, weight 0.1853 evalue: 164 8.4418, weight 0.1853 evalue: 165 8.4418, weight 0.1853 evalue: 166 8.4418, weight 0.1853 evalue: 167 8.4418, weight 0.1853 evalue: 168 8.4418, weight 0.1853 evalue: 169 8.4418, weight 0.1853 evalue: 170 0.1899, weight 2.3073 evalue: 171 0.1899, weight 2.3073 evalue: 172 0.1899, weight 2.3073 evalue: 173 0.1899, weight 2.3073 evalue: 174 0.1899, weight 2.3073 evalue: 175 0.1899, weight 2.3073 evalue: 176 0.1899, weight 2.3073 evalue: 177 0.1899, weight 2.3073 evalue: 178 0.1899, weight 2.3073 evalue: 179 0.1899, weight 2.3073 evalue: 180 0.1899, weight 2.3073 evalue: 181 0.1899, weight 2.3073 evalue: 182 0.1899, weight 2.3073 evalue: 183 0.1899, weight 2.3073 evalue: 184 0.1899, weight 2.3073 evalue: 185 0.1899, weight 2.3073 evalue: 186 0.1899, weight 2.3073 evalue: 187 0.1899, weight 2.3073 evalue: 188 0.1899, weight 2.3073 evalue: 189 0.1899, weight 2.3073 evalue: 190 0.1899, weight 2.3073 evalue: 191 0.1899, weight 2.3073 evalue: 192 0.1899, weight 2.3073 evalue: 193 0.1899, weight 2.3073 evalue: 194 0.1899, weight 2.3073 evalue: 195 0.1899, weight 2.3073 evalue: 196 0.1899, weight 2.3073 evalue: 197 0.1899, weight 2.3073 evalue: 198 0.1899, weight 2.3073 evalue: 199 0.1899, weight 2.3073 evalue: 200 0.1899, weight 2.3073 evalue: 201 0.1899, weight 2.3073 evalue: 202 0.1899, weight 2.3073 evalue: 203 0.1899, weight 2.3073 evalue: 204 0.1899, weight 2.3073 evalue: 205 0.1899, weight 2.3073 evalue: 206 5.6807, weight 0.2643 evalue: 207 5.6807, weight 0.2643 evalue: 208 5.6807, weight 0.2643 evalue: 209 5.6807, weight 0.2643 evalue: 210 5.6807, weight 0.2643 evalue: 211 5.6807, weight 0.2643 evalue: 212 5.6807, weight 0.2643 evalue: 213 5.6807, weight 0.2643 evalue: 214 5.6807, weight 0.2643 evalue: 215 5.6807, weight 0.2643 evalue: 216 5.6807, weight 0.2643 evalue: 217 5.6807, weight 0.2643 evalue: 218 5.6807, weight 0.2643 evalue: 219 5.6807, weight 0.2643 evalue: 220 5.6807, weight 0.2643 evalue: 221 5.6807, weight 0.2643 evalue: 222 5.6807, weight 0.2643 evalue: 223 5.6807, weight 0.2643 evalue: 224 5.6807, weight 0.2643 evalue: 225 5.6807, weight 0.2643 evalue: 226 5.6807, weight 0.2643 evalue: 227 5.6807, weight 0.2643 evalue: 228 5.6807, weight 0.2643 evalue: 229 5.6807, weight 0.2643 evalue: 230 5.6807, weight 0.2643 evalue: 231 5.6807, weight 0.2643 evalue: 232 5.6807, weight 0.2643 evalue: 233 5.6807, weight 0.2643 evalue: 234 5.6807, weight 0.2643 evalue: 235 5.6807, weight 0.2643 evalue: 236 5.6807, weight 0.2643 evalue: 237 5.6807, weight 0.2643 evalue: 238 5.6807, weight 0.2643 evalue: 239 5.6807, weight 0.2643 evalue: 240 5.0465, weight 0.2930 evalue: 241 5.0465, weight 0.2930 evalue: 242 5.0465, weight 0.2930 evalue: 243 5.0465, weight 0.2930 evalue: 244 5.0465, weight 0.2930 evalue: 245 5.0465, weight 0.2930 evalue: 246 5.0465, weight 0.2930 evalue: 247 5.0465, weight 0.2930 evalue: 248 5.0465, weight 0.2930 evalue: 249 5.0465, weight 0.2930 evalue: 250 5.0465, weight 0.2930 evalue: 251 5.0465, weight 0.2930 evalue: 252 5.0465, weight 0.2930 evalue: 253 5.0465, weight 0.2930 evalue: 254 5.0465, weight 0.2930 evalue: 255 5.0465, weight 0.2930 evalue: 256 5.0465, weight 0.2930 evalue: 257 5.0465, weight 0.2930 evalue: 258 5.0465, weight 0.2930 evalue: 259 5.0465, weight 0.2930 evalue: 260 5.0465, weight 0.2930 evalue: 261 5.0465, weight 0.2930 evalue: 262 5.0465, weight 0.2930 evalue: 263 5.0465, weight 0.2930 evalue: 264 5.0465, weight 0.2930 evalue: 265 5.0465, weight 0.2930 evalue: 266 5.0465, weight 0.2930 evalue: 267 5.0465, weight 0.2930 evalue: 268 5.0465, weight 0.2930 evalue: 269 5.0465, weight 0.2930 evalue: 270 5.0465, weight 0.2930 evalue: 271 5.0465, weight 0.2930 evalue: 272 5.0465, weight 0.2930 evalue: 273 0.6539, weight 1.2886 evalue: 274 0.6539, weight 1.2886 evalue: 275 0.6539, weight 1.2886 evalue: 276 0.6539, weight 1.2886 evalue: 277 0.6539, weight 1.2886 evalue: 278 0.6539, weight 1.2886 evalue: 279 0.6539, weight 1.2886 evalue: 280 0.6539, weight 1.2886 evalue: 281 0.6539, weight 1.2886 evalue: 282 0.6539, weight 1.2886 evalue: 283 0.6539, weight 1.2886 evalue: 284 0.6539, weight 1.2886 evalue: 285 0.6539, weight 1.2886 evalue: 286 0.6539, weight 1.2886 evalue: 287 0.6539, weight 1.2886 evalue: 288 0.6539, weight 1.2886 evalue: 289 0.6539, weight 1.2886 evalue: 290 0.6539, weight 1.2886 evalue: 291 0.6539, weight 1.2886 evalue: 292 0.6539, weight 1.2886 evalue: 293 0.6539, weight 1.2886 evalue: 294 0.6539, weight 1.2886 evalue: 295 0.6539, weight 1.2886 evalue: 296 0.6539, weight 1.2886 evalue: 297 0.6539, weight 1.2886 evalue: 298 0.6539, weight 1.2886 evalue: 299 0.6539, weight 1.2886 evalue: 300 0.6539, weight 1.2886 evalue: 301 0.6539, weight 1.2886 evalue: 302 0.6539, weight 1.2886 evalue: 303 0.6539, weight 1.2886 evalue: 304 0.6539, weight 1.2886 evalue: 305 0.6539, weight 1.2886 evalue: 306 0.6539, weight 1.2886 evalue: 307 0.6539, weight 1.2886 evalue: 308 0.6539, weight 1.2886 evalue: 309 0.6539, weight 1.2886 evalue: 310 5.3692, weight 0.2777 evalue: 311 5.3692, weight 0.2777 evalue: 312 5.3692, weight 0.2777 evalue: 313 5.3692, weight 0.2777 evalue: 314 5.3692, weight 0.2777 evalue: 315 5.3692, weight 0.2777 evalue: 316 5.3692, weight 0.2777 evalue: 317 5.3692, weight 0.2777 evalue: 318 5.3692, weight 0.2777 evalue: 319 5.3692, weight 0.2777 evalue: 320 5.3692, weight 0.2777 evalue: 321 5.3692, weight 0.2777 evalue: 322 5.3692, weight 0.2777 evalue: 323 5.3692, weight 0.2777 evalue: 324 5.3692, weight 0.2777 evalue: 325 5.3692, weight 0.2777 evalue: 326 5.3692, weight 0.2777 evalue: 327 5.3692, weight 0.2777 evalue: 328 5.3692, weight 0.2777 evalue: 329 5.3692, weight 0.2777 evalue: 330 5.3692, weight 0.2777 evalue: 331 5.3692, weight 0.2777 evalue: 332 5.3692, weight 0.2777 evalue: 333 5.3692, weight 0.2777 evalue: 334 5.3692, weight 0.2777 evalue: 335 5.3692, weight 0.2777 evalue: 336 5.3692, weight 0.2777 evalue: 337 5.3692, weight 0.2777 evalue: 338 5.3692, weight 0.2777 evalue: 339 5.3692, weight 0.2777 evalue: 340 5.3692, weight 0.2777 evalue: 341 5.3692, weight 0.2777 evalue: 342 5.3692, weight 0.2777 evalue: 343 5.3692, weight 0.2777 evalue: 344 0.0001, weight 10.1570 evalue: 345 0.0001, weight 10.1570 evalue: 346 0.0001, weight 10.1570 evalue: 347 0.0001, weight 10.1570 evalue: 348 0.0001, weight 10.1570 evalue: 349 0.0001, weight 10.1570 evalue: 350 0.0001, weight 10.1570 evalue: 351 0.0001, weight 10.1570 evalue: 352 0.0001, weight 10.1570 evalue: 353 0.0001, weight 10.1570 evalue: 354 0.0001, weight 10.1570 evalue: 355 0.0001, weight 10.1570 evalue: 356 0.0001, weight 10.1570 evalue: 357 0.0001, weight 10.1570 evalue: 358 0.0001, weight 10.1570 evalue: 359 0.0001, weight 10.1570 evalue: 360 0.0001, weight 10.1570 evalue: 361 0.0001, weight 10.1570 evalue: 362 0.0001, weight 10.1570 evalue: 363 0.0001, weight 10.1570 evalue: 364 0.0001, weight 10.1570 evalue: 365 0.0001, weight 10.1570 evalue: 366 0.0001, weight 10.1570 evalue: 367 0.0001, weight 10.1570 evalue: 368 0.0001, weight 10.1570 evalue: 369 0.0001, weight 10.1570 evalue: 370 0.0001, weight 10.1570 evalue: 371 0.0001, weight 10.1570 evalue: 372 0.0001, weight 10.1570 evalue: 373 0.0001, weight 10.1570 evalue: 374 0.0001, weight 10.1570 evalue: 375 0.0001, weight 10.1570 evalue: 376 0.0001, weight 10.1570 evalue: 377 0.0001, weight 10.1570 evalue: 378 0.0001, weight 10.1570 evalue: 379 0.0001, weight 10.1570 evalue: 380 7.6030, weight 0.2038 evalue: 381 7.6030, weight 0.2038 evalue: 382 7.6030, weight 0.2038 evalue: 383 7.6030, weight 0.2038 evalue: 384 7.6030, weight 0.2038 evalue: 385 7.6030, weight 0.2038 evalue: 386 7.6030, weight 0.2038 evalue: 387 7.6030, weight 0.2038 evalue: 388 7.6030, weight 0.2038 evalue: 389 7.6030, weight 0.2038 evalue: 390 7.6030, weight 0.2038 evalue: 391 7.6030, weight 0.2038 evalue: 392 7.6030, weight 0.2038 evalue: 393 7.6030, weight 0.2038 evalue: 394 7.6030, weight 0.2038 evalue: 395 7.6030, weight 0.2038 evalue: 396 7.6030, weight 0.2038 evalue: 397 7.6030, weight 0.2038 evalue: 398 7.6030, weight 0.2038 evalue: 399 7.6030, weight 0.2038 evalue: 400 7.6030, weight 0.2038 evalue: 401 7.6030, weight 0.2038 evalue: 402 7.6030, weight 0.2038 evalue: 403 7.6030, weight 0.2038 evalue: 404 7.6030, weight 0.2038 evalue: 405 7.6030, weight 0.2038 evalue: 406 7.6030, weight 0.2038 evalue: 407 7.6030, weight 0.2038 evalue: 408 7.6030, weight 0.2038 evalue: 409 7.6030, weight 0.2038 evalue: 410 7.6030, weight 0.2038 evalue: 411 7.6030, weight 0.2038 evalue: 412 10.2540, weight 0.1549 evalue: 413 10.2540, weight 0.1549 evalue: 414 10.2540, weight 0.1549 evalue: 415 10.2540, weight 0.1549 evalue: 416 10.2540, weight 0.1549 evalue: 417 10.2540, weight 0.1549 evalue: 418 10.2540, weight 0.1549 evalue: 419 10.2540, weight 0.1549 evalue: 420 10.2540, weight 0.1549 evalue: 421 10.2540, weight 0.1549 evalue: 422 10.2540, weight 0.1549 evalue: 423 10.2540, weight 0.1549 evalue: 424 10.2540, weight 0.1549 evalue: 425 10.2540, weight 0.1549 evalue: 426 10.2540, weight 0.1549 evalue: 427 10.2540, weight 0.1549 evalue: 428 10.2540, weight 0.1549 evalue: 429 10.2540, weight 0.1549 evalue: 430 10.2540, weight 0.1549 evalue: 431 10.2540, weight 0.1549 evalue: 432 10.2540, weight 0.1549 evalue: 433 10.2540, weight 0.1549 evalue: 434 10.2540, weight 0.1549 evalue: 435 10.2540, weight 0.1549 evalue: 436 10.2540, weight 0.1549 evalue: 437 10.2540, weight 0.1549 evalue: 438 10.2540, weight 0.1549 evalue: 439 10.2540, weight 0.1549 evalue: 440 10.2540, weight 0.1549 evalue: 441 10.2540, weight 0.1549 evalue: 442 10.2540, weight 0.1549 evalue: 443 10.2540, weight 0.1549 evalue: 444 10.2540, weight 0.1549 evalue: 445 10.2540, weight 0.1549 evalue: 446 4.8062, weight 0.3057 evalue: 447 4.8062, weight 0.3057 evalue: 448 4.8062, weight 0.3057 evalue: 449 4.8062, weight 0.3057 evalue: 450 4.8062, weight 0.3057 evalue: 451 4.8062, weight 0.3057 evalue: 452 4.8062, weight 0.3057 evalue: 453 4.8062, weight 0.3057 evalue: 454 4.8062, weight 0.3057 evalue: 455 4.8062, weight 0.3057 evalue: 456 4.8062, weight 0.3057 evalue: 457 4.8062, weight 0.3057 evalue: 458 4.8062, weight 0.3057 evalue: 459 4.8062, weight 0.3057 evalue: 460 4.8062, weight 0.3057 evalue: 461 4.8062, weight 0.3057 evalue: 462 4.8062, weight 0.3057 evalue: 463 4.8062, weight 0.3057 evalue: 464 4.8062, weight 0.3057 evalue: 465 4.8062, weight 0.3057 evalue: 466 4.8062, weight 0.3057 evalue: 467 4.8062, weight 0.3057 evalue: 468 4.8062, weight 0.3057 evalue: 469 4.8062, weight 0.3057 evalue: 470 4.8062, weight 0.3057 evalue: 471 4.8062, weight 0.3057 evalue: 472 4.8062, weight 0.3057 evalue: 473 4.8062, weight 0.3057 evalue: 474 4.8062, weight 0.3057 evalue: 475 4.8062, weight 0.3057 evalue: 476 4.8062, weight 0.3057 evalue: 477 4.8062, weight 0.3057 evalue: 478 4.8062, weight 0.3057 evalue: 479 4.8062, weight 0.3057 evalue: 480 4.3053, weight 0.3358 evalue: 481 4.3053, weight 0.3358 evalue: 482 4.3053, weight 0.3358 evalue: 483 4.3053, weight 0.3358 evalue: 484 4.3053, weight 0.3358 evalue: 485 4.3053, weight 0.3358 evalue: 486 4.3053, weight 0.3358 evalue: 487 4.3053, weight 0.3358 evalue: 488 4.3053, weight 0.3358 evalue: 489 4.3053, weight 0.3358 evalue: 490 4.3053, weight 0.3358 evalue: 491 4.3053, weight 0.3358 evalue: 492 4.3053, weight 0.3358 evalue: 493 4.3053, weight 0.3358 evalue: 494 4.3053, weight 0.3358 evalue: 495 4.3053, weight 0.3358 evalue: 496 4.3053, weight 0.3358 evalue: 497 4.3053, weight 0.3358 evalue: 498 4.3053, weight 0.3358 evalue: 499 4.3053, weight 0.3358 evalue: 500 4.3053, weight 0.3358 evalue: 501 4.3053, weight 0.3358 evalue: 502 4.3053, weight 0.3358 evalue: 503 4.3053, weight 0.3358 evalue: 504 4.3053, weight 0.3358 evalue: 505 4.3053, weight 0.3358 evalue: 506 4.3053, weight 0.3358 evalue: 507 4.3053, weight 0.3358 evalue: 508 4.3053, weight 0.3358 evalue: 509 4.3053, weight 0.3358 evalue: 510 4.3053, weight 0.3358 evalue: 511 4.3053, weight 0.3358 evalue: 512 4.3053, weight 0.3358 evalue: 513 4.3053, weight 0.3358 evalue: 514 4.3053, weight 0.3358 evalue: 515 4.3053, weight 0.3358 evalue: 516 2.8053, weight 0.4778 evalue: 517 2.8053, weight 0.4778 evalue: 518 2.8053, weight 0.4778 evalue: 519 2.8053, weight 0.4778 evalue: 520 2.8053, weight 0.4778 evalue: 521 2.8053, weight 0.4778 evalue: 522 2.8053, weight 0.4778 evalue: 523 2.8053, weight 0.4778 evalue: 524 2.8053, weight 0.4778 evalue: 525 2.8053, weight 0.4778 evalue: 526 2.8053, weight 0.4778 evalue: 527 2.8053, weight 0.4778 evalue: 528 2.8053, weight 0.4778 evalue: 529 2.8053, weight 0.4778 evalue: 530 2.8053, weight 0.4778 evalue: 531 2.8053, weight 0.4778 evalue: 532 2.8053, weight 0.4778 evalue: 533 2.8053, weight 0.4778 evalue: 534 2.8053, weight 0.4778 evalue: 535 2.8053, weight 0.4778 evalue: 536 2.8053, weight 0.4778 evalue: 537 2.8053, weight 0.4778 evalue: 538 2.8053, weight 0.4778 evalue: 539 2.8053, weight 0.4778 evalue: 540 2.8053, weight 0.4778 evalue: 541 2.8053, weight 0.4778 evalue: 542 2.8053, weight 0.4778 evalue: 543 2.8053, weight 0.4778 evalue: 544 2.8053, weight 0.4778 evalue: 545 2.8053, weight 0.4778 evalue: 546 2.8053, weight 0.4778 evalue: 547 2.8053, weight 0.4778 evalue: 548 2.8053, weight 0.4778 evalue: 549 2.8053, weight 0.4778 evalue: 550 2.8053, weight 0.4778 evalue: 551 2.8053, weight 0.4778 evalue: 552 7.4863, weight 0.2066 evalue: 553 7.4863, weight 0.2066 evalue: 554 7.4863, weight 0.2066 evalue: 555 7.4863, weight 0.2066 evalue: 556 7.4863, weight 0.2066 evalue: 557 7.4863, weight 0.2066 evalue: 558 7.4863, weight 0.2066 evalue: 559 7.4863, weight 0.2066 evalue: 560 7.4863, weight 0.2066 evalue: 561 7.4863, weight 0.2066 evalue: 562 7.4863, weight 0.2066 evalue: 563 7.4863, weight 0.2066 evalue: 564 7.4863, weight 0.2066 evalue: 565 8.3111, weight 0.1879 evalue: 566 8.3111, weight 0.1879 evalue: 567 8.3111, weight 0.1879 evalue: 568 8.3111, weight 0.1879 evalue: 569 8.3111, weight 0.1879 evalue: 570 8.3111, weight 0.1879 evalue: 571 8.3111, weight 0.1879 evalue: 572 8.3111, weight 0.1879 evalue: 573 8.3111, weight 0.1879 evalue: 574 8.3111, weight 0.1879 evalue: 575 8.3111, weight 0.1879 evalue: 576 8.3111, weight 0.1879 evalue: 577 8.3111, weight 0.1879 evalue: 578 8.3111, weight 0.1879 evalue: 579 8.3111, weight 0.1879 evalue: 580 8.3111, weight 0.1879 evalue: 581 8.3111, weight 0.1879 evalue: 582 8.3111, weight 0.1879 evalue: 583 8.3111, weight 0.1879 evalue: 584 8.3111, weight 0.1879 evalue: 585 8.3111, weight 0.1879 evalue: 586 8.3111, weight 0.1879 evalue: 587 8.3111, weight 0.1879 evalue: 588 8.3111, weight 0.1879 evalue: 589 8.3111, weight 0.1879 evalue: 590 8.3111, weight 0.1879 evalue: 591 8.3111, weight 0.1879 evalue: 592 8.3111, weight 0.1879 evalue: 593 8.3111, weight 0.1879 evalue: 594 8.3111, weight 0.1879 evalue: 595 8.3111, weight 0.1879 evalue: 596 8.3111, weight 0.1879 evalue: 597 8.3111, weight 0.1879 evalue: 598 8.3111, weight 0.1879 evalue: 599 1.8098, weight 0.6675 evalue: 600 1.8098, weight 0.6675 evalue: 601 1.8098, weight 0.6675 evalue: 602 1.8098, weight 0.6675 evalue: 603 1.8098, weight 0.6675 evalue: 604 1.8098, weight 0.6675 evalue: 605 1.8098, weight 0.6675 evalue: 606 1.8098, weight 0.6675 evalue: 607 1.8098, weight 0.6675 evalue: 608 1.8098, weight 0.6675 evalue: 609 1.8098, weight 0.6675 evalue: 610 1.8098, weight 0.6675 evalue: 611 1.8098, weight 0.6675 evalue: 612 1.8098, weight 0.6675 evalue: 613 1.8098, weight 0.6675 evalue: 614 1.8098, weight 0.6675 evalue: 615 1.8098, weight 0.6675 evalue: 616 1.8098, weight 0.6675 evalue: 617 1.8098, weight 0.6675 evalue: 618 1.8098, weight 0.6675 evalue: 619 1.8098, weight 0.6675 evalue: 620 1.8098, weight 0.6675 evalue: 621 1.8098, weight 0.6675 evalue: 622 1.8098, weight 0.6675 evalue: 623 1.8098, weight 0.6675 evalue: 624 1.8098, weight 0.6675 evalue: 625 1.8098, weight 0.6675 evalue: 626 1.8098, weight 0.6675 evalue: 627 1.8098, weight 0.6675 evalue: 628 1.8098, weight 0.6675 evalue: 629 1.8098, weight 0.6675 evalue: 630 1.8098, weight 0.6675 evalue: 631 1.8098, weight 0.6675 evalue: 632 7.3224, weight 0.2108 evalue: 633 7.3224, weight 0.2108 evalue: 634 7.3224, weight 0.2108 evalue: 635 7.3224, weight 0.2108 evalue: 636 7.3224, weight 0.2108 evalue: 637 7.3224, weight 0.2108 evalue: 638 7.3224, weight 0.2108 evalue: 639 7.3224, weight 0.2108 evalue: 640 7.3224, weight 0.2108 evalue: 641 7.3224, weight 0.2108 evalue: 642 7.3224, weight 0.2108 evalue: 643 7.3224, weight 0.2108 evalue: 644 7.3224, weight 0.2108 evalue: 645 7.3224, weight 0.2108 evalue: 646 7.3224, weight 0.2108 evalue: 647 7.3224, weight 0.2108 evalue: 648 7.3224, weight 0.2108 evalue: 649 7.3224, weight 0.2108 evalue: 650 7.3224, weight 0.2108 evalue: 651 7.3224, weight 0.2108 evalue: 652 7.3224, weight 0.2108 evalue: 653 7.3224, weight 0.2108 evalue: 654 7.3224, weight 0.2108 evalue: 655 7.3224, weight 0.2108 evalue: 656 7.3224, weight 0.2108 evalue: 657 7.3224, weight 0.2108 evalue: 658 7.3224, weight 0.2108 evalue: 659 7.3224, weight 0.2108 evalue: 660 7.3224, weight 0.2108 evalue: 661 7.3224, weight 0.2108 evalue: 662 7.3224, weight 0.2108 evalue: 663 7.3224, weight 0.2108 evalue: 664 7.3224, weight 0.2108 evalue: 665 7.3224, weight 0.2108 evalue: 666 7.3224, weight 0.2108 evalue: 667 0.0000, weight 13.5515 evalue: 668 0.0000, weight 13.5515 evalue: 669 0.0000, weight 13.5515 evalue: 670 0.0000, weight 13.5515 evalue: 671 0.0000, weight 13.5515 evalue: 672 0.0000, weight 13.5515 evalue: 673 0.0000, weight 13.5515 evalue: 674 0.0000, weight 13.5515 evalue: 675 0.0000, weight 13.5515 evalue: 676 0.0000, weight 13.5515 evalue: 677 0.0000, weight 13.5515 evalue: 678 0.0000, weight 13.5515 evalue: 679 0.0000, weight 13.5515 evalue: 680 0.0000, weight 13.5515 evalue: 681 0.0000, weight 13.5515 evalue: 682 0.0000, weight 13.5515 evalue: 683 0.0000, weight 13.5515 evalue: 684 0.0000, weight 13.5515 evalue: 685 0.0000, weight 13.5515 evalue: 686 0.0000, weight 13.5515 evalue: 687 0.0000, weight 13.5515 evalue: 688 0.0000, weight 13.5515 evalue: 689 0.0000, weight 13.5515 evalue: 690 0.0000, weight 13.5515 evalue: 691 0.0000, weight 13.5515 evalue: 692 0.0000, weight 13.5515 evalue: 693 0.0000, weight 13.5515 evalue: 694 0.0000, weight 13.5515 evalue: 695 0.0000, weight 13.5515 evalue: 696 0.0000, weight 13.5515 evalue: 697 0.0000, weight 13.5515 evalue: 698 0.0000, weight 13.5515 evalue: 699 0.0000, weight 13.5515 evalue: 700 0.0000, weight 13.5515 evalue: 701 0.0000, weight 13.5515 evalue: 702 0.0000, weight 13.5515 evalue: 703 8.0012, weight 0.1945 evalue: 704 8.0012, weight 0.1945 evalue: 705 8.0012, weight 0.1945 evalue: 706 8.0012, weight 0.1945 evalue: 707 8.0012, weight 0.1945 evalue: 708 8.0012, weight 0.1945 evalue: 709 8.0012, weight 0.1945 evalue: 710 8.0012, weight 0.1945 evalue: 711 8.0012, weight 0.1945 evalue: 712 8.0012, weight 0.1945 evalue: 713 8.0012, weight 0.1945 evalue: 714 8.0012, weight 0.1945 evalue: 715 8.0012, weight 0.1945 evalue: 716 8.0012, weight 0.1945 evalue: 717 8.0012, weight 0.1945 evalue: 718 8.0012, weight 0.1945 evalue: 719 8.0012, weight 0.1945 evalue: 720 8.0012, weight 0.1945 evalue: 721 8.0012, weight 0.1945 evalue: 722 8.0012, weight 0.1945 evalue: 723 8.0012, weight 0.1945 evalue: 724 8.0012, weight 0.1945 evalue: 725 8.0012, weight 0.1945 evalue: 726 8.0012, weight 0.1945 evalue: 727 8.0012, weight 0.1945 evalue: 728 8.0012, weight 0.1945 evalue: 729 8.0012, weight 0.1945 evalue: 730 8.0012, weight 0.1945 evalue: 731 8.0012, weight 0.1945 evalue: 732 8.0012, weight 0.1945 evalue: 733 8.0012, weight 0.1945 evalue: 734 8.0012, weight 0.1945 evalue: 735 8.0012, weight 0.1945 evalue: 736 8.0012, weight 0.1945 evalue: 737 8.0012, weight 0.1945 evalue: 738 8.0012, weight 0.1945 evalue: 739 8.0012, weight 0.1945 evalue: 740 8.0012, weight 0.1945 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 17 RES2ATOM 3 24 RES2ATOM 4 32 RES2ATOM 5 38 RES2ATOM 6 46 RES2ATOM 8 58 RES2ATOM 9 65 RES2ATOM 10 76 RES2ATOM 11 81 RES2ATOM 12 90 RES2ATOM 13 96 RES2ATOM 14 103 RES2ATOM 15 111 RES2ATOM 16 120 RES2ATOM 17 127 RES2ATOM 18 135 RES2ATOM 19 144 RES2ATOM 20 153 RES2ATOM 21 163 RES2ATOM 22 171 RES2ATOM 23 179 RES2ATOM 24 188 RES2ATOM 25 195 RES2ATOM 26 207 RES2ATOM 27 215 RES2ATOM 28 221 RES2ATOM 29 226 RES2ATOM 30 232 RES2ATOM 31 240 RES2ATOM 32 248 RES2ATOM 33 255 RES2ATOM 34 262 RES2ATOM 35 273 RES2ATOM 36 284 RES2ATOM 37 293 RES2ATOM 38 298 RES2ATOM 39 305 RES2ATOM 40 313 RES2ATOM 42 324 RES2ATOM 43 332 RES2ATOM 44 346 RES2ATOM 45 354 RES2ATOM 46 362 RES2ATOM 47 367 RES2ATOM 48 374 RES2ATOM 49 383 RES2ATOM 50 391 RES2ATOM 51 402 RES2ATOM 52 411 RES2ATOM 53 420 RES2ATOM 54 428 RES2ATOM 55 434 RES2ATOM 56 442 RES2ATOM 57 447 RES2ATOM 58 456 RES2ATOM 59 465 RES2ATOM 61 478 RES2ATOM 62 486 RES2ATOM 63 492 RES2ATOM 64 500 RES2ATOM 65 509 RES2ATOM 66 520 RES2ATOM 67 529 RES2ATOM 68 537 RES2ATOM 69 548 RES2ATOM 70 556 RES2ATOM 71 563 RES2ATOM 72 571 RES2ATOM 73 578 RES2ATOM 75 588 RES2ATOM 76 596 RES2ATOM 77 607 RES2ATOM 78 615 RES2ATOM 79 622 RES2ATOM 80 629 RES2ATOM 81 638 RES2ATOM 82 649 RES2ATOM 83 656 RES2ATOM 84 664 RES2ATOM 85 672 RES2ATOM 86 680 RES2ATOM 87 689 RES2ATOM 88 697 RES2ATOM 89 705 RES2ATOM 90 712 RES2ATOM 91 721 RES2ATOM 92 730 RES2ATOM 93 738 RES2ATOM 94 747 RES2ATOM 95 755 RES2ATOM 96 760 RES2ATOM 97 768 RES2ATOM 98 777 RES2ATOM 99 782 RES2ATOM 100 791 RES2ATOM 101 799 RES2ATOM 102 807 RES2ATOM 104 817 RES2ATOM 105 828 RES2ATOM 106 835 RES2ATOM 108 847 RES2ATOM 109 858 RES2ATOM 110 867 RES2ATOM 111 875 RES2ATOM 112 883 RES2ATOM 113 891 RES2ATOM 114 898 RES2ATOM 115 907 RES2ATOM 116 912 RES2ATOM 117 920 RES2ATOM 118 929 RES2ATOM 119 936 RES2ATOM 120 943 RES2ATOM 121 954 RES2ATOM 122 962 RES2ATOM 123 967 RES2ATOM 124 979 RES2ATOM 125 987 RES2ATOM 126 996 RES2ATOM 127 1007 RES2ATOM 128 1013 RES2ATOM 129 1021 RES2ATOM 130 1029 RES2ATOM 131 1034 RES2ATOM 133 1045 RES2ATOM 134 1053 RES2ATOM 135 1058 RES2ATOM 136 1067 RES2ATOM 137 1076 RES2ATOM 138 1083 RES2ATOM 139 1091 RES2ATOM 140 1099 RES2ATOM 141 1108 RES2ATOM 142 1116 RES2ATOM 143 1124 RES2ATOM 144 1132 RES2ATOM 145 1140 RES2ATOM 146 1148 RES2ATOM 147 1157 RES2ATOM 149 1166 RES2ATOM 150 1177 RES2ATOM 152 1192 RES2ATOM 153 1203 RES2ATOM 154 1212 RES2ATOM 155 1219 RES2ATOM 156 1227 RES2ATOM 157 1238 RES2ATOM 158 1245 RES2ATOM 159 1250 RES2ATOM 160 1259 RES2ATOM 161 1267 RES2ATOM 162 1275 RES2ATOM 163 1283 RES2ATOM 164 1292 RES2ATOM 165 1300 RES2ATOM 166 1308 RES2ATOM 167 1316 RES2ATOM 168 1324 RES2ATOM 169 1333 RES2ATOM 170 1342 RES2ATOM 171 1350 RES2ATOM 172 1357 RES2ATOM 173 1365 RES2ATOM 174 1373 RES2ATOM 175 1381 RES2ATOM 176 1390 RES2ATOM 177 1398 RES2ATOM 178 1407 RES2ATOM 179 1415 RES2ATOM 180 1426 RES2ATOM 181 1437 RES2ATOM 182 1446 RES2ATOM 183 1454 RES2ATOM 184 1465 RES2ATOM 185 1470 RES2ATOM 186 1478 RES2ATOM 187 1487 RES2ATOM 188 1493 RES2ATOM 189 1502 RES2ATOM 190 1510 RES2ATOM 191 1518 RES2ATOM 192 1525 RES2ATOM 193 1532 RES2ATOM 194 1540 RES2ATOM 195 1547 RES2ATOM 196 1555 RES2ATOM 197 1566 RES2ATOM 198 1574 RES2ATOM 199 1586 RES2ATOM 200 1595 RES2ATOM 201 1602 RES2ATOM 202 1610 RES2ATOM 203 1619 RES2ATOM 204 1633 RES2ATOM 207 1648 RES2ATOM 208 1656 RES2ATOM 209 1661 RES2ATOM 210 1669 RES2ATOM 211 1677 RES2ATOM 212 1682 RES2ATOM 213 1691 RES2ATOM 214 1702 RES2ATOM 216 1713 RES2ATOM 217 1719 RES2ATOM 218 1730 RES2ATOM 219 1738 RES2ATOM 220 1747 RES2ATOM 221 1755 RES2ATOM 222 1763 RES2ATOM 223 1771 RES2ATOM 224 1776 RES2ATOM 225 1787 Constraint 241 778 5.1236 6.4044 12.8089 71.5327 Constraint 189 722 5.4945 6.8681 13.7362 70.4094 Constraint 392 808 3.6158 4.5198 9.0395 69.9549 Constraint 818 1596 4.6781 5.8476 11.6952 69.4934 Constraint 800 1596 4.2379 5.2974 10.5947 68.7669 Constraint 1447 1541 4.3578 5.4472 10.8944 68.7278 Constraint 944 1567 5.5452 6.9314 13.8629 68.6507 Constraint 968 1603 4.8449 6.0561 12.1123 68.6455 Constraint 748 1649 4.2097 5.2621 10.5243 68.4335 Constraint 818 1556 3.9734 4.9668 9.9335 68.4105 Constraint 769 1620 3.7335 4.6669 9.3337 68.4105 Constraint 368 836 5.3783 6.7229 13.4457 66.4452 Constraint 294 384 4.4681 5.5851 11.1702 66.0275 Constraint 299 829 5.4039 6.7549 13.5099 65.9939 Constraint 1008 1634 4.2164 5.2705 10.5411 65.2976 Constraint 1030 1657 3.8333 4.7916 9.5832 63.8130 Constraint 299 800 3.6792 4.5990 9.1980 63.7591 Constraint 180 493 5.6192 7.0240 14.0480 63.7321 Constraint 263 778 3.6118 4.5148 9.0295 63.6765 Constraint 963 1374 4.8730 6.0913 12.1826 63.3142 Constraint 241 748 4.2892 5.3615 10.7230 63.2072 Constraint 769 1649 4.3950 5.4938 10.9876 62.6409 Constraint 263 421 4.7422 5.9278 11.8556 62.0839 Constraint 299 808 4.1514 5.1892 10.3785 62.0010 Constraint 241 756 4.2234 5.2792 10.5584 61.8815 Constraint 968 1408 5.3870 6.7337 13.4674 61.5561 Constraint 997 1374 4.9324 6.1654 12.3309 61.4070 Constraint 216 722 4.0675 5.0844 10.1689 61.0517 Constraint 1382 1603 5.1472 6.4340 12.8680 60.7688 Constraint 154 530 5.5460 6.9325 13.8649 60.5105 Constraint 713 1692 4.4237 5.5296 11.0592 60.4104 Constraint 1077 1260 5.1348 6.4185 12.8371 59.9832 Constraint 1077 1703 4.4761 5.5951 11.1902 59.4408 Constraint 713 1670 3.8144 4.7680 9.5361 58.6223 Constraint 690 1703 4.6027 5.7533 11.5067 58.6223 Constraint 997 1351 4.3703 5.4628 10.9257 58.5777 Constraint 1046 1317 5.1353 6.4191 12.8383 58.4440 Constraint 848 1533 4.6844 5.8555 11.7110 58.4109 Constraint 189 698 4.6260 5.7826 11.5651 58.3309 Constraint 222 722 4.5282 5.6602 11.3205 58.1716 Constraint 189 690 4.5274 5.6592 11.3185 57.7178 Constraint 216 698 5.3100 6.6375 13.2749 57.5729 Constraint 306 980 3.9731 4.9663 9.9327 57.5559 Constraint 1054 1678 3.7482 4.6853 9.3706 56.8576 Constraint 1084 1703 5.1678 6.4597 12.9195 56.6939 Constraint 968 1374 3.9537 4.9422 9.8843 56.5972 Constraint 1022 1317 5.0297 6.2871 12.5742 56.3702 Constraint 1030 1317 4.7163 5.8954 11.7908 56.3488 Constraint 233 443 5.8978 7.3723 14.7446 55.7895 Constraint 249 1035 4.9348 6.1685 12.3371 55.6190 Constraint 325 829 4.3620 5.4525 10.9050 55.6152 Constraint 274 778 4.1742 5.2177 10.4354 55.5725 Constraint 1030 1351 5.5880 6.9849 13.9699 55.4919 Constraint 306 800 5.6071 7.0088 14.0177 55.2794 Constraint 937 1438 5.5380 6.9225 13.8450 55.2144 Constraint 241 722 4.1679 5.2099 10.4198 54.5984 Constraint 1408 1603 4.3875 5.4844 10.9687 54.5957 Constraint 1046 1678 4.5943 5.7428 11.4856 54.5363 Constraint 274 748 5.5883 6.9854 13.9707 54.3940 Constraint 299 778 3.5201 4.4001 8.8002 54.3262 Constraint 968 1634 4.5501 5.6876 11.3752 54.3173 Constraint 263 756 4.6552 5.8190 11.6380 54.3003 Constraint 937 1374 4.6470 5.8087 11.6175 54.2826 Constraint 299 783 6.2333 7.7917 15.5833 54.2700 Constraint 274 1035 5.1520 6.4400 12.8800 53.7331 Constraint 800 1620 4.1958 5.2447 10.4895 53.7018 Constraint 818 1620 6.1441 7.6801 15.3602 53.6779 Constraint 748 1670 4.0558 5.0698 10.1396 53.6261 Constraint 818 1587 4.4800 5.5999 11.1999 53.6034 Constraint 937 1399 4.7486 5.9357 11.8714 53.4217 Constraint 1046 1293 4.5001 5.6252 11.2503 53.3830 Constraint 1293 1678 5.2078 6.5098 13.0196 53.2811 Constraint 1447 1575 4.8554 6.0693 12.1386 52.9062 Constraint 713 1703 4.1650 5.2062 10.4124 52.5993 Constraint 1351 1634 5.7381 7.1727 14.3453 52.4232 Constraint 739 1670 4.6169 5.7711 11.5422 51.9574 Constraint 800 1634 6.1021 7.6276 15.2553 51.9008 Constraint 778 1649 6.1008 7.6260 15.2519 51.8606 Constraint 792 1620 4.3384 5.4230 10.8460 51.8466 Constraint 748 1678 6.1827 7.7284 15.4568 51.8466 Constraint 249 1059 5.3330 6.6663 13.3326 51.7800 Constraint 944 1603 5.1034 6.3793 12.7586 51.7101 Constraint 1077 1731 4.6700 5.8375 11.6750 51.7054 Constraint 968 1351 4.7265 5.9081 11.8163 51.5740 Constraint 690 1720 4.5612 5.7015 11.4029 51.5645 Constraint 1030 1678 4.0951 5.1188 10.2377 50.9059 Constraint 196 1084 5.3682 6.7103 13.4205 50.5976 Constraint 997 1343 4.5327 5.6659 11.3319 50.4872 Constraint 997 1317 4.7375 5.9219 11.8437 50.1344 Constraint 681 1720 3.9784 4.9730 9.9460 49.8245 Constraint 944 1408 5.0510 6.3137 12.6274 49.7053 Constraint 1077 1293 5.5725 6.9656 13.9313 49.6778 Constraint 690 1731 6.1176 7.6470 15.2940 49.2976 Constraint 530 673 5.5652 6.9565 13.9129 49.2377 Constraint 222 1054 6.1605 7.7006 15.4012 49.1802 Constraint 249 1014 5.8292 7.2864 14.5729 48.7501 Constraint 274 980 5.7381 7.1726 14.3452 48.6575 Constraint 222 1084 4.5485 5.6856 11.3712 48.6166 Constraint 1408 1575 4.7046 5.8808 11.7616 48.1838 Constraint 1293 1683 4.6710 5.8388 11.6775 48.0408 Constraint 421 783 4.9572 6.1966 12.3931 47.9325 Constraint 306 955 5.3993 6.7491 13.4981 47.8882 Constraint 722 1703 6.2038 7.7547 15.5095 47.8099 Constraint 1447 1567 4.9833 6.2291 12.4583 47.2605 Constraint 501 722 5.8178 7.2723 14.5445 47.2471 Constraint 274 1014 4.8740 6.0925 12.1851 47.2240 Constraint 448 756 4.3230 5.4037 10.8074 47.1821 Constraint 392 836 4.2259 5.2823 10.5646 47.1524 Constraint 421 800 6.1221 7.6527 15.3054 47.0530 Constraint 1054 1703 4.3153 5.3941 10.7881 47.0313 Constraint 818 1567 5.4901 6.8626 13.7251 46.7983 Constraint 222 1059 4.1844 5.2304 10.4609 46.6872 Constraint 294 412 5.2875 6.6094 13.2188 46.5159 Constraint 501 698 4.1563 5.1954 10.3907 46.4859 Constraint 448 778 5.6322 7.0403 14.0805 46.4180 Constraint 421 778 4.4167 5.5208 11.0417 46.4012 Constraint 448 783 3.3145 4.1431 8.2862 46.3279 Constraint 421 808 3.2648 4.0810 8.1620 46.3279 Constraint 429 783 4.3971 5.4963 10.9927 46.3111 Constraint 530 698 3.3925 4.2406 8.4812 46.2906 Constraint 968 1382 5.2426 6.5533 13.1065 46.2699 Constraint 937 1408 4.2257 5.2821 10.5643 46.1801 Constraint 392 829 3.4916 4.3645 8.7289 46.0984 Constraint 1008 1657 4.0500 5.0624 10.1249 46.0811 Constraint 479 731 5.2460 6.5575 13.1151 46.0570 Constraint 501 731 3.5835 4.4794 8.9588 46.0542 Constraint 429 808 4.1569 5.1961 10.3922 45.9800 Constraint 448 761 5.4309 6.7886 13.5773 45.9305 Constraint 748 1035 5.6712 7.0890 14.1781 45.9146 Constraint 1447 1548 5.4831 6.8539 13.7079 45.8064 Constraint 1351 1657 3.7763 4.7203 9.4406 45.7465 Constraint 222 1035 5.9128 7.3910 14.7819 45.6281 Constraint 403 836 6.0275 7.5344 15.0688 45.5886 Constraint 403 808 5.9602 7.4503 14.9005 45.4220 Constraint 1325 1657 4.7388 5.9236 11.8471 45.3695 Constraint 355 829 5.9389 7.4236 14.8472 45.3187 Constraint 1030 1293 4.7143 5.8929 11.7857 45.0953 Constraint 1035 1649 5.8713 7.3392 14.6784 45.0238 Constraint 1008 1351 4.7619 5.9524 11.9048 44.8573 Constraint 1046 1284 5.4686 6.8358 13.6715 44.3753 Constraint 368 829 6.1242 7.6552 15.3105 44.3663 Constraint 1325 1683 4.6455 5.8068 11.6137 43.8131 Constraint 493 698 5.8665 7.3331 14.6662 43.7798 Constraint 368 859 4.9176 6.1471 12.2941 43.6058 Constraint 848 1556 4.1367 5.1708 10.3417 43.5417 Constraint 980 1634 4.7442 5.9302 11.8605 43.1728 Constraint 501 706 5.4939 6.8673 13.7347 42.8259 Constraint 299 392 5.6384 7.0480 14.0961 42.7574 Constraint 241 1035 5.6959 7.1199 14.2397 42.4606 Constraint 769 1634 5.4238 6.7797 13.5595 42.3022 Constraint 294 421 4.3238 5.4048 10.8096 42.2537 Constraint 1008 1649 4.5626 5.7033 11.4065 42.1028 Constraint 314 384 4.9895 6.2369 12.4738 42.0608 Constraint 306 1014 6.0978 7.6223 15.2445 41.5894 Constraint 180 530 4.6155 5.7694 11.5387 41.5310 Constraint 997 1657 5.9624 7.4529 14.9059 41.3508 Constraint 189 530 4.8107 6.0133 12.0267 41.1067 Constraint 189 1084 5.9070 7.3838 14.7676 40.7939 Constraint 274 1008 5.6204 7.0255 14.0510 40.7912 Constraint 216 530 5.4336 6.7919 13.5839 40.6505 Constraint 355 848 6.2740 7.8425 15.6849 40.6253 Constraint 216 493 3.4609 4.3262 8.6524 40.5711 Constraint 355 859 4.9485 6.1856 12.3712 40.4842 Constraint 196 1059 5.1663 6.4579 12.9158 40.1892 Constraint 299 421 3.8740 4.8425 9.6850 39.8994 Constraint 1046 1260 4.5529 5.6912 11.3823 39.8877 Constraint 285 1014 5.3095 6.6369 13.2737 39.7881 Constraint 216 501 5.8807 7.3508 14.7016 39.7473 Constraint 263 443 4.7176 5.8970 11.7939 39.7418 Constraint 233 493 5.6140 7.0175 14.0350 39.6950 Constraint 1301 1683 5.7937 7.2422 14.4843 39.4893 Constraint 263 748 6.1289 7.6611 15.3222 39.2426 Constraint 1193 1731 4.7386 5.9232 11.8465 39.1600 Constraint 263 448 5.9833 7.4791 14.9582 39.0492 Constraint 294 778 6.1781 7.7226 15.4452 38.7576 Constraint 233 466 5.7409 7.1761 14.3522 38.7201 Constraint 1077 1268 5.2677 6.5846 13.1692 38.7024 Constraint 325 800 5.3768 6.7210 13.4420 38.5635 Constraint 325 818 6.1543 7.6929 15.3857 38.4835 Constraint 1046 1657 4.9603 6.2004 12.4007 38.4171 Constraint 222 690 5.9127 7.3908 14.7817 38.3881 Constraint 1382 1611 5.1722 6.4653 12.9305 37.9098 Constraint 538 673 5.0703 6.3379 12.6758 37.6510 Constraint 1416 1575 5.3852 6.7315 13.4630 37.5801 Constraint 944 1634 5.7157 7.1446 14.2892 37.5014 Constraint 180 521 5.4325 6.7906 13.5811 37.4543 Constraint 274 1649 5.3134 6.6418 13.2835 37.3494 Constraint 944 1596 5.2001 6.5001 13.0003 37.0745 Constraint 538 698 5.4390 6.7987 13.5974 37.0607 Constraint 1193 1764 4.5078 5.6347 11.2694 36.2780 Constraint 690 1084 4.8283 6.0354 12.0708 35.5221 Constraint 1213 1764 4.4915 5.6143 11.2286 35.0579 Constraint 1213 1739 4.2671 5.3339 10.6678 34.7727 Constraint 306 944 6.0474 7.5593 15.1186 34.5874 Constraint 479 756 6.1345 7.6681 15.3362 34.5786 Constraint 363 829 4.3847 5.4808 10.9617 34.5566 Constraint 443 756 5.6248 7.0310 14.0620 34.5560 Constraint 1030 1325 5.4768 6.8460 13.6921 34.3207 Constraint 443 778 6.1468 7.6834 15.3669 34.2390 Constraint 1008 1678 5.1795 6.4744 12.9489 33.7591 Constraint 899 1541 5.4134 6.7667 13.5334 33.7478 Constraint 1317 1657 5.3846 6.7308 13.4615 33.7367 Constraint 1077 1678 3.8421 4.8027 9.6053 33.5621 Constraint 713 1720 5.7974 7.2467 14.4934 33.5012 Constraint 1109 1731 4.2804 5.3506 10.7011 33.2838 Constraint 1268 1731 5.0772 6.3465 12.6930 33.1436 Constraint 1268 1739 4.2132 5.2665 10.5330 32.7482 Constraint 1054 1260 5.4586 6.8232 13.6464 32.7132 Constraint 769 1670 5.9751 7.4689 14.9378 32.4758 Constraint 154 665 4.6794 5.8493 11.6986 32.4560 Constraint 1068 1260 4.9197 6.1496 12.2992 32.4082 Constraint 530 665 5.1332 6.4164 12.8329 32.2732 Constraint 1408 1567 5.7528 7.1911 14.3821 31.8717 Constraint 154 557 4.4036 5.5046 11.0091 31.8345 Constraint 216 756 5.4003 6.7504 13.5009 31.6724 Constraint 325 944 5.9606 7.4508 14.9015 31.6526 Constraint 189 665 4.1871 5.2339 10.4678 31.5987 Constraint 128 616 5.7789 7.2236 14.4472 31.4988 Constraint 564 673 4.2586 5.3233 10.6465 31.1738 Constraint 164 665 5.3369 6.6711 13.3422 31.0127 Constraint 392 859 6.2394 7.7993 15.5986 30.8108 Constraint 493 722 5.8274 7.2843 14.5686 30.7857 Constraint 1030 1649 4.8310 6.0387 12.0774 30.7710 Constraint 1054 1293 4.9302 6.1627 12.3255 30.7681 Constraint 1109 1703 5.0977 6.3722 12.7443 30.7642 Constraint 792 1587 6.0133 7.5167 15.0334 30.7190 Constraint 778 1620 6.1989 7.7486 15.4972 30.7190 Constraint 493 731 5.9378 7.4222 14.8445 30.6960 Constraint 1008 1317 5.7442 7.1802 14.3604 30.6501 Constraint 443 783 6.2996 7.8746 15.7491 30.5828 Constraint 829 1596 6.1350 7.6687 15.3374 30.4522 Constraint 1374 1603 5.5528 6.9410 13.8820 30.2174 Constraint 1035 1703 6.0746 7.5933 15.1865 29.8984 Constraint 216 421 5.0210 6.2763 12.5525 29.7600 Constraint 899 1511 4.4350 5.5438 11.0876 29.7115 Constraint 180 443 5.6358 7.0448 14.0895 29.4430 Constraint 263 384 4.3036 5.3795 10.7590 29.4314 Constraint 294 443 6.1212 7.6515 15.3029 29.1485 Constraint 325 848 5.6802 7.1003 14.2006 28.8681 Constraint 1100 1204 4.6834 5.8542 11.7085 28.8174 Constraint 899 1471 5.6013 7.0016 14.0032 28.6732 Constraint 1030 1634 4.7815 5.9768 11.9536 28.6648 Constraint 1035 1678 3.9499 4.9374 9.8748 28.6160 Constraint 128 650 4.0258 5.0323 10.0646 28.5627 Constraint 1077 1239 4.2503 5.3129 10.6258 28.4983 Constraint 384 808 3.7934 4.7417 9.4834 28.3562 Constraint 306 1634 6.2864 7.8580 15.7161 28.1699 Constraint 222 1703 6.1862 7.7327 15.4655 28.1699 Constraint 1239 1731 5.4547 6.8184 13.6369 28.0903 Constraint 1030 1683 5.6320 7.0401 14.0801 27.8669 Constraint 1054 1731 5.4898 6.8622 13.7244 27.8494 Constraint 121 597 5.4610 6.8263 13.6526 27.8249 Constraint 392 783 4.4552 5.5690 11.1381 27.7344 Constraint 333 921 4.7935 5.9919 11.9838 27.4648 Constraint 325 921 5.9892 7.4865 14.9730 27.4196 Constraint 180 557 5.1746 6.4682 12.9364 27.4032 Constraint 333 955 4.8611 6.0764 12.1527 27.3825 Constraint 233 421 4.8487 6.0609 12.1218 27.2317 Constraint 1100 1193 5.1262 6.4077 12.8155 27.2171 Constraint 121 530 4.7162 5.8953 11.7905 27.2026 Constraint 421 756 3.5414 4.4267 8.8534 26.9856 Constraint 1100 1731 3.8761 4.8451 9.6902 26.9724 Constraint 227 1059 5.3882 6.7352 13.4704 26.8841 Constraint 921 1541 5.3729 6.7162 13.4323 26.8071 Constraint 1077 1683 5.9242 7.4052 14.8105 26.7889 Constraint 1100 1703 6.0165 7.5206 15.0412 26.7846 Constraint 333 836 4.7908 5.9885 11.9770 26.7068 Constraint 164 1084 6.0068 7.5085 15.0170 26.6607 Constraint 690 1109 4.7830 5.9788 11.9575 26.4518 Constraint 1213 1772 5.0213 6.2766 12.5532 26.3594 Constraint 1382 1575 4.9758 6.2198 12.4396 26.3590 Constraint 748 1054 5.4244 6.7805 13.5610 26.3257 Constraint 1382 1634 5.8647 7.3308 14.6617 26.1282 Constraint 363 808 3.3364 4.1705 8.3409 26.0905 Constraint 448 722 5.8598 7.3247 14.6495 26.0390 Constraint 1059 1703 5.5311 6.9139 13.8277 26.0097 Constraint 1054 1649 5.7323 7.1653 14.3306 25.5533 Constraint 479 698 5.5244 6.9055 13.8110 25.4398 Constraint 1293 1657 4.9655 6.2069 12.4138 25.4021 Constraint 421 731 4.6867 5.8584 11.7168 25.3725 Constraint 1109 1720 6.2971 7.8714 15.7429 25.3634 Constraint 1054 1683 5.9544 7.4430 14.8861 25.3532 Constraint 479 673 4.8149 6.0187 12.0373 25.3178 Constraint 1077 1193 4.5589 5.6986 11.3973 25.3103 Constraint 448 698 4.0067 5.0083 10.0167 25.3067 Constraint 421 722 5.5905 6.9881 13.9762 25.2801 Constraint 443 698 5.9719 7.4648 14.9296 25.2347 Constraint 429 731 5.1806 6.4757 12.9515 25.2130 Constraint 448 731 3.6569 4.5711 9.1423 25.2015 Constraint 448 706 5.4089 6.7611 13.5221 25.2015 Constraint 368 808 5.8386 7.2983 14.5965 25.2015 Constraint 1416 1603 5.5380 6.9225 13.8451 24.9943 Constraint 501 673 4.2771 5.3464 10.6928 24.8127 Constraint 216 443 3.6510 4.5638 9.1275 24.7998 Constraint 1239 1739 4.4058 5.5073 11.0145 24.7499 Constraint 263 783 6.0585 7.5732 15.1463 24.5980 Constraint 1046 1683 5.6185 7.0231 14.0463 24.5551 Constraint 1068 1678 5.8108 7.2634 14.5269 24.5239 Constraint 1447 1603 5.8707 7.3383 14.6766 24.5187 Constraint 921 1567 5.9275 7.4094 14.8188 24.5155 Constraint 154 564 5.1406 6.4258 12.8515 24.2751 Constraint 1100 1260 4.5092 5.6365 11.2729 24.2657 Constraint 128 530 5.4171 6.7714 13.5427 24.1483 Constraint 1325 1678 5.9076 7.3844 14.7689 24.0627 Constraint 154 493 4.1686 5.2107 10.4215 24.0556 Constraint 145 557 6.2681 7.8351 15.6702 23.8934 Constraint 1084 1720 6.1011 7.6264 15.2527 23.8220 Constraint 800 980 6.2021 7.7526 15.5052 23.6978 Constraint 216 448 5.7892 7.2365 14.4729 23.6760 Constraint 1077 1204 5.0626 6.3282 12.6564 23.6525 Constraint 968 1657 6.1951 7.7439 15.4878 23.5599 Constraint 233 412 5.6498 7.0622 14.1244 23.5358 Constraint 180 466 5.3116 6.6394 13.2789 23.4018 Constraint 1077 1228 6.0633 7.5792 15.1583 23.3286 Constraint 154 501 5.2133 6.5166 13.0332 23.1704 Constraint 164 1092 5.5451 6.9314 13.8627 23.1537 Constraint 1351 1611 5.2393 6.5491 13.0983 23.0739 Constraint 1351 1603 5.2961 6.6201 13.2402 23.0712 Constraint 384 778 4.5564 5.6955 11.3910 23.0649 Constraint 384 783 4.9035 6.1294 12.2587 22.9773 Constraint 363 836 4.1856 5.2319 10.4639 22.9436 Constraint 899 1533 3.7426 4.6782 9.3565 22.9298 Constraint 1455 1541 5.4112 6.7640 13.5281 22.8485 Constraint 333 829 5.7491 7.1863 14.3727 22.7888 Constraint 233 756 5.7255 7.1568 14.3136 22.7662 Constraint 937 1603 6.2230 7.7787 15.5574 22.6856 Constraint 164 1117 6.0340 7.5425 15.0850 22.6851 Constraint 1068 1284 5.5934 6.9917 13.9834 22.6728 Constraint 876 1533 5.2992 6.6241 13.2481 22.6441 Constraint 384 800 6.1808 7.7260 15.4519 22.5939 Constraint 180 698 6.0877 7.6096 15.2191 22.4917 Constraint 1268 1714 6.1607 7.7008 15.4016 22.4079 Constraint 222 1109 5.8761 7.3452 14.6904 22.3612 Constraint 899 1567 5.6714 7.0892 14.1785 22.3429 Constraint 189 1109 5.6120 7.0149 14.0299 22.3177 Constraint 196 1109 5.5298 6.9122 13.8245 22.2399 Constraint 196 1117 4.4143 5.5178 11.0357 22.2093 Constraint 657 1756 3.9531 4.9413 9.8827 22.1342 Constraint 355 892 6.1004 7.6255 15.2510 22.1328 Constraint 241 421 4.8053 6.0066 12.0132 21.8171 Constraint 1084 1731 3.9208 4.9010 9.8020 21.7300 Constraint 1260 1678 5.2340 6.5425 13.0851 21.7216 Constraint 713 1678 6.2461 7.8077 15.6154 21.7015 Constraint 325 1596 5.3560 6.6950 13.3900 21.6266 Constraint 241 1054 5.8399 7.2999 14.5998 21.6088 Constraint 1046 1351 5.9952 7.4940 14.9880 21.4721 Constraint 196 1092 4.4344 5.5431 11.0861 21.3989 Constraint 1193 1756 5.1190 6.3987 12.7975 21.3256 Constraint 1193 1739 5.0296 6.2870 12.5739 21.3117 Constraint 1100 1293 6.0577 7.5721 15.1443 21.3048 Constraint 1325 1662 5.6431 7.0539 14.1079 21.0198 Constraint 657 1720 3.8919 4.8648 9.7297 20.9652 Constraint 848 1567 5.7089 7.1361 14.2722 20.9341 Constraint 1100 1239 4.6124 5.7655 11.5310 20.8600 Constraint 249 1084 5.6090 7.0112 14.0224 20.7858 Constraint 1068 1317 5.7729 7.2161 14.4323 20.7392 Constraint 1046 1325 5.5017 6.8771 13.7543 20.6738 Constraint 1109 1193 5.5881 6.9851 13.9703 20.5885 Constraint 294 375 5.3103 6.6379 13.2758 20.4885 Constraint 892 1567 5.7312 7.1640 14.3280 20.1980 Constraint 639 1764 6.2968 7.8710 15.7421 20.0834 Constraint 892 1533 4.2665 5.3331 10.6662 19.9897 Constraint 121 589 6.2839 7.8548 15.7097 19.7264 Constraint 1125 1204 4.2878 5.3598 10.7196 19.7108 Constraint 1054 1670 5.1015 6.3769 12.7537 19.6315 Constraint 921 1533 3.6881 4.6101 9.2202 19.6159 Constraint 892 1541 5.4368 6.7960 13.5920 19.5738 Constraint 1022 1657 5.8783 7.3479 14.6958 19.4465 Constraint 921 1511 4.5211 5.6514 11.3028 19.2975 Constraint 913 1533 6.2186 7.7733 15.5465 19.2778 Constraint 657 1084 6.2861 7.8576 15.7153 19.2410 Constraint 1022 1343 4.4879 5.6099 11.2197 19.2350 Constraint 1100 1268 5.0256 6.2821 12.5641 19.1710 Constraint 145 493 5.8728 7.3409 14.6819 19.1470 Constraint 1054 1268 5.8851 7.3564 14.7128 18.8018 Constraint 1408 1541 4.8809 6.1011 12.2022 18.7766 Constraint 1068 1293 4.4387 5.5484 11.0968 18.7426 Constraint 216 731 5.9094 7.3867 14.7734 18.6502 Constraint 1447 1519 4.1422 5.1777 10.3555 18.5473 Constraint 274 1054 5.2864 6.6080 13.2160 18.5028 Constraint 249 1054 4.6363 5.7954 11.5909 18.5028 Constraint 1109 1246 5.4208 6.7760 13.5519 18.4227 Constraint 1246 1739 4.1630 5.2037 10.4074 18.4191 Constraint 1125 1193 4.5041 5.6302 11.2603 18.3501 Constraint 1374 1575 5.7184 7.1480 14.2960 18.3294 Constraint 908 1438 5.0607 6.3258 12.6517 18.2850 Constraint 997 1634 4.1211 5.1513 10.3027 18.2764 Constraint 1046 1251 5.5751 6.9689 13.9377 18.1997 Constraint 299 384 3.9722 4.9652 9.9304 18.0622 Constraint 1408 1548 5.6761 7.0951 14.1902 17.9692 Constraint 657 1748 5.6016 7.0020 14.0039 17.9546 Constraint 263 808 4.4402 5.5502 11.1005 17.9097 Constraint 908 1471 5.1550 6.4438 12.8876 17.9066 Constraint 274 800 5.1605 6.4506 12.9012 17.8223 Constraint 876 1526 5.8670 7.3337 14.6675 17.6677 Constraint 121 557 5.8458 7.3073 14.6146 17.5953 Constraint 1022 1351 4.1829 5.2287 10.4573 17.5560 Constraint 968 1596 5.2163 6.5204 13.0409 17.4308 Constraint 1022 1374 5.2966 6.6208 13.2416 17.4046 Constraint 1084 1193 5.7159 7.1449 14.2898 17.3651 Constraint 963 1399 4.6664 5.8330 11.6660 17.2551 Constraint 564 665 4.6153 5.7691 11.5383 17.2091 Constraint 930 1567 6.0908 7.6134 15.2269 17.1118 Constraint 722 1059 5.9221 7.4026 14.8053 17.1107 Constraint 997 1603 5.4256 6.7820 13.5640 17.0856 Constraint 968 1567 5.4406 6.8007 13.6014 17.0650 Constraint 1268 1683 5.4543 6.8179 13.6358 16.9479 Constraint 1008 1603 4.2962 5.3703 10.7406 16.9432 Constraint 800 1567 4.2635 5.3294 10.6588 16.9317 Constraint 748 1634 4.3075 5.3843 10.7686 16.8513 Constraint 800 1603 6.0625 7.5782 15.1563 16.8481 Constraint 501 665 4.5054 5.6318 11.2635 16.8339 Constraint 778 1634 6.0837 7.6046 15.2092 16.8276 Constraint 1035 1634 5.7991 7.2489 14.4978 16.8102 Constraint 1084 1756 5.9268 7.4085 14.8170 16.7981 Constraint 792 1596 4.3478 5.4348 10.8696 16.7476 Constraint 980 1603 4.3428 5.4284 10.8569 16.7055 Constraint 657 1731 5.5848 6.9810 13.9619 16.6919 Constraint 944 1575 4.8062 6.0077 12.0155 16.6224 Constraint 944 1541 5.4697 6.8371 13.6742 16.6119 Constraint 968 1575 5.3112 6.6390 13.2781 16.5639 Constraint 818 1533 3.8118 4.7647 9.5295 16.5639 Constraint 769 1596 3.5184 4.3979 8.7959 16.5639 Constraint 739 1649 4.6113 5.7641 11.5282 16.5639 Constraint 713 1649 3.7583 4.6979 9.3958 16.5639 Constraint 722 1084 5.7122 7.1403 14.2805 16.5408 Constraint 1109 1756 5.7568 7.1960 14.3919 16.5141 Constraint 1030 1260 4.7026 5.8783 11.7565 16.2766 Constraint 263 829 4.9885 6.2356 12.4713 16.1071 Constraint 274 1634 5.5202 6.9003 13.8005 16.0772 Constraint 665 1756 3.9911 4.9889 9.9778 16.0667 Constraint 665 1748 5.9434 7.4292 14.8584 16.0667 Constraint 997 1382 5.1806 6.4757 12.9514 15.8768 Constraint 121 579 6.2182 7.7727 15.5455 15.7730 Constraint 963 1408 4.3759 5.4698 10.9397 15.7645 Constraint 997 1408 5.4675 6.8344 13.6687 15.7508 Constraint 1204 1731 6.2972 7.8716 15.7431 15.6921 Constraint 274 756 6.3161 7.8951 15.7902 15.5333 Constraint 1077 1739 6.0277 7.5346 15.0692 15.4728 Constraint 963 1438 5.4583 6.8229 13.6458 15.3166 Constraint 1260 1683 4.1359 5.1699 10.3398 15.2505 Constraint 1213 1731 4.7598 5.9497 11.8994 15.1905 Constraint 988 1374 4.9610 6.2012 12.4025 15.1216 Constraint 306 1035 6.1951 7.7438 15.4877 15.0750 Constraint 665 1764 5.8108 7.2635 14.5271 15.0625 Constraint 285 1035 5.2052 6.5065 13.0131 15.0606 Constraint 325 1567 5.4600 6.8250 13.6500 15.0586 Constraint 1117 1260 3.9404 4.9256 9.8511 15.0105 Constraint 180 665 6.2106 7.7632 15.5264 14.9630 Constraint 1054 1657 3.7183 4.6479 9.2958 14.9420 Constraint 913 1567 6.0491 7.5613 15.1227 14.9242 Constraint 121 564 5.5653 6.9566 13.9133 14.8992 Constraint 121 521 5.8398 7.2997 14.5995 14.8463 Constraint 980 1649 5.9146 7.3933 14.7866 14.8087 Constraint 1035 1670 6.0236 7.5294 15.0589 14.7267 Constraint 1022 1284 5.1725 6.4656 12.9312 14.7154 Constraint 997 1284 4.9997 6.2496 12.4992 14.5015 Constraint 1100 1228 5.4224 6.7780 13.5560 14.4999 Constraint 216 778 4.3245 5.4056 10.8112 14.4313 Constraint 1455 1575 6.3090 7.8863 15.7725 14.4099 Constraint 1246 1764 4.1769 5.2212 10.4423 14.3603 Constraint 1035 1657 3.9282 4.9102 9.8204 14.2185 Constraint 630 1777 5.9964 7.4955 14.9910 14.0583 Constraint 748 1657 6.1584 7.6980 15.3960 14.0080 Constraint 1213 1756 6.0747 7.5933 15.1867 13.7119 Constraint 164 1109 6.2495 7.8119 15.6238 13.6237 Constraint 1092 1260 5.4167 6.7709 13.5418 13.6200 Constraint 333 859 5.4217 6.7772 13.5543 13.6013 Constraint 884 1533 6.3041 7.8801 15.7601 13.5693 Constraint 1092 1204 5.8903 7.3629 14.7257 13.4940 Constraint 1030 1284 3.9647 4.9558 9.9116 13.4074 Constraint 208 493 5.4718 6.8397 13.6794 13.2125 Constraint 208 443 5.4097 6.7621 13.5243 13.1458 Constraint 104 650 6.0098 7.5123 15.0246 13.0581 Constraint 333 868 5.6961 7.1201 14.2402 13.0389 Constraint 1117 1246 4.8567 6.0709 12.1417 13.0323 Constraint 1077 1251 6.3351 7.9189 15.8378 12.9582 Constraint 1117 1193 5.5223 6.9028 13.8056 12.8858 Constraint 196 1178 4.5163 5.6453 11.2906 12.6979 Constraint 1077 1178 5.9530 7.4413 14.8826 12.6850 Constraint 1246 1731 4.3666 5.4583 10.9165 12.6443 Constraint 1117 1251 4.7156 5.8945 11.7890 12.6301 Constraint 222 1077 6.3031 7.8789 15.7578 12.6229 Constraint 189 748 4.4445 5.5557 11.1113 12.5778 Constraint 1059 1178 5.3706 6.7132 13.4265 12.5625 Constraint 1046 1649 6.3608 7.9510 15.9021 12.5613 Constraint 1068 1178 4.6398 5.7998 11.5996 12.5238 Constraint 263 363 5.0754 6.3442 12.6885 12.5234 Constraint 164 1178 5.8554 7.3192 14.6385 12.5220 Constraint 913 1438 5.3804 6.7256 13.4511 12.4922 Constraint 154 722 4.4035 5.5044 11.0088 12.4552 Constraint 154 698 4.9687 6.2109 12.4218 12.4548 Constraint 306 988 5.5800 6.9750 13.9500 12.4172 Constraint 980 1596 6.3605 7.9506 15.9012 12.3902 Constraint 1014 1649 5.9518 7.4397 14.8794 12.3015 Constraint 1100 1739 6.0765 7.5956 15.1912 12.0500 Constraint 274 1030 5.6663 7.0829 14.1657 12.0500 Constraint 227 1084 5.3988 6.7485 13.4969 12.0500 Constraint 263 800 4.2832 5.3540 10.7079 12.0345 Constraint 1100 1213 5.6831 7.1039 14.2078 12.0216 Constraint 128 665 5.2532 6.5665 13.1330 11.9462 Constraint 222 778 4.2098 5.2622 10.5244 11.8512 Constraint 564 650 5.9762 7.4703 14.9406 11.8110 Constraint 189 778 5.3563 6.6953 13.3907 11.6511 Constraint 800 1008 5.6698 7.0873 14.1746 11.6456 Constraint 333 944 4.9893 6.2366 12.4732 11.5872 Constraint 1077 1246 5.6358 7.0448 14.0895 11.5267 Constraint 538 616 5.2401 6.5502 13.1003 11.5232 Constraint 1284 1657 6.1265 7.6582 15.3163 11.4721 Constraint 968 1317 4.4097 5.5121 11.0241 11.3626 Constraint 908 1447 5.6551 7.0689 14.1378 11.3330 Constraint 333 980 4.8310 6.0388 12.0776 11.1462 Constraint 930 1438 4.8799 6.0998 12.1997 11.1025 Constraint 306 1008 3.5313 4.4141 8.8282 11.0937 Constraint 189 1059 5.2078 6.5098 13.0195 11.0872 Constraint 921 1471 5.5741 6.9676 13.9353 11.0032 Constraint 899 1438 5.3270 6.6587 13.3175 10.9602 Constraint 1246 1772 4.9542 6.1927 12.3855 10.8943 Constraint 443 722 5.8040 7.2550 14.5099 10.8615 Constraint 443 731 5.9013 7.3766 14.7533 10.8476 Constraint 899 1519 4.8713 6.0891 12.1782 10.7579 Constraint 256 384 4.5088 5.6360 11.2721 10.7060 Constraint 216 748 5.5676 6.9595 13.9190 10.6742 Constraint 530 616 5.2316 6.5395 13.0790 10.6220 Constraint 429 756 6.0029 7.5036 15.0073 10.5519 Constraint 1293 1662 5.6913 7.1141 14.2282 10.5435 Constraint 997 1309 4.1154 5.1443 10.2886 10.4680 Constraint 325 808 5.8680 7.3350 14.6699 10.4433 Constraint 681 1692 4.8274 6.0343 12.0685 10.4289 Constraint 892 1511 5.3505 6.6881 13.3762 10.4093 Constraint 164 1059 4.6033 5.7541 11.5082 10.3716 Constraint 180 756 6.1037 7.6296 15.2591 10.3514 Constraint 363 848 6.2151 7.7689 15.5378 10.3143 Constraint 249 800 5.6376 7.0470 14.0941 10.2883 Constraint 222 748 5.3727 6.7159 13.4318 10.2216 Constraint 333 848 4.8038 6.0047 12.0094 10.1444 Constraint 868 1526 5.8178 7.2723 14.5446 10.1262 Constraint 868 1533 5.0537 6.3172 12.6343 10.1105 Constraint 154 549 4.5581 5.6977 11.3953 10.0772 Constraint 665 1777 4.6782 5.8477 11.6954 10.0417 Constraint 368 868 5.7592 7.1990 14.3980 9.8197 Constraint 892 1471 5.6513 7.0641 14.1282 9.8154 Constraint 1008 1596 6.2452 7.8064 15.6129 9.7004 Constraint 1317 1634 5.4289 6.7861 13.5722 9.6820 Constraint 121 493 5.2082 6.5102 13.0205 9.6138 Constraint 1374 1567 6.0148 7.5185 15.0370 9.5679 Constraint 876 1511 5.3153 6.6441 13.2882 9.5533 Constraint 263 412 4.9968 6.2460 12.4920 9.5449 Constraint 97 597 4.2513 5.3141 10.6282 9.5014 Constraint 963 1343 4.7019 5.8774 11.7547 9.4807 Constraint 241 808 4.2549 5.3187 10.6373 9.4342 Constraint 1416 1541 6.0806 7.6007 15.2014 9.4054 Constraint 241 800 3.8484 4.8105 9.6209 9.3922 Constraint 1416 1548 5.2267 6.5334 13.0668 9.3487 Constraint 1109 1268 5.3524 6.6905 13.3810 9.3281 Constraint 848 1541 5.6563 7.0704 14.1407 9.2859 Constraint 306 1603 6.2499 7.8124 15.6248 9.2097 Constraint 1466 1541 3.8380 4.7975 9.5949 9.2059 Constraint 829 1567 6.1380 7.6725 15.3449 9.2054 Constraint 294 808 4.9185 6.1482 12.2963 9.1765 Constraint 164 722 4.6515 5.8144 11.6288 9.1616 Constraint 818 1541 6.2062 7.7578 15.5156 9.1213 Constraint 930 1447 5.5154 6.8943 13.7886 9.1159 Constraint 778 1596 6.2062 7.7578 15.5156 9.0834 Constraint 930 1541 6.3136 7.8919 15.7839 9.0728 Constraint 968 1611 5.7266 7.1583 14.3165 9.0624 Constraint 899 1488 5.2555 6.5694 13.1388 9.0542 Constraint 792 1556 6.0500 7.5625 15.1250 9.0531 Constraint 189 756 3.7856 4.7320 9.4639 9.0405 Constraint 937 1575 6.2567 7.8209 15.6418 9.0375 Constraint 355 868 4.1775 5.2219 10.4437 9.0316 Constraint 128 698 4.9809 6.2262 12.4523 8.9550 Constraint 538 623 4.9214 6.1518 12.3036 8.9202 Constraint 97 530 5.7897 7.2371 14.4743 8.8856 Constraint 1438 1541 3.4363 4.2954 8.5908 8.8811 Constraint 1471 1541 3.7603 4.7004 9.4008 8.7984 Constraint 1438 1533 6.2856 7.8570 15.7140 8.7983 Constraint 299 818 5.7386 7.1732 14.3464 8.7294 Constraint 944 1374 5.0169 6.2712 12.5423 8.7167 Constraint 233 384 4.5377 5.6721 11.3441 8.6606 Constraint 274 818 5.7992 7.2490 14.4981 8.6316 Constraint 128 690 5.1512 6.4390 12.8780 8.6134 Constraint 189 1035 5.9210 7.4013 14.8025 8.5749 Constraint 572 673 6.3332 7.9165 15.8330 8.5673 Constraint 1438 1511 3.6032 4.5040 9.0080 8.5317 Constraint 294 829 4.1392 5.1740 10.3481 8.5305 Constraint 241 783 6.1304 7.6631 15.3261 8.5231 Constraint 1382 1587 5.6395 7.0494 14.0987 8.5112 Constraint 557 665 4.7200 5.9000 11.8000 8.4915 Constraint 222 1014 5.3041 6.6302 13.2603 8.4609 Constraint 1343 1603 6.2942 7.8677 15.7354 8.4596 Constraint 1109 1239 4.6604 5.8254 11.6509 8.4288 Constraint 233 778 4.9940 6.2425 12.4851 8.4020 Constraint 968 1343 3.8439 4.8049 9.6098 8.3687 Constraint 1054 1167 5.2738 6.5923 13.1845 8.3673 Constraint 1447 1526 5.9536 7.4420 14.8839 8.3418 Constraint 164 1167 6.2489 7.8112 15.6224 8.2614 Constraint 1008 1611 5.9735 7.4668 14.9337 8.2102 Constraint 1466 1548 5.5365 6.9206 13.8412 8.1618 Constraint 1059 1167 4.4212 5.5266 11.0531 8.1581 Constraint 1455 1548 6.3335 7.9168 15.8336 8.1500 Constraint 355 913 5.8739 7.3424 14.6848 8.1445 Constraint 306 968 6.1832 7.7291 15.4581 8.1330 Constraint 196 1167 5.2149 6.5186 13.0373 8.1323 Constraint 1068 1167 5.7950 7.2438 14.4876 8.1290 Constraint 325 968 5.9595 7.4494 14.8987 8.1288 Constraint 189 1167 5.6485 7.0606 14.1212 8.1093 Constraint 690 1167 4.8393 6.0492 12.0983 8.1074 Constraint 1077 1167 4.4453 5.5566 11.1132 8.1047 Constraint 657 1167 6.1211 7.6514 15.3029 8.0640 Constraint 1358 1611 5.6314 7.0393 14.0786 8.0333 Constraint 963 1603 6.1874 7.7343 15.4686 8.0333 Constraint 930 1533 6.2310 7.7887 15.5774 8.0333 Constraint 222 1167 5.5658 6.9573 13.9146 8.0333 Constraint 274 829 3.7895 4.7369 9.4738 8.0227 Constraint 530 623 4.6055 5.7569 11.5138 7.8742 Constraint 121 572 5.2970 6.6213 13.2426 7.8045 Constraint 769 1603 6.3175 7.8969 15.7938 7.7564 Constraint 1246 1756 5.7866 7.2332 14.4664 7.7502 Constraint 1014 1634 5.9400 7.4250 14.8500 7.6778 Constraint 538 665 5.2106 6.5133 13.0265 7.6256 Constraint 937 1343 4.4568 5.5710 11.1419 7.6041 Constraint 739 1620 5.9439 7.4299 14.8599 7.5264 Constraint 294 363 3.8677 4.8347 9.6693 7.5137 Constraint 1268 1772 4.4144 5.5180 11.0360 7.4819 Constraint 937 1366 4.7583 5.9479 11.8958 7.4555 Constraint 930 1471 4.8765 6.0956 12.1913 7.4486 Constraint 91 557 6.0328 7.5409 15.0819 7.4124 Constraint 722 1670 6.1616 7.7020 15.4041 7.3476 Constraint 97 665 4.9624 6.2029 12.4059 7.3408 Constraint 180 549 5.1321 6.4152 12.8303 7.3397 Constraint 1059 1670 5.4467 6.8083 13.6167 7.3354 Constraint 690 1692 4.6526 5.8157 11.6314 7.3164 Constraint 285 355 5.4851 6.8564 13.7128 7.2612 Constraint 263 355 5.1621 6.4527 12.9053 7.2299 Constraint 263 392 4.5056 5.6320 11.2640 7.1226 Constraint 557 650 6.0395 7.5494 15.0988 7.1224 Constraint 274 808 5.4937 6.8671 13.7341 7.1006 Constraint 557 673 4.3089 5.3861 10.7722 7.0980 Constraint 1438 1519 6.3423 7.9278 15.8556 7.0835 Constraint 848 1511 4.8731 6.0914 12.1827 7.0705 Constraint 1455 1533 6.1640 7.7049 15.4099 7.0178 Constraint 164 1035 5.6781 7.0976 14.1952 6.9069 Constraint 657 1703 5.5571 6.9463 13.8927 6.8168 Constraint 657 1692 3.9579 4.9474 9.8947 6.8168 Constraint 892 1438 5.3879 6.7348 13.4697 6.8092 Constraint 1077 1670 6.1965 7.7456 15.4912 6.7925 Constraint 104 1092 5.7197 7.1496 14.2993 6.7843 Constraint 713 1662 4.2024 5.2530 10.5060 6.7757 Constraint 690 1670 4.3370 5.4213 10.8426 6.7757 Constraint 713 1657 6.2465 7.8082 15.6163 6.7737 Constraint 355 884 5.8265 7.2831 14.5663 6.7050 Constraint 256 355 4.8199 6.0249 12.0499 6.6760 Constraint 128 722 5.6260 7.0325 14.0649 6.6736 Constraint 196 1014 5.4410 6.8012 13.6024 6.6177 Constraint 412 756 5.7015 7.1269 14.2537 6.6129 Constraint 216 783 6.0569 7.5711 15.1423 6.6038 Constraint 501 650 6.2163 7.7704 15.5408 6.5907 Constraint 196 1035 5.2257 6.5321 13.0643 6.5835 Constraint 241 829 5.6735 7.0919 14.1838 6.5759 Constraint 121 665 5.7986 7.2482 14.4964 6.5480 Constraint 299 1596 5.5315 6.9144 13.8287 6.2726 Constraint 145 443 5.2218 6.5272 13.0544 6.2556 Constraint 256 325 5.4769 6.8461 13.6923 6.2313 Constraint 222 1649 5.8152 7.2690 14.5380 6.2030 Constraint 136 1084 5.6278 7.0348 14.0695 6.2030 Constraint 1260 1731 6.1681 7.7101 15.4203 6.0905 Constraint 908 1541 6.2508 7.8135 15.6270 6.0788 Constraint 306 921 5.0351 6.2939 12.5878 6.0500 Constraint 1068 1251 5.5671 6.9589 13.9177 6.0250 Constraint 1117 1268 4.8318 6.0398 12.0796 6.0228 Constraint 180 421 4.6162 5.7703 11.5406 5.9775 Constraint 1301 1772 5.4833 6.8541 13.7082 5.9593 Constraint 1228 1731 5.9886 7.4857 14.9715 5.9253 Constraint 1133 1268 5.3991 6.7489 13.4978 5.7963 Constraint 180 722 4.6166 5.7707 11.5415 5.7859 Constraint 412 778 6.1459 7.6823 15.3647 5.7372 Constraint 412 783 6.3122 7.8903 15.7805 5.6749 Constraint 128 657 5.1698 6.4623 12.9246 5.6631 Constraint 249 980 4.2488 5.3110 10.6220 5.6615 Constraint 97 557 4.3664 5.4580 10.9160 5.6613 Constraint 1268 1678 3.7694 4.7118 9.4236 5.5546 Constraint 274 944 5.7604 7.2005 14.4009 5.5499 Constraint 1268 1764 4.2593 5.3242 10.6483 5.5472 Constraint 274 363 5.0980 6.3725 12.7450 5.5043 Constraint 829 944 4.3337 5.4171 10.8341 5.4944 Constraint 1084 1670 4.9110 6.1388 12.2775 5.4358 Constraint 227 1014 5.3981 6.7476 13.4952 5.4202 Constraint 1092 1193 5.5767 6.9709 13.9418 5.4174 Constraint 285 955 4.6666 5.8333 11.6665 5.4032 Constraint 222 769 6.1850 7.7313 15.4626 5.3638 Constraint 241 1649 6.1799 7.7249 15.4498 5.2685 Constraint 1084 1692 6.2386 7.7983 15.5966 5.2682 Constraint 274 1596 5.5692 6.9615 13.9230 5.2144 Constraint 829 968 4.6545 5.8181 11.6363 5.1448 Constraint 908 1567 6.2324 7.7905 15.5811 5.1190 Constraint 222 756 5.8971 7.3713 14.7427 5.1098 Constraint 274 955 5.1491 6.4364 12.8727 5.1093 Constraint 136 1059 5.3247 6.6559 13.3118 5.1031 Constraint 1260 1657 5.0525 6.3157 12.6314 5.0989 Constraint 136 1092 4.3699 5.4624 10.9247 5.0783 Constraint 1268 1703 5.3748 6.7185 13.4370 5.0538 Constraint 97 650 6.3032 7.8790 15.7580 4.9629 Constraint 263 333 4.7991 5.9989 11.9978 4.9257 Constraint 1008 1703 4.4826 5.6033 11.2066 4.9105 Constraint 564 639 4.2033 5.2541 10.5082 4.8926 Constraint 1109 1764 4.5252 5.6565 11.3131 4.8881 Constraint 1030 1703 5.0952 6.3690 12.7380 4.8581 Constraint 1301 1777 4.1778 5.2222 10.4444 4.8056 Constraint 104 665 5.6751 7.0939 14.1878 4.8030 Constraint 241 384 5.0353 6.2941 12.5882 4.8010 Constraint 1276 1777 4.1173 5.1467 10.2933 4.7900 Constraint 1092 1228 5.7273 7.1591 14.3182 4.7862 Constraint 299 921 6.1952 7.7440 15.4881 4.7839 Constraint 1301 1788 4.6343 5.7928 11.5857 4.7674 Constraint 1268 1777 5.0698 6.3372 12.6744 4.7674 Constraint 154 421 4.6679 5.8348 11.6697 4.7569 Constraint 241 363 4.8407 6.0509 12.1019 4.7558 Constraint 1084 1178 4.3058 5.3823 10.7646 4.7167 Constraint 274 884 5.0019 6.2524 12.5048 4.7143 Constraint 128 1084 5.6212 7.0266 14.0531 4.7143 Constraint 572 650 6.0321 7.5402 15.0803 4.6274 Constraint 256 375 5.0213 6.2766 12.5533 4.6098 Constraint 154 572 5.1428 6.4285 12.8569 4.5983 Constraint 128 572 5.4000 6.7499 13.4999 4.5801 Constraint 216 384 5.0758 6.3448 12.6896 4.5761 Constraint 233 355 4.7781 5.9726 11.9452 4.5571 Constraint 154 756 6.1326 7.6657 15.3315 4.5532 Constraint 274 392 5.5527 6.9408 13.8817 4.5425 Constraint 154 443 3.8733 4.8417 9.6834 4.5385 Constraint 299 848 5.8350 7.2938 14.5876 4.5262 Constraint 1117 1703 5.8266 7.2833 14.5665 4.5236 Constraint 121 466 5.0894 6.3617 12.7234 4.5174 Constraint 549 673 4.2606 5.3257 10.6514 4.5168 Constraint 650 1756 4.6509 5.8137 11.6274 4.5158 Constraint 180 412 5.5768 6.9710 13.9421 4.5102 Constraint 1133 1731 4.1768 5.2210 10.4420 4.5055 Constraint 1133 1246 5.0247 6.2809 12.5618 4.4739 Constraint 121 443 5.1775 6.4718 12.9437 4.4723 Constraint 189 421 5.0261 6.2826 12.5652 4.4410 Constraint 294 392 4.1169 5.1461 10.2923 4.4345 Constraint 285 921 4.4713 5.5891 11.1781 4.3882 Constraint 154 448 5.5140 6.8924 13.7849 4.3432 Constraint 930 1455 5.5586 6.9482 13.8965 4.2916 Constraint 921 1455 5.3830 6.7288 13.4575 4.2776 Constraint 128 1092 5.7008 7.1260 14.2519 4.2606 Constraint 154 731 5.8909 7.3636 14.7273 4.2590 Constraint 549 665 4.8110 6.0138 12.0276 4.2520 Constraint 1167 1703 4.2995 5.3744 10.7488 4.2339 Constraint 1246 1703 4.4396 5.5495 11.0989 4.2327 Constraint 1293 1703 5.3054 6.6318 13.2636 4.2104 Constraint 899 1526 5.7790 7.2238 14.4476 4.1969 Constraint 233 722 6.2589 7.8237 15.6473 4.1525 Constraint 299 944 6.1694 7.7117 15.4235 4.1306 Constraint 249 944 4.9419 6.1774 12.3549 4.1229 Constraint 285 944 4.2740 5.3424 10.6849 4.1124 Constraint 274 988 5.5776 6.9721 13.9441 4.1051 Constraint 1133 1239 4.4761 5.5952 11.1903 4.0723 Constraint 274 921 5.7482 7.1852 14.3704 4.0689 Constraint 876 1503 5.7081 7.1351 14.2702 4.0562 Constraint 249 955 5.1190 6.3987 12.7975 4.0355 Constraint 1133 1739 5.0284 6.2855 12.5711 4.0323 Constraint 1133 1756 5.1256 6.4070 12.8140 4.0167 Constraint 1084 1260 4.6956 5.8695 11.7391 3.9816 Constraint 1133 1204 5.1002 6.3752 12.7505 3.9516 Constraint 1084 1239 3.8144 4.7680 9.5360 3.9478 Constraint 97 493 4.5315 5.6643 11.3286 3.8410 Constraint 355 808 6.3043 7.8803 15.7606 3.8387 Constraint 384 829 5.9415 7.4269 14.8539 3.8378 Constraint 222 980 5.4158 6.7697 13.5394 3.8326 Constraint 1678 1772 4.3725 5.4656 10.9312 3.8162 Constraint 121 698 6.2734 7.8418 15.6835 3.8130 Constraint 208 756 6.0459 7.5573 15.1147 3.8025 Constraint 164 1054 6.0212 7.5265 15.0529 3.8001 Constraint 1683 1772 3.3823 4.2278 8.4556 3.7994 Constraint 154 1084 5.5975 6.9969 13.9939 3.7968 Constraint 241 1014 4.0540 5.0676 10.1351 3.7881 Constraint 1077 1213 5.6841 7.1051 14.2102 3.7872 Constraint 1246 1720 6.0049 7.5061 15.0123 3.7849 Constraint 1268 1756 5.0071 6.2589 12.5178 3.7818 Constraint 233 783 6.0701 7.5876 15.1752 3.7788 Constraint 91 493 6.3077 7.8846 15.7692 3.7788 Constraint 180 731 5.9159 7.3948 14.7897 3.7776 Constraint 222 1008 5.8237 7.2797 14.5594 3.7720 Constraint 1683 1764 5.6576 7.0720 14.1441 3.7632 Constraint 681 1662 6.3697 7.9621 15.9241 3.7632 Constraint 657 1714 6.2671 7.8339 15.6677 3.7632 Constraint 216 1035 5.8053 7.2567 14.5134 3.7632 Constraint 154 1059 6.3287 7.9108 15.8216 3.7632 Constraint 154 690 4.7269 5.9086 11.8172 3.7632 Constraint 145 698 6.3720 7.9650 15.9301 3.7632 Constraint 241 392 5.9386 7.4232 14.8464 3.7507 Constraint 899 1447 5.5841 6.9801 13.9602 3.6821 Constraint 97 501 5.0361 6.2952 12.5904 3.6620 Constraint 180 501 5.5012 6.8765 13.7530 3.6490 Constraint 448 808 6.2525 7.8156 15.6312 3.6076 Constraint 1351 1649 5.2738 6.5922 13.1844 3.5704 Constraint 263 368 6.0004 7.5005 15.0010 3.5270 Constraint 222 800 4.4929 5.6161 11.2322 3.5206 Constraint 1193 1703 4.5842 5.7302 11.4604 3.5136 Constraint 884 1567 6.0816 7.6020 15.2040 3.5060 Constraint 1059 1720 5.2224 6.5280 13.0560 3.4925 Constraint 538 608 5.7881 7.2352 14.4703 3.4833 Constraint 892 1488 6.0072 7.5090 15.0181 3.4776 Constraint 1068 1204 6.1380 7.6725 15.3450 3.4726 Constraint 285 384 5.1491 6.4363 12.8726 3.3980 Constraint 121 608 6.2937 7.8671 15.7342 3.3931 Constraint 579 650 5.9932 7.4915 14.9830 3.3721 Constraint 1054 1720 4.2720 5.3400 10.6800 3.3598 Constraint 1228 1764 5.4470 6.8087 13.6175 3.3268 Constraint 363 778 4.9467 6.1834 12.3669 3.3224 Constraint 363 800 6.2051 7.7564 15.5127 3.3026 Constraint 530 597 4.1813 5.2267 10.4534 3.3018 Constraint 306 829 5.8643 7.3304 14.6608 3.2925 Constraint 1008 1382 5.4980 6.8725 13.7449 3.2561 Constraint 1084 1268 4.9084 6.1355 12.2711 3.2289 Constraint 1133 1260 4.6093 5.7616 11.5231 3.2107 Constraint 1035 1731 4.3750 5.4688 10.9376 3.1999 Constraint 241 1008 6.2525 7.8156 15.6312 3.1967 Constraint 800 968 5.5923 6.9904 13.9808 3.1908 Constraint 1100 1246 5.7956 7.2445 14.4889 3.1815 Constraint 1317 1603 5.3795 6.7244 13.4488 3.1674 Constraint 392 778 5.8297 7.2871 14.5743 3.1598 Constraint 1358 1657 5.9400 7.4250 14.8500 3.1453 Constraint 1030 1731 5.0331 6.2913 12.5827 3.1352 Constraint 355 908 5.9500 7.4375 14.8750 3.1229 Constraint 128 630 5.1526 6.4408 12.8816 3.1133 Constraint 241 333 5.7374 7.1717 14.3435 3.0973 Constraint 363 783 4.8257 6.0321 12.0642 3.0945 Constraint 1092 1213 4.5150 5.6438 11.2876 3.0791 Constraint 145 549 6.3011 7.8764 15.7527 3.0648 Constraint 1220 1731 5.5788 6.9735 13.9470 3.0640 Constraint 1068 1239 5.9616 7.4520 14.9041 3.0600 Constraint 429 836 5.9146 7.3932 14.7865 3.0480 Constraint 1133 1764 3.8440 4.8050 9.6100 3.0374 Constraint 1035 1325 5.3184 6.6480 13.2960 3.0267 Constraint 980 1447 5.7398 7.1747 14.3495 3.0247 Constraint 368 783 4.5372 5.6715 11.3429 3.0220 Constraint 1317 1611 4.5198 5.6497 11.2994 3.0125 Constraint 222 1670 6.2136 7.7670 15.5340 3.0125 Constraint 1100 1220 5.7704 7.2130 14.4261 3.0105 Constraint 392 761 5.7810 7.2262 14.4525 3.0105 Constraint 392 756 4.9300 6.1625 12.3251 3.0105 Constraint 1293 1731 3.8573 4.8216 9.6433 3.0090 Constraint 1408 1596 5.4980 6.8725 13.7450 2.9915 Constraint 256 421 4.7277 5.9097 11.8194 2.9514 Constraint 1239 1772 4.8045 6.0056 12.0112 2.9469 Constraint 82 521 5.5861 6.9826 13.9653 2.9421 Constraint 980 1408 3.9597 4.9496 9.8991 2.9393 Constraint 1447 1596 4.9519 6.1899 12.3797 2.9373 Constraint 233 448 5.4999 6.8749 13.7498 2.9063 Constraint 836 944 5.7712 7.2140 14.4279 2.9029 Constraint 1301 1764 5.0179 6.2723 12.5446 2.8919 Constraint 1408 1634 4.2303 5.2878 10.5756 2.8857 Constraint 164 690 6.0282 7.5352 15.0704 2.8527 Constraint 1084 1764 5.4370 6.7962 13.5924 2.8504 Constraint 579 657 4.2163 5.2704 10.5409 2.8434 Constraint 1479 1548 5.4877 6.8597 13.7194 2.8257 Constraint 829 980 4.2499 5.3124 10.6249 2.8247 Constraint 299 913 6.0623 7.5779 15.1558 2.8133 Constraint 189 769 5.1954 6.4943 12.9885 2.8130 Constraint 538 639 5.1941 6.4926 12.9852 2.8049 Constraint 1317 1678 6.0169 7.5211 15.0422 2.7878 Constraint 1035 1351 4.0936 5.1169 10.2339 2.7813 Constraint 274 384 4.2536 5.3170 10.6340 2.7812 Constraint 1246 1788 4.1237 5.1546 10.3093 2.7610 Constraint 82 557 5.9936 7.4920 14.9840 2.7561 Constraint 1109 1213 4.9369 6.1711 12.3423 2.7547 Constraint 314 829 6.0271 7.5338 15.0677 2.7382 Constraint 530 650 6.2004 7.7505 15.5011 2.7087 Constraint 249 988 5.5658 6.9573 13.9146 2.7059 Constraint 808 980 5.6007 7.0008 14.0017 2.6871 Constraint 1030 1416 4.8459 6.0574 12.1149 2.6848 Constraint 557 630 5.3841 6.7301 13.4602 2.6636 Constraint 778 1008 4.7179 5.8973 11.7946 2.6508 Constraint 216 363 4.6130 5.7663 11.5325 2.6446 Constraint 848 944 3.9432 4.9290 9.8580 2.6431 Constraint 944 1447 5.0916 6.3644 12.7289 2.6389 Constraint 1117 1228 5.4070 6.7587 13.5175 2.6306 Constraint 233 363 4.5874 5.7342 11.4684 2.6301 Constraint 899 1455 5.3443 6.6804 13.3609 2.6117 Constraint 980 1382 4.4932 5.6165 11.2330 2.6072 Constraint 1125 1239 5.3769 6.7211 13.4422 2.6005 Constraint 314 836 4.5386 5.6733 11.3466 2.5998 Constraint 808 1008 4.4936 5.6170 11.2339 2.5893 Constraint 1014 1351 5.5039 6.8799 13.7598 2.5849 Constraint 233 808 6.1240 7.6550 15.3100 2.5838 Constraint 1054 1756 5.0845 6.3556 12.7112 2.5725 Constraint 944 1649 5.3779 6.7224 13.4447 2.5720 Constraint 1117 1204 4.7732 5.9665 11.9329 2.5609 Constraint 1351 1678 3.6481 4.5601 9.1202 2.5257 Constraint 233 325 4.5005 5.6256 11.2512 2.5200 Constraint 1077 1720 5.7182 7.1478 14.2955 2.5193 Constraint 1035 1720 5.4197 6.7747 13.5493 2.5151 Constraint 829 1408 4.3852 5.4815 10.9629 2.5132 Constraint 1382 1657 4.3745 5.4681 10.9362 2.5120 Constraint 285 363 5.6304 7.0381 14.0761 2.4972 Constraint 859 1447 4.3876 5.4846 10.9691 2.4939 Constraint 1008 1670 4.7541 5.9426 11.8853 2.4879 Constraint 829 1008 5.0172 6.2714 12.5429 2.4800 Constraint 1084 1293 4.9525 6.1907 12.3813 2.4770 Constraint 955 1416 5.5247 6.9058 13.8117 2.4761 Constraint 208 466 5.4685 6.8356 13.6712 2.4736 Constraint 216 392 5.4029 6.7536 13.5073 2.4714 Constraint 1035 1756 4.5497 5.6872 11.3744 2.4704 Constraint 980 1416 5.2832 6.6040 13.2079 2.4697 Constraint 859 944 4.5248 5.6561 11.3121 2.4684 Constraint 299 859 5.9190 7.3988 14.7975 2.4651 Constraint 997 1703 6.3321 7.9151 15.8302 2.4597 Constraint 66 597 5.1861 6.4826 12.9651 2.4592 Constraint 1008 1731 5.2707 6.5884 13.1769 2.4582 Constraint 1117 1239 4.0938 5.1173 10.2346 2.4488 Constraint 1246 1777 5.8193 7.2741 14.5483 2.4468 Constraint 66 589 6.2162 7.7703 15.5406 2.4436 Constraint 756 1317 4.1688 5.2110 10.4221 2.4416 Constraint 968 1670 6.0011 7.5014 15.0027 2.4350 Constraint 299 868 4.5350 5.6687 11.3374 2.4297 Constraint 1084 1213 3.9687 4.9608 9.9217 2.4277 Constraint 249 829 5.6628 7.0785 14.1570 2.4208 Constraint 748 1030 5.5169 6.8961 13.7923 2.4155 Constraint 1455 1567 5.8741 7.3426 14.6853 2.4153 Constraint 829 1670 5.7204 7.1505 14.3010 2.4126 Constraint 818 1670 4.2318 5.2897 10.5795 2.4126 Constraint 1035 1317 6.0465 7.5581 15.1162 2.4054 Constraint 908 1455 5.7423 7.1779 14.3558 2.4047 Constraint 980 1374 6.0987 7.6234 15.2468 2.4028 Constraint 1035 1764 5.3880 6.7350 13.4700 2.3957 Constraint 1008 1720 5.5293 6.9116 13.8232 2.3957 Constraint 818 1703 6.3219 7.9023 15.8047 2.3957 Constraint 818 1692 4.3925 5.4906 10.9812 2.3957 Constraint 818 1662 5.7307 7.1633 14.3266 2.3957 Constraint 800 1720 6.2003 7.7504 15.5007 2.3957 Constraint 792 1720 5.6332 7.0415 14.0830 2.3957 Constraint 792 1692 5.2396 6.5495 13.0990 2.3957 Constraint 769 1756 5.4442 6.8052 13.6105 2.3957 Constraint 769 1748 5.5541 6.9426 13.8852 2.3957 Constraint 769 1720 4.0672 5.0841 10.1681 2.3957 Constraint 739 1756 6.2104 7.7630 15.5260 2.3957 Constraint 739 1748 5.1165 6.3956 12.7912 2.3957 Constraint 249 1008 4.0982 5.1228 10.2455 2.3938 Constraint 333 808 3.4786 4.3482 8.6964 2.3937 Constraint 778 1351 4.7699 5.9623 11.9246 2.3901 Constraint 256 412 4.9446 6.1807 12.3615 2.3851 Constraint 1030 1447 4.4418 5.5522 11.1045 2.3605 Constraint 921 1447 3.9118 4.8898 9.7796 2.3590 Constraint 314 868 5.5722 6.9653 13.9305 2.3531 Constraint 347 808 6.0661 7.5826 15.1653 2.3504 Constraint 808 1408 5.8024 7.2530 14.5060 2.3431 Constraint 274 848 5.3505 6.6881 13.3761 2.3189 Constraint 1084 1246 4.7458 5.9322 11.8644 2.3137 Constraint 172 493 5.3183 6.6479 13.2957 2.3119 Constraint 274 421 4.7581 5.9476 11.8952 2.3065 Constraint 778 1035 3.9928 4.9910 9.9821 2.3023 Constraint 808 1382 4.9807 6.2259 12.4518 2.2984 Constraint 756 1351 5.7679 7.2098 14.4197 2.2962 Constraint 128 639 5.6554 7.0693 14.1386 2.2952 Constraint 154 639 5.3562 6.6952 13.3904 2.2933 Constraint 145 530 4.0332 5.0415 10.0831 2.2867 Constraint 347 836 6.3712 7.9641 15.9281 2.2796 Constraint 97 657 5.1557 6.4447 12.8893 2.2775 Constraint 783 1343 4.2758 5.3448 10.6895 2.2747 Constraint 145 521 4.9591 6.1989 12.3977 2.2730 Constraint 314 859 5.2358 6.5447 13.0894 2.2723 Constraint 836 1408 4.5761 5.7201 11.4402 2.2687 Constraint 808 1374 3.0506 3.8133 7.6266 2.2627 Constraint 256 921 5.0919 6.3649 12.7298 2.2619 Constraint 639 1756 4.1538 5.1922 10.3845 2.2579 Constraint 66 564 4.6561 5.8201 11.6401 2.2579 Constraint 1167 1720 6.1458 7.6823 15.3645 2.2534 Constraint 778 1317 6.0113 7.5141 15.0282 2.2490 Constraint 859 1408 3.8322 4.7903 9.5806 2.2445 Constraint 1133 1213 4.4200 5.5250 11.0499 2.2387 Constraint 1239 1678 3.9861 4.9826 9.9652 2.2372 Constraint 756 1035 4.7522 5.9403 11.8806 2.2366 Constraint 1167 1731 3.7707 4.7133 9.4267 2.2099 Constraint 756 1293 5.7367 7.1709 14.3418 2.2048 Constraint 1471 1567 4.1876 5.2345 10.4690 2.2035 Constraint 1077 1756 4.2473 5.3092 10.6184 2.2028 Constraint 1351 1587 4.8788 6.0985 12.1970 2.2009 Constraint 1059 1764 5.0244 6.2805 12.5610 2.1903 Constraint 25 128 4.7758 5.9697 11.9395 2.1873 Constraint 180 448 5.4289 6.7861 13.5723 2.1851 Constraint 778 1030 4.2436 5.3045 10.6090 2.1843 Constraint 997 1455 4.9378 6.1723 12.3446 2.1809 Constraint 1293 1748 5.3001 6.6252 13.2503 2.1793 Constraint 1084 1748 5.9832 7.4790 14.9581 2.1699 Constraint 836 1374 3.7097 4.6372 9.2744 2.1590 Constraint 778 1054 5.5063 6.8829 13.7658 2.1546 Constraint 1117 1213 3.9819 4.9773 9.9546 2.1493 Constraint 859 980 6.1495 7.6869 15.3738 2.1486 Constraint 233 375 5.0223 6.2779 12.5559 2.1462 Constraint 1382 1548 4.9699 6.2124 12.4247 2.1343 Constraint 921 1488 5.8370 7.2963 14.5925 2.1292 Constraint 1325 1703 5.9096 7.3870 14.7740 2.1288 Constraint 836 1399 4.6593 5.8242 11.6484 2.1236 Constraint 1239 1703 5.3683 6.7103 13.4207 2.1219 Constraint 921 1438 5.4230 6.7787 13.5574 2.1207 Constraint 77 597 6.3332 7.9165 15.8330 2.1200 Constraint 104 1084 6.3404 7.9255 15.8510 2.1159 Constraint 1014 1382 3.9451 4.9314 9.8628 2.1110 Constraint 1054 1764 4.9750 6.2187 12.4374 2.1103 Constraint 164 657 6.1975 7.7469 15.4939 2.1097 Constraint 955 1447 3.8862 4.8577 9.7154 2.1064 Constraint 1022 1309 4.2271 5.2838 10.5676 2.1041 Constraint 1260 1739 5.7985 7.2482 14.4964 2.1038 Constraint 25 112 4.5003 5.6254 11.2508 2.1035 Constraint 955 1408 5.5348 6.9185 13.8370 2.0977 Constraint 783 1317 4.0115 5.0144 10.0288 2.0970 Constraint 263 375 6.0270 7.5338 15.0676 2.0886 Constraint 955 1471 5.3545 6.6932 13.3863 2.0873 Constraint 829 1374 5.2482 6.5602 13.1204 2.0827 Constraint 1059 1293 5.2790 6.5988 13.1976 2.0823 Constraint 256 363 5.5286 6.9107 13.8214 2.0803 Constraint 868 1438 5.2386 6.5483 13.0965 2.0758 Constraint 249 921 4.4962 5.6202 11.2405 2.0716 Constraint 722 1054 3.6855 4.6069 9.2138 2.0705 Constraint 77 616 5.7209 7.1512 14.3023 2.0673 Constraint 285 980 4.5033 5.6291 11.2581 2.0543 Constraint 25 650 5.9060 7.3825 14.7650 2.0536 Constraint 1678 1748 6.2008 7.7510 15.5021 2.0528 Constraint 808 1351 3.8592 4.8240 9.6480 2.0511 Constraint 249 884 5.6365 7.0457 14.0913 2.0504 Constraint 249 421 4.2892 5.3615 10.7231 2.0495 Constraint 761 1317 5.0546 6.3182 12.6364 2.0490 Constraint 1358 1764 6.0477 7.5596 15.1192 2.0420 Constraint 1683 1788 5.9502 7.4378 14.8756 2.0396 Constraint 859 1399 5.7947 7.2434 14.4868 2.0384 Constraint 1092 1239 5.5357 6.9196 13.8393 2.0380 Constraint 172 1059 5.4417 6.8021 13.6042 2.0332 Constraint 783 1351 4.3260 5.4075 10.8151 2.0305 Constraint 180 538 4.6824 5.8530 11.7059 2.0275 Constraint 988 1343 4.8325 6.0407 12.0813 2.0252 Constraint 963 1366 4.7164 5.8955 11.7911 2.0252 Constraint 1678 1788 6.0750 7.5938 15.1876 2.0240 Constraint 1167 1670 4.8916 6.1145 12.2290 2.0240 Constraint 859 1438 3.6585 4.5731 9.1462 2.0234 Constraint 808 1343 5.3915 6.7394 13.4788 2.0216 Constraint 25 136 4.8580 6.0725 12.1449 2.0198 Constraint 274 355 5.7497 7.1872 14.3743 2.0166 Constraint 1022 1447 5.4127 6.7658 13.5317 2.0157 Constraint 299 892 4.4223 5.5279 11.0559 2.0132 Constraint 1268 1788 4.5073 5.6342 11.2683 2.0083 Constraint 1167 1692 6.2319 7.7899 15.5797 2.0083 Constraint 1109 1739 5.0293 6.2866 12.5733 2.0083 Constraint 164 1703 6.2043 7.7554 15.5108 2.0083 Constraint 77 650 3.7937 4.7421 9.4842 2.0083 Constraint 25 121 5.9971 7.4963 14.9927 2.0083 Constraint 227 980 4.6282 5.7852 11.5704 1.9990 Constraint 808 1014 6.0645 7.5806 15.1612 1.9976 Constraint 1014 1358 6.0399 7.5499 15.0998 1.9828 Constraint 196 1054 5.3933 6.7416 13.4832 1.9827 Constraint 136 1117 4.4926 5.6157 11.2314 1.9810 Constraint 1220 1764 5.2417 6.5521 13.1042 1.9617 Constraint 1416 1634 5.6517 7.0647 14.1294 1.9591 Constraint 818 1611 4.6913 5.8641 11.7281 1.9471 Constraint 698 1260 5.0800 6.3500 12.6999 1.9426 Constraint 249 808 5.6559 7.0699 14.1399 1.9396 Constraint 306 384 4.7424 5.9280 11.8560 1.9395 Constraint 97 564 5.1711 6.4639 12.9278 1.9387 Constraint 306 392 4.9375 6.1719 12.3438 1.9382 Constraint 579 665 3.7873 4.7341 9.4683 1.9260 Constraint 530 639 4.9465 6.1831 12.3663 1.9254 Constraint 944 1620 5.1048 6.3810 12.7620 1.9243 Constraint 128 1059 4.1846 5.2308 10.4616 1.9200 Constraint 1408 1556 5.5272 6.9089 13.8179 1.9186 Constraint 274 347 5.9130 7.3912 14.7825 1.9179 Constraint 1479 1567 3.8643 4.8304 9.6608 1.9166 Constraint 112 557 6.2284 7.7855 15.5710 1.8971 Constraint 66 579 4.4839 5.6048 11.2097 1.8933 Constraint 227 1035 5.4794 6.8493 13.6986 1.8859 Constraint 800 1649 6.0646 7.5808 15.1615 1.8843 Constraint 968 1649 4.1100 5.1375 10.2750 1.8818 Constraint 1276 1739 4.7213 5.9016 11.8033 1.8736 Constraint 274 836 4.5877 5.7346 11.4692 1.8705 Constraint 884 1438 5.2026 6.5033 13.0065 1.8665 Constraint 557 657 4.9730 6.2163 12.4326 1.8550 Constraint 1117 1220 4.3406 5.4258 10.8515 1.8525 Constraint 698 1084 4.5637 5.7046 11.4091 1.8495 Constraint 299 884 4.7913 5.9892 11.9784 1.8471 Constraint 1109 1228 5.3834 6.7293 13.4586 1.8469 Constraint 899 1556 3.6216 4.5270 9.0541 1.8432 Constraint 913 1408 4.7079 5.8848 11.7697 1.8415 Constraint 1293 1374 5.5282 6.9103 13.8205 1.8406 Constraint 756 1054 4.0732 5.0915 10.1830 1.8371 Constraint 1109 1260 5.0282 6.2853 12.5705 1.8349 Constraint 1059 1325 5.5054 6.8818 13.7635 1.8307 Constraint 848 1587 4.1073 5.1342 10.2684 1.8304 Constraint 294 892 4.6422 5.8028 11.6056 1.8216 Constraint 172 443 5.0338 6.2923 12.5846 1.8214 Constraint 208 530 4.2200 5.2751 10.5501 1.8193 Constraint 1382 1649 6.0122 7.5152 15.0304 1.8130 Constraint 274 913 4.7635 5.9544 11.9087 1.8111 Constraint 997 1678 5.9143 7.3929 14.7859 1.8086 Constraint 233 530 5.6484 7.0605 14.1209 1.8044 Constraint 731 1293 5.4292 6.7865 13.5730 1.8022 Constraint 868 1541 5.9045 7.3806 14.7612 1.8018 Constraint 208 557 5.8691 7.3363 14.6727 1.7956 Constraint 306 884 4.8158 6.0197 12.0394 1.7949 Constraint 884 1447 5.5514 6.9393 13.8786 1.7938 Constraint 1239 1756 5.6661 7.0826 14.1651 1.7917 Constraint 748 1703 6.1513 7.6892 15.3783 1.7900 Constraint 778 1670 6.0909 7.6136 15.2272 1.7881 Constraint 196 1008 5.9037 7.3796 14.7592 1.7858 Constraint 748 1692 4.0609 5.0761 10.1523 1.7795 Constraint 921 1596 5.8255 7.2819 14.5638 1.7794 Constraint 501 756 4.7430 5.9287 11.8575 1.7777 Constraint 1125 1213 5.1761 6.4701 12.9402 1.7755 Constraint 899 1596 5.7197 7.1496 14.2992 1.7724 Constraint 325 1620 5.4389 6.7986 13.5973 1.7724 Constraint 294 800 6.2611 7.8264 15.6528 1.7724 Constraint 713 1714 4.2249 5.2811 10.5622 1.7712 Constraint 690 1748 4.5666 5.7083 11.4166 1.7712 Constraint 876 1556 5.5248 6.9060 13.8120 1.7705 Constraint 731 1284 5.1730 6.4662 12.9325 1.7701 Constraint 1054 1408 5.3066 6.6332 13.2664 1.7649 Constraint 756 1059 5.5488 6.9360 13.8720 1.7590 Constraint 1109 1788 4.5161 5.6452 11.2903 1.7568 Constraint 1046 1703 5.7749 7.2186 14.4372 1.7568 Constraint 769 1662 4.4437 5.5546 11.1093 1.7568 Constraint 739 1692 4.6231 5.7789 11.5579 1.7568 Constraint 722 1720 6.2148 7.7685 15.5371 1.7568 Constraint 690 1756 6.0842 7.6053 15.2105 1.7568 Constraint 681 1748 3.9863 4.9828 9.9657 1.7568 Constraint 657 1777 3.3275 4.1594 8.3188 1.7568 Constraint 657 1772 5.6375 7.0469 14.0937 1.7568 Constraint 274 1670 5.5033 6.8791 13.7582 1.7568 Constraint 1325 1408 4.9504 6.1880 12.3759 1.7513 Constraint 314 892 5.7278 7.1597 14.3195 1.7492 Constraint 968 1678 6.1444 7.6805 15.3610 1.7460 Constraint 208 421 4.6623 5.8278 11.6557 1.7377 Constraint 1408 1526 5.8473 7.3092 14.6184 1.7362 Constraint 1035 1293 4.6812 5.8515 11.7029 1.7274 Constraint 77 530 5.9058 7.3822 14.7645 1.7257 Constraint 145 466 5.0200 6.2750 12.5500 1.7233 Constraint 299 908 5.9321 7.4151 14.8303 1.7189 Constraint 1228 1678 5.4701 6.8376 13.6753 1.7097 Constraint 294 913 5.0259 6.2824 12.5648 1.7094 Constraint 1008 1325 4.8845 6.1056 12.2111 1.7057 Constraint 189 501 5.4448 6.8060 13.6119 1.7052 Constraint 1133 1228 5.0408 6.3010 12.6020 1.7005 Constraint 196 1204 4.2849 5.3561 10.7123 1.6962 Constraint 876 1471 6.1688 7.7110 15.4220 1.6946 Constraint 1014 1670 5.7061 7.1326 14.2652 1.6936 Constraint 722 1077 3.3717 4.2147 8.4294 1.6871 Constraint 172 530 5.3821 6.7277 13.4553 1.6869 Constraint 756 1084 5.7146 7.1433 14.2866 1.6815 Constraint 128 1109 5.5230 6.9037 13.8074 1.6756 Constraint 222 808 6.1401 7.6751 15.3502 1.6750 Constraint 564 657 4.2505 5.3132 10.6263 1.6740 Constraint 285 392 4.5024 5.6280 11.2561 1.6734 Constraint 1268 1649 3.9308 4.9135 9.8270 1.6720 Constraint 673 1204 6.1420 7.6775 15.3549 1.6672 Constraint 241 443 4.1038 5.1297 10.2594 1.6661 Constraint 1084 1204 5.2811 6.6014 13.2028 1.6647 Constraint 1109 1220 6.2682 7.8352 15.6704 1.6627 Constraint 557 690 4.5890 5.7362 11.4725 1.6627 Constraint 1141 1239 4.2931 5.3664 10.7328 1.6603 Constraint 227 448 4.8856 6.1070 12.2141 1.6595 Constraint 1427 1678 5.8708 7.3385 14.6770 1.6569 Constraint 1030 1455 4.7691 5.9614 11.9228 1.6520 Constraint 731 1054 5.9294 7.4117 14.8234 1.6493 Constraint 1092 1220 5.2730 6.5913 13.1826 1.6492 Constraint 189 1054 5.6989 7.1237 14.2473 1.6461 Constraint 208 412 5.5801 6.9751 13.9502 1.6451 Constraint 1268 1657 4.9255 6.1568 12.3136 1.6398 Constraint 731 1084 4.3643 5.4553 10.9106 1.6377 Constraint 154 748 6.0860 7.6075 15.2150 1.6349 Constraint 623 748 5.8514 7.3143 14.6286 1.6291 Constraint 196 980 4.0820 5.1024 10.2049 1.6258 Constraint 216 800 4.8554 6.0693 12.1386 1.6252 Constraint 1054 1246 5.7746 7.2182 14.4364 1.6221 Constraint 299 1567 5.6478 7.0598 14.1195 1.6201 Constraint 249 836 4.8405 6.0506 12.1012 1.6147 Constraint 657 1193 6.3721 7.9651 15.9302 1.6115 Constraint 1399 1541 5.2508 6.5634 13.1269 1.6095 Constraint 848 1596 5.8533 7.3166 14.6332 1.6070 Constraint 97 630 5.2103 6.5128 13.0256 1.6032 Constraint 1239 1764 3.0280 3.7850 7.5700 1.6008 Constraint 164 1756 6.1949 7.7437 15.4874 1.5971 Constraint 227 921 6.2771 7.8463 15.6927 1.5889 Constraint 189 1756 6.0270 7.5338 15.0675 1.5889 Constraint 66 623 6.3554 7.9443 15.8885 1.5871 Constraint 112 493 6.2900 7.8625 15.7251 1.5844 Constraint 997 1479 4.0197 5.0246 10.0492 1.5827 Constraint 1077 1317 4.4315 5.5394 11.0788 1.5814 Constraint 731 1260 5.1073 6.3841 12.7682 1.5787 Constraint 256 347 4.5233 5.6541 11.3082 1.5761 Constraint 128 1035 5.5400 6.9250 13.8500 1.5726 Constraint 227 955 4.7280 5.9099 11.8199 1.5719 Constraint 521 589 4.4405 5.5506 11.1013 1.5716 Constraint 136 1109 5.9355 7.4194 14.8388 1.5698 Constraint 196 988 6.3155 7.8944 15.7887 1.5694 Constraint 557 681 4.7986 5.9982 11.9964 1.5687 Constraint 1374 1548 5.4216 6.7770 13.5541 1.5659 Constraint 722 1046 6.2597 7.8247 15.6494 1.5658 Constraint 876 1541 6.0044 7.5055 15.0110 1.5653 Constraint 189 1030 3.9335 4.9168 9.8337 1.5606 Constraint 314 884 4.6932 5.8665 11.7331 1.5582 Constraint 1084 1228 5.4986 6.8732 13.7464 1.5561 Constraint 104 1059 5.1078 6.3847 12.7694 1.5560 Constraint 66 493 6.2358 7.7947 15.5894 1.5547 Constraint 1351 1620 4.4306 5.5382 11.0765 1.5526 Constraint 639 1193 5.0873 6.3591 12.7181 1.5523 Constraint 698 1109 3.4118 4.2648 8.5296 1.5514 Constraint 673 1228 4.9364 6.1706 12.3411 1.5510 Constraint 1092 1293 5.8794 7.3492 14.6985 1.5504 Constraint 884 1541 5.4948 6.8685 13.7371 1.5497 Constraint 988 1479 5.5049 6.8811 13.7623 1.5490 Constraint 1193 1720 6.2747 7.8434 15.6867 1.5487 Constraint 564 690 4.3108 5.3885 10.7769 1.5447 Constraint 91 564 5.4223 6.7779 13.5558 1.5407 Constraint 227 944 6.2072 7.7589 15.5179 1.5394 Constraint 180 748 5.8678 7.3348 14.6695 1.5394 Constraint 164 1014 4.1755 5.2194 10.4387 1.5394 Constraint 97 1068 5.0308 6.2885 12.5769 1.5394 Constraint 97 1059 5.4663 6.8329 13.6658 1.5394 Constraint 955 1455 6.2951 7.8688 15.7377 1.5359 Constraint 937 1634 6.0180 7.5224 15.0449 1.5328 Constraint 263 347 5.4251 6.7814 13.5628 1.5327 Constraint 713 1077 6.2181 7.7726 15.5452 1.5304 Constraint 121 501 4.9850 6.2312 12.4624 1.5302 Constraint 104 1117 6.1849 7.7312 15.4624 1.5302 Constraint 980 1351 5.1470 6.4338 12.8676 1.5290 Constraint 241 1634 6.1674 7.7092 15.4184 1.5279 Constraint 97 549 5.8840 7.3549 14.7099 1.5279 Constraint 91 579 5.4993 6.8741 13.7483 1.5270 Constraint 630 1720 5.2685 6.5856 13.1712 1.5209 Constraint 91 549 5.0509 6.3136 12.6272 1.5209 Constraint 91 530 4.9782 6.2227 12.4454 1.5209 Constraint 1293 1596 5.4772 6.8464 13.6929 1.5208 Constraint 189 800 5.6485 7.0606 14.1213 1.5198 Constraint 1293 1408 5.5777 6.9722 13.9443 1.5185 Constraint 1109 1204 4.1780 5.2225 10.4450 1.5140 Constraint 630 722 5.4170 6.7712 13.5424 1.5099 Constraint 630 713 3.9963 4.9953 9.9907 1.5099 Constraint 623 713 3.9859 4.9824 9.9648 1.5099 Constraint 980 1670 5.3054 6.6317 13.2635 1.5087 Constraint 1077 1220 6.3736 7.9670 15.9340 1.5053 Constraint 1068 1228 4.3073 5.3841 10.7682 1.5053 Constraint 690 1193 4.7812 5.9765 11.9530 1.5053 Constraint 623 1720 4.2265 5.2831 10.5662 1.5053 Constraint 222 1193 6.2679 7.8348 15.6696 1.5053 Constraint 196 1193 5.9517 7.4396 14.8791 1.5053 Constraint 189 1193 5.6259 7.0324 14.0648 1.5053 Constraint 164 1204 5.8646 7.3307 14.6615 1.5053 Constraint 97 639 5.5959 6.9949 13.9897 1.5053 Constraint 66 530 4.9712 6.2140 12.4280 1.5053 Constraint 1479 1575 5.5808 6.9760 13.9520 1.5037 Constraint 1548 1649 5.9120 7.3900 14.7800 1.4982 Constraint 249 778 4.0932 5.1165 10.2330 1.4947 Constraint 623 722 4.2682 5.3353 10.6706 1.4882 Constraint 241 944 5.6240 7.0300 14.0600 1.4786 Constraint 189 997 5.6657 7.0821 14.1642 1.4745 Constraint 1268 1479 5.7835 7.2294 14.4589 1.4738 Constraint 1035 1268 5.7526 7.1907 14.3814 1.4734 Constraint 1054 1416 5.3255 6.6568 13.3137 1.4725 Constraint 263 913 3.9697 4.9621 9.9243 1.4676 Constraint 1133 1220 5.4212 6.7765 13.5529 1.4595 Constraint 1167 1596 5.1274 6.4093 12.8186 1.4587 Constraint 892 1596 5.7439 7.1799 14.3597 1.4582 Constraint 944 1382 5.2363 6.5453 13.0907 1.4577 Constraint 1158 1228 4.9154 6.1443 12.2886 1.4540 Constraint 1276 1479 5.0980 6.3725 12.7449 1.4288 Constraint 1084 1649 4.3779 5.4723 10.9447 1.4250 Constraint 392 848 5.5542 6.9428 13.8856 1.4246 Constraint 1471 1556 6.0159 7.5199 15.0398 1.4239 Constraint 421 818 5.2881 6.6101 13.2203 1.4115 Constraint 1268 1503 5.2745 6.5931 13.1862 1.4067 Constraint 1246 1511 6.1086 7.6358 15.2715 1.4037 Constraint 1399 1556 5.1877 6.4847 12.9693 1.4029 Constraint 1030 1382 5.4209 6.7761 13.5523 1.3979 Constraint 1077 1284 5.5540 6.9425 13.8849 1.3968 Constraint 818 913 4.8388 6.0485 12.0970 1.3964 Constraint 963 1488 4.8989 6.1236 12.2472 1.3949 Constraint 1030 1374 4.5240 5.6551 11.3101 1.3946 Constraint 1455 1603 6.2396 7.7995 15.5991 1.3887 Constraint 639 713 5.6625 7.0781 14.1562 1.3879 Constraint 216 521 5.6909 7.1136 14.2271 1.3860 Constraint 233 521 6.0440 7.5550 15.1101 1.3856 Constraint 639 722 4.5461 5.6826 11.3652 1.3841 Constraint 1391 1556 4.8726 6.0908 12.1816 1.3837 Constraint 1014 1596 5.6255 7.0319 14.0638 1.3835 Constraint 1077 1764 5.8326 7.2908 14.5816 1.3756 Constraint 665 1109 4.8845 6.1056 12.2113 1.3734 Constraint 285 800 5.8852 7.3565 14.7130 1.3728 Constraint 314 876 5.2322 6.5402 13.0805 1.3679 Constraint 1351 1575 4.8425 6.0531 12.1063 1.3630 Constraint 263 937 4.3153 5.3942 10.7883 1.3614 Constraint 1374 1634 5.8712 7.3390 14.6779 1.3548 Constraint 639 1204 5.3766 6.7207 13.4414 1.3532 Constraint 256 1008 4.6575 5.8219 11.6437 1.3531 Constraint 1391 1739 6.1543 7.6928 15.3857 1.3516 Constraint 263 884 4.2637 5.3296 10.6593 1.3485 Constraint 1054 1382 5.2532 6.5665 13.1330 1.3476 Constraint 1260 1494 4.0334 5.0417 10.0834 1.3446 Constraint 1213 1678 4.1633 5.2041 10.4082 1.3438 Constraint 1276 1649 4.4817 5.6021 11.2041 1.3339 Constraint 222 968 5.6482 7.0602 14.1204 1.3329 Constraint 739 1777 4.1727 5.2158 10.4317 1.3320 Constraint 530 713 4.1761 5.2202 10.4404 1.3250 Constraint 294 368 6.0668 7.5835 15.1670 1.3204 Constraint 1382 1556 4.5002 5.6253 11.2506 1.3197 Constraint 673 1167 5.0337 6.2921 12.5842 1.3175 Constraint 722 1109 5.8428 7.3035 14.6070 1.3153 Constraint 1260 1488 5.1314 6.4143 12.8286 1.3138 Constraint 241 968 4.0116 5.0145 10.0289 1.3098 Constraint 1567 1649 5.1168 6.3960 12.7919 1.3071 Constraint 208 1466 4.2096 5.2620 10.5241 1.3067 Constraint 216 1030 5.1055 6.3819 12.7638 1.3012 Constraint 216 997 3.6509 4.5636 9.1272 1.3006 Constraint 1260 1503 5.8064 7.2580 14.5161 1.2997 Constraint 1158 1239 5.0540 6.3174 12.6349 1.2980 Constraint 227 1008 5.7397 7.1746 14.3493 1.2918 Constraint 1046 1447 4.7382 5.9228 11.8456 1.2891 Constraint 1293 1382 5.5734 6.9667 13.9335 1.2887 Constraint 997 1488 4.5765 5.7206 11.4411 1.2850 Constraint 263 848 4.2724 5.3405 10.6811 1.2847 Constraint 263 968 5.7471 7.1839 14.3679 1.2821 Constraint 180 564 4.2468 5.3085 10.6170 1.2818 Constraint 208 997 5.3475 6.6844 13.3688 1.2801 Constraint 285 884 4.6342 5.7927 11.5854 1.2787 Constraint 1054 1374 5.1141 6.3927 12.7853 1.2750 Constraint 1260 1408 4.4280 5.5350 11.0700 1.2748 Constraint 189 1008 5.6479 7.0598 14.1196 1.2739 Constraint 306 421 5.2555 6.5693 13.1386 1.2731 Constraint 963 1503 3.9992 4.9991 9.9981 1.2724 Constraint 818 944 4.9208 6.1511 12.3021 1.2715 Constraint 443 792 5.1368 6.4210 12.8421 1.2669 Constraint 285 1008 4.3037 5.3797 10.7593 1.2656 Constraint 412 1438 5.4742 6.8427 13.6854 1.2639 Constraint 639 731 5.1279 6.4099 12.8199 1.2636 Constraint 285 899 5.1477 6.4346 12.8692 1.2636 Constraint 154 713 6.1428 7.6785 15.3570 1.2636 Constraint 77 1068 4.8617 6.0771 12.1542 1.2636 Constraint 1268 1488 4.1552 5.1940 10.3881 1.2626 Constraint 1276 1678 3.7477 4.6847 9.3693 1.2621 Constraint 1204 1488 5.8115 7.2644 14.5287 1.2591 Constraint 274 368 6.0858 7.6073 15.2145 1.2586 Constraint 968 1503 4.7647 5.9559 11.9118 1.2568 Constraint 249 384 5.3819 6.7273 13.4547 1.2562 Constraint 435 521 4.3542 5.4427 10.8854 1.2548 Constraint 876 1519 4.9767 6.2209 12.4419 1.2498 Constraint 1366 1567 4.2645 5.3306 10.6613 1.2462 Constraint 233 997 6.0491 7.5614 15.1228 1.2439 Constraint 384 848 5.5420 6.9275 13.8550 1.2436 Constraint 263 892 5.0204 6.2755 12.5511 1.2375 Constraint 713 1777 4.0821 5.1026 10.2053 1.2369 Constraint 698 1117 4.6221 5.7776 11.5553 1.2324 Constraint 227 1284 5.9123 7.3903 14.7807 1.2321 Constraint 1084 1678 4.6399 5.7999 11.5998 1.2282 Constraint 1035 1596 5.7368 7.1710 14.3420 1.2249 Constraint 1301 1714 5.9529 7.4411 14.8822 1.2246 Constraint 241 493 4.6155 5.7694 11.5387 1.2183 Constraint 256 913 5.7147 7.1433 14.2867 1.2167 Constraint 180 579 5.1868 6.4836 12.9671 1.2141 Constraint 521 713 4.3433 5.4292 10.8583 1.2116 Constraint 1141 1260 4.5065 5.6331 11.2662 1.2104 Constraint 249 392 4.4514 5.5642 11.1285 1.2094 Constraint 997 1503 5.1023 6.3778 12.7557 1.2082 Constraint 1141 1213 5.3513 6.6892 13.3784 1.2064 Constraint 196 443 5.9652 7.4565 14.9130 1.1979 Constraint 1301 1756 5.3894 6.7367 13.4734 1.1978 Constraint 1268 1494 6.0776 7.5970 15.1939 1.1968 Constraint 1239 1519 3.9447 4.9309 9.8619 1.1968 Constraint 1220 1714 4.7751 5.9689 11.9378 1.1968 Constraint 1220 1692 5.4501 6.8127 13.6253 1.1968 Constraint 1030 1408 4.0796 5.0995 10.1990 1.1937 Constraint 47 128 5.7166 7.1457 14.2915 1.1913 Constraint 665 1167 4.2123 5.2654 10.5308 1.1897 Constraint 1334 1764 4.4316 5.5394 11.0789 1.1891 Constraint 1391 1575 3.9002 4.8753 9.7506 1.1884 Constraint 299 412 5.7434 7.1792 14.3584 1.1878 Constraint 1054 1239 5.2847 6.6059 13.2118 1.1875 Constraint 1455 1703 6.0391 7.5489 15.0977 1.1867 Constraint 1416 1739 5.9211 7.4013 14.8027 1.1851 Constraint 384 818 4.0439 5.0549 10.1099 1.1835 Constraint 222 448 4.2745 5.3431 10.6862 1.1817 Constraint 1276 1358 5.2831 6.6039 13.2077 1.1803 Constraint 1141 1731 4.1890 5.2363 10.4725 1.1790 Constraint 1334 1720 4.6251 5.7814 11.5629 1.1751 Constraint 1325 1748 5.1840 6.4800 12.9600 1.1751 Constraint 1293 1764 5.4322 6.7903 13.5806 1.1751 Constraint 249 1133 5.0892 6.3615 12.7230 1.1749 Constraint 1141 1703 4.3028 5.3785 10.7570 1.1746 Constraint 241 848 4.9091 6.1364 12.2728 1.1718 Constraint 180 1466 6.2335 7.7919 15.5838 1.1708 Constraint 1239 1503 4.6995 5.8744 11.7488 1.1702 Constraint 233 937 4.1850 5.2312 10.4624 1.1681 Constraint 493 769 5.6684 7.0855 14.1710 1.1680 Constraint 937 1503 5.7115 7.1393 14.2787 1.1652 Constraint 180 1030 4.1799 5.2249 10.4499 1.1636 Constraint 913 1374 4.6719 5.8398 11.6796 1.1617 Constraint 1260 1703 5.8549 7.3187 14.6373 1.1603 Constraint 997 1611 5.0034 6.2542 12.5084 1.1596 Constraint 233 944 5.8097 7.2621 14.5241 1.1595 Constraint 1447 1634 5.8781 7.3476 14.6952 1.1573 Constraint 1548 1678 5.4201 6.7751 13.5503 1.1566 Constraint 1260 1479 5.1618 6.4522 12.9044 1.1529 Constraint 493 739 4.6605 5.8257 11.6513 1.1485 Constraint 530 722 5.5622 6.9528 13.9055 1.1482 Constraint 1133 1284 5.5365 6.9206 13.8412 1.1464 Constraint 980 1167 5.1111 6.3889 12.7777 1.1452 Constraint 216 1008 4.1557 5.1946 10.3891 1.1441 Constraint 493 713 4.5986 5.7483 11.4965 1.1423 Constraint 233 968 3.1938 3.9923 7.9846 1.1415 Constraint 180 1046 5.9151 7.3938 14.7877 1.1396 Constraint 1246 1503 5.5619 6.9523 13.9046 1.1386 Constraint 501 748 4.6495 5.8119 11.6238 1.1375 Constraint 848 1519 4.9216 6.1520 12.3040 1.1348 Constraint 222 1720 6.1258 7.6573 15.3146 1.1340 Constraint 1008 1408 4.4941 5.6176 11.2352 1.1337 Constraint 1268 1634 5.0414 6.3018 12.6035 1.1317 Constraint 355 876 5.2387 6.5483 13.0966 1.1313 Constraint 443 521 4.3879 5.4849 10.9698 1.1288 Constraint 1077 1374 5.5049 6.8812 13.7624 1.1286 Constraint 997 1447 4.3777 5.4721 10.9443 1.1279 Constraint 164 530 5.1700 6.4625 12.9250 1.1272 Constraint 222 421 3.8061 4.7576 9.5151 1.1257 Constraint 443 800 5.1973 6.4966 12.9933 1.1240 Constraint 306 913 5.0058 6.2573 12.5146 1.1200 Constraint 1293 1503 5.7322 7.1652 14.3304 1.1150 Constraint 299 876 5.9979 7.4974 14.9948 1.1140 Constraint 263 944 4.2810 5.3513 10.7026 1.1134 Constraint 180 997 4.5833 5.7291 11.4582 1.1124 Constraint 222 443 4.0191 5.0238 10.0477 1.1092 Constraint 913 1399 4.5179 5.6474 11.2948 1.1092 Constraint 876 1548 5.7013 7.1266 14.2532 1.1082 Constraint 1117 1756 5.8208 7.2760 14.5521 1.1074 Constraint 713 792 4.5314 5.6643 11.3286 1.1074 Constraint 1382 1596 5.1077 6.3846 12.7692 1.1051 Constraint 963 1519 6.0829 7.6036 15.2071 1.1036 Constraint 829 1620 6.0216 7.5270 15.0539 1.1017 Constraint 1054 1447 5.2527 6.5659 13.1317 1.1007 Constraint 944 1438 4.8106 6.0132 12.0265 1.1004 Constraint 1239 1788 5.0352 6.2939 12.5879 1.0997 Constraint 145 579 3.5836 4.4795 8.9589 1.0963 Constraint 216 968 3.7964 4.7455 9.4910 1.0962 Constraint 256 443 5.6036 7.0045 14.0089 1.0951 Constraint 443 530 5.1156 6.3945 12.7891 1.0896 Constraint 285 892 5.6521 7.0651 14.1302 1.0877 Constraint 196 479 4.9385 6.1731 12.3463 1.0862 Constraint 1167 1756 6.0602 7.5753 15.1506 1.0846 Constraint 1220 1670 5.2056 6.5070 13.0141 1.0829 Constraint 241 818 4.3155 5.3944 10.7888 1.0818 Constraint 1054 1351 5.0178 6.2723 12.5446 1.0809 Constraint 1325 1611 5.5864 6.9830 13.9660 1.0797 Constraint 1251 1494 5.3536 6.6921 13.3841 1.0782 Constraint 241 530 5.0443 6.3054 12.6108 1.0779 Constraint 1246 1494 5.4599 6.8249 13.6498 1.0779 Constraint 256 937 4.7772 5.9715 11.9430 1.0756 Constraint 1455 1678 5.1663 6.4579 12.9158 1.0741 Constraint 82 1100 5.6472 7.0590 14.1179 1.0733 Constraint 82 1092 5.1392 6.4240 12.8480 1.0733 Constraint 82 1068 4.8976 6.1220 12.2440 1.0733 Constraint 233 963 4.6181 5.7726 11.5452 1.0696 Constraint 1416 1731 4.7788 5.9735 11.9469 1.0692 Constraint 530 690 3.9096 4.8870 9.7741 1.0683 Constraint 154 579 5.6500 7.0625 14.1250 1.0648 Constraint 1239 1408 5.5016 6.8770 13.7539 1.0648 Constraint 1268 1720 4.3911 5.4888 10.9777 1.0627 Constraint 294 921 4.4894 5.6118 11.2235 1.0619 Constraint 39 128 4.7080 5.8850 11.7700 1.0615 Constraint 1251 1503 4.6578 5.8222 11.6445 1.0610 Constraint 1054 1284 5.4242 6.7802 13.5604 1.0604 Constraint 829 921 5.1937 6.4921 12.9842 1.0590 Constraint 1657 1748 3.9022 4.8777 9.7555 1.0579 Constraint 1374 1541 6.1324 7.6655 15.3311 1.0575 Constraint 1030 1479 4.9252 6.1565 12.3130 1.0566 Constraint 1228 1503 4.2365 5.2956 10.5913 1.0564 Constraint 538 650 5.9984 7.4980 14.9960 1.0558 Constraint 1447 1533 3.9653 4.9566 9.9132 1.0548 Constraint 294 908 6.2757 7.8446 15.6892 1.0530 Constraint 249 429 5.3652 6.7065 13.4130 1.0530 Constraint 180 1022 5.5351 6.9189 13.8378 1.0530 Constraint 227 421 5.5134 6.8918 13.7836 1.0521 Constraint 1334 1772 4.4427 5.5534 11.1068 1.0513 Constraint 1228 1670 4.8342 6.0428 12.0856 1.0507 Constraint 836 921 5.3278 6.6598 13.3196 1.0505 Constraint 180 623 5.8889 7.3612 14.7223 1.0491 Constraint 233 1455 5.4121 6.7651 13.5301 1.0464 Constraint 1213 1556 5.8027 7.2533 14.5067 1.0451 Constraint 241 448 5.2081 6.5101 13.0202 1.0436 Constraint 1054 1317 4.7129 5.8911 11.7822 1.0425 Constraint 294 884 4.9875 6.2343 12.4687 1.0409 Constraint 1334 1731 4.5793 5.7242 11.4483 1.0409 Constraint 233 1466 6.1509 7.6887 15.3773 1.0402 Constraint 1193 1567 4.5387 5.6733 11.3467 1.0398 Constraint 384 1455 6.2990 7.8738 15.7476 1.0397 Constraint 412 818 5.1659 6.4573 12.9146 1.0382 Constraint 1603 1678 4.9939 6.2424 12.4848 1.0380 Constraint 189 443 6.2062 7.7577 15.5155 1.0329 Constraint 530 657 5.6487 7.0609 14.1217 1.0327 Constraint 1109 1293 5.0833 6.3542 12.7083 1.0312 Constraint 39 136 4.8837 6.1047 12.2094 1.0307 Constraint 650 722 5.7617 7.2021 14.4042 1.0275 Constraint 1301 1748 3.1628 3.9535 7.9069 1.0268 Constraint 1276 1720 3.9179 4.8973 9.7947 1.0259 Constraint 1358 1587 3.8549 4.8186 9.6372 1.0258 Constraint 1343 1587 5.6016 7.0020 14.0040 1.0258 Constraint 1309 1567 5.8792 7.3490 14.6980 1.0258 Constraint 1239 1511 5.0620 6.3275 12.6550 1.0258 Constraint 1220 1720 6.0024 7.5029 15.0059 1.0258 Constraint 1100 1533 4.0383 5.0479 10.0959 1.0258 Constraint 412 1455 4.0647 5.0809 10.1617 1.0258 Constraint 384 1438 5.8157 7.2697 14.5394 1.0258 Constraint 375 1438 4.7709 5.9637 11.9273 1.0258 Constraint 208 1455 6.0001 7.5001 15.0002 1.0258 Constraint 77 579 5.9332 7.4165 14.8330 1.0256 Constraint 1260 1764 5.6108 7.0135 14.0271 1.0250 Constraint 1109 1777 5.0573 6.3216 12.6433 1.0247 Constraint 1309 1772 3.8457 4.8071 9.6142 1.0210 Constraint 1084 1777 6.1787 7.7234 15.4468 1.0210 Constraint 47 136 4.8305 6.0381 12.0762 1.0193 Constraint 1193 1603 5.9151 7.3939 14.7879 1.0181 Constraint 1109 1317 4.9427 6.1784 12.3568 1.0150 Constraint 172 564 4.1864 5.2330 10.4661 1.0139 Constraint 1391 1567 5.5508 6.9385 13.8769 1.0132 Constraint 466 769 4.4389 5.5486 11.0973 1.0127 Constraint 145 564 4.4538 5.5673 11.1345 1.0122 Constraint 1382 1567 4.5329 5.6661 11.3322 1.0106 Constraint 1213 1649 4.8829 6.1037 12.2074 1.0104 Constraint 493 748 4.0711 5.0888 10.1777 1.0104 Constraint 294 429 5.3769 6.7212 13.4424 1.0091 Constraint 66 557 6.1109 7.6386 15.2773 1.0080 Constraint 1046 1408 4.6872 5.8590 11.7181 1.0077 Constraint 1141 1268 5.1706 6.4633 12.9266 1.0058 Constraint 1714 1788 5.9943 7.4928 14.9857 1.0042 Constraint 1343 1575 6.3240 7.9050 15.8100 1.0042 Constraint 1325 1764 5.8979 7.3724 14.7448 1.0042 Constraint 1293 1788 5.8708 7.3385 14.6770 1.0042 Constraint 1276 1788 3.7410 4.6763 9.3526 1.0042 Constraint 1276 1772 3.7956 4.7445 9.4890 1.0042 Constraint 1268 1748 3.1635 3.9543 7.9087 1.0042 Constraint 1260 1788 5.8331 7.2913 14.5827 1.0042 Constraint 1260 1772 5.9031 7.3788 14.7577 1.0042 Constraint 1260 1748 5.4669 6.8337 13.6673 1.0042 Constraint 1046 1731 5.9584 7.4481 14.8961 1.0042 Constraint 899 1494 4.7384 5.9231 11.8461 1.0042 Constraint 792 1611 6.0650 7.5812 15.1624 1.0042 Constraint 769 1692 6.1002 7.6252 15.2505 1.0042 Constraint 713 1748 5.8452 7.3066 14.6131 1.0042 Constraint 639 1788 6.2746 7.8432 15.6865 1.0042 Constraint 306 1649 6.2521 7.8152 15.6303 1.0042 Constraint 249 1634 6.2748 7.8435 15.6869 1.0042 Constraint 47 145 5.1109 6.3886 12.7772 1.0042 Constraint 39 650 5.9489 7.4362 14.8723 1.0042 Constraint 980 1471 4.7881 5.9851 11.9702 1.0017 Constraint 189 493 4.0845 5.1057 10.2113 1.0009 Constraint 1008 1293 4.5839 5.7299 11.4598 1.0006 Constraint 1351 1596 5.5198 6.8998 13.7995 0.9997 Constraint 1408 1533 4.4789 5.5986 11.1971 0.9995 Constraint 466 739 6.0658 7.5823 15.1646 0.9966 Constraint 443 769 4.2208 5.2760 10.5520 0.9960 Constraint 412 792 5.5703 6.9629 13.9257 0.9929 Constraint 1260 1649 5.2650 6.5813 13.1626 0.9905 Constraint 1035 1193 5.6825 7.1031 14.2063 0.9902 Constraint 208 564 5.9977 7.4971 14.9942 0.9900 Constraint 299 368 5.9370 7.4213 14.8426 0.9872 Constraint 77 479 3.9899 4.9874 9.9749 0.9849 Constraint 1317 1703 5.8389 7.2986 14.5972 0.9847 Constraint 944 1167 5.2677 6.5846 13.1692 0.9822 Constraint 448 521 5.6534 7.0667 14.1335 0.9817 Constraint 1358 1575 5.1055 6.3819 12.7638 0.9783 Constraint 1358 1739 5.6829 7.1036 14.2072 0.9782 Constraint 249 748 5.4280 6.7850 13.5700 0.9759 Constraint 892 1408 5.3072 6.6340 13.2681 0.9742 Constraint 530 756 4.7308 5.9134 11.8269 0.9738 Constraint 538 690 5.1911 6.4888 12.9777 0.9738 Constraint 722 800 5.2195 6.5243 13.0487 0.9707 Constraint 997 1416 5.4245 6.7806 13.5613 0.9706 Constraint 274 783 5.8935 7.3669 14.7338 0.9679 Constraint 1309 1649 5.8984 7.3730 14.7461 0.9643 Constraint 1204 1541 4.7601 5.9501 11.9003 0.9637 Constraint 1268 1471 4.6228 5.7785 11.5570 0.9635 Constraint 650 739 5.3626 6.7032 13.4065 0.9634 Constraint 216 466 4.7197 5.8996 11.7991 0.9632 Constraint 1317 1399 5.0539 6.3174 12.6348 0.9630 Constraint 530 748 5.3547 6.6934 13.3867 0.9581 Constraint 196 448 3.7568 4.6960 9.3920 0.9575 Constraint 66 510 4.2221 5.2776 10.5552 0.9575 Constraint 66 501 3.8313 4.7891 9.5782 0.9575 Constraint 66 479 4.0202 5.0253 10.0505 0.9575 Constraint 91 510 5.7460 7.1825 14.3650 0.9573 Constraint 97 521 4.9901 6.2376 12.4751 0.9561 Constraint 706 1777 6.0910 7.6138 15.2276 0.9515 Constraint 189 713 6.0710 7.5888 15.1775 0.9515 Constraint 1416 1678 5.2678 6.5847 13.1694 0.9513 Constraint 216 665 5.4400 6.8000 13.5999 0.9507 Constraint 944 1351 4.9259 6.1574 12.3147 0.9445 Constraint 980 1678 4.4454 5.5567 11.1135 0.9432 Constraint 233 1374 5.2008 6.5011 13.0021 0.9417 Constraint 1193 1575 5.8432 7.3040 14.6081 0.9400 Constraint 249 769 6.3115 7.8894 15.7788 0.9395 Constraint 1325 1731 6.1141 7.6426 15.2852 0.9390 Constraint 448 530 4.5724 5.7155 11.4310 0.9343 Constraint 650 731 4.4433 5.5541 11.1082 0.9336 Constraint 1399 1533 5.0065 6.2581 12.5162 0.9331 Constraint 1343 1731 5.3178 6.6473 13.2945 0.9329 Constraint 1317 1391 4.5225 5.6531 11.3062 0.9310 Constraint 1133 1293 5.1306 6.4132 12.8264 0.9304 Constraint 154 623 5.3006 6.6258 13.2516 0.9289 Constraint 285 421 4.1261 5.1576 10.3152 0.9277 Constraint 1035 1167 5.4521 6.8152 13.6304 0.9260 Constraint 1382 1471 5.0579 6.3223 12.6446 0.9257 Constraint 241 557 3.7315 4.6643 9.3286 0.9242 Constraint 1133 1471 4.7977 5.9971 11.9942 0.9242 Constraint 1358 1567 4.0170 5.0213 10.0426 0.9235 Constraint 493 778 5.9379 7.4223 14.8446 0.9235 Constraint 294 1022 5.8504 7.3131 14.6261 0.9228 Constraint 1054 1603 4.8586 6.0733 12.1466 0.9215 Constraint 1213 1548 3.2852 4.1064 8.2129 0.9202 Constraint 1213 1541 5.4235 6.7793 13.5587 0.9202 Constraint 829 913 4.9329 6.1661 12.3323 0.9168 Constraint 1276 1634 5.7905 7.2382 14.4764 0.9167 Constraint 363 884 5.9748 7.4685 14.9371 0.9150 Constraint 1022 1479 4.1294 5.1617 10.3235 0.9147 Constraint 1077 1351 5.5083 6.8853 13.7707 0.9136 Constraint 1084 1634 5.5780 6.9725 13.9449 0.9125 Constraint 1077 1408 5.6167 7.0208 14.0416 0.9122 Constraint 285 913 6.1293 7.6616 15.3232 0.9119 Constraint 1046 1374 4.8437 6.0546 12.1092 0.9110 Constraint 530 1077 5.9438 7.4297 14.8594 0.9087 Constraint 1374 1466 5.6315 7.0394 14.0787 0.9059 Constraint 1008 1167 5.2670 6.5838 13.1675 0.9049 Constraint 154 521 4.3159 5.3949 10.7897 0.9047 Constraint 1204 1556 4.7606 5.9508 11.9016 0.9046 Constraint 1204 1548 5.8506 7.3133 14.6266 0.9046 Constraint 980 1556 5.0773 6.3467 12.6934 0.9038 Constraint 1391 1548 5.1512 6.4390 12.8781 0.9034 Constraint 457 530 5.8189 7.2736 14.5472 0.9031 Constraint 501 778 5.6981 7.1227 14.2453 0.9018 Constraint 1030 1575 5.1153 6.3941 12.7882 0.9016 Constraint 263 557 5.0375 6.2969 12.5938 0.9009 Constraint 421 501 5.2698 6.5872 13.1744 0.8983 Constraint 521 665 4.6069 5.7586 11.5173 0.8958 Constraint 530 778 5.1709 6.4636 12.9271 0.8958 Constraint 698 1167 5.3728 6.7160 13.4320 0.8945 Constraint 1133 1479 5.0565 6.3206 12.6413 0.8941 Constraint 1260 1471 5.0830 6.3537 12.7075 0.8936 Constraint 963 1494 5.0877 6.3597 12.7194 0.8904 Constraint 1193 1649 5.7453 7.1816 14.3633 0.8902 Constraint 1193 1587 5.7252 7.1565 14.3131 0.8902 Constraint 1382 1739 5.9195 7.3993 14.7987 0.8893 Constraint 921 1408 5.2817 6.6021 13.2043 0.8891 Constraint 1100 1548 4.5501 5.6877 11.3753 0.8885 Constraint 1416 1533 5.1603 6.4504 12.9009 0.8881 Constraint 1268 1620 4.7297 5.9121 11.8242 0.8881 Constraint 249 448 4.1596 5.1996 10.3991 0.8867 Constraint 1276 1657 4.6477 5.8096 11.6191 0.8850 Constraint 1167 1575 4.8285 6.0356 12.0711 0.8846 Constraint 1178 1596 5.4679 6.8349 13.6697 0.8823 Constraint 1416 1596 5.7729 7.2161 14.4322 0.8820 Constraint 1260 1374 5.3820 6.7275 13.4550 0.8815 Constraint 1084 1220 6.1558 7.6947 15.3895 0.8808 Constraint 1382 1731 4.7712 5.9640 11.9280 0.8785 Constraint 1317 1447 4.2095 5.2619 10.5237 0.8779 Constraint 306 818 5.5743 6.9679 13.9358 0.8775 Constraint 1213 1567 4.7565 5.9456 11.8911 0.8766 Constraint 1059 1268 4.6594 5.8243 11.6486 0.8743 Constraint 739 1662 5.7564 7.1955 14.3909 0.8727 Constraint 1008 1438 5.8174 7.2717 14.5435 0.8713 Constraint 1374 1556 4.6744 5.8430 11.6860 0.8705 Constraint 1343 1620 4.8848 6.1060 12.2121 0.8705 Constraint 1193 1556 5.9198 7.3997 14.7995 0.8705 Constraint 1035 1683 5.4096 6.7619 13.5239 0.8705 Constraint 980 1109 4.7703 5.9629 11.9259 0.8642 Constraint 196 501 4.0982 5.1227 10.2455 0.8610 Constraint 1301 1739 6.0171 7.5213 15.0427 0.8609 Constraint 164 698 5.7523 7.1904 14.3807 0.8609 Constraint 196 722 5.3535 6.6919 13.3837 0.8600 Constraint 227 501 5.1491 6.4363 12.8726 0.8594 Constraint 448 538 4.7433 5.9291 11.8582 0.8569 Constraint 241 836 4.5847 5.7309 11.4619 0.8563 Constraint 1035 1620 4.4124 5.5156 11.0311 0.8555 Constraint 1035 1408 5.4563 6.8204 13.6409 0.8553 Constraint 457 538 4.7794 5.9743 11.9486 0.8552 Constraint 1366 1575 4.7210 5.9012 11.8024 0.8548 Constraint 1251 1764 4.9091 6.1363 12.2727 0.8548 Constraint 1100 1541 5.2635 6.5794 13.1587 0.8548 Constraint 227 1575 4.9379 6.1724 12.3447 0.8548 Constraint 306 876 5.2661 6.5826 13.1653 0.8548 Constraint 988 1293 3.9137 4.8921 9.7843 0.8543 Constraint 1416 1703 5.9020 7.3775 14.7549 0.8533 Constraint 164 1008 5.6971 7.1214 14.2428 0.8525 Constraint 1391 1596 5.4975 6.8719 13.7438 0.8498 Constraint 501 639 3.8352 4.7940 9.5881 0.8496 Constraint 216 564 4.8399 6.0499 12.0998 0.8490 Constraint 1276 1670 5.8519 7.3149 14.6298 0.8424 Constraint 1438 1567 5.0167 6.2708 12.5416 0.8414 Constraint 1213 1634 5.6755 7.0944 14.1888 0.8388 Constraint 818 968 4.1752 5.2190 10.4380 0.8374 Constraint 1046 1117 4.9738 6.2173 12.4345 0.8322 Constraint 91 616 5.4590 6.8237 13.6475 0.8309 Constraint 1284 1471 6.1605 7.7006 15.4013 0.8275 Constraint 421 530 4.6766 5.8457 11.6914 0.8274 Constraint 521 673 4.4427 5.5533 11.1067 0.8272 Constraint 868 944 5.2963 6.6204 13.2408 0.8271 Constraint 274 521 5.0203 6.2754 12.5508 0.8264 Constraint 1014 1325 5.5523 6.9403 13.8806 0.8264 Constraint 1268 1670 6.2900 7.8625 15.7251 0.8252 Constraint 1391 1541 4.2644 5.3305 10.6610 0.8230 Constraint 1351 1662 6.2798 7.8497 15.6995 0.8226 Constraint 944 1260 5.5089 6.8862 13.7724 0.8219 Constraint 1260 1416 5.5680 6.9600 13.9199 0.8213 Constraint 1260 1399 4.4419 5.5523 11.1046 0.8208 Constraint 1014 1260 5.2444 6.5555 13.1111 0.8205 Constraint 325 412 4.2493 5.3117 10.6233 0.8202 Constraint 1008 1374 4.2088 5.2609 10.5219 0.8190 Constraint 1391 1678 5.8614 7.3267 14.6534 0.8181 Constraint 1220 1479 4.7545 5.9431 11.8862 0.8178 Constraint 988 1611 4.8373 6.0467 12.0934 0.8177 Constraint 1054 1325 5.4218 6.7772 13.5544 0.8170 Constraint 66 616 4.1988 5.2486 10.4971 0.8156 Constraint 1167 1587 5.4531 6.8164 13.6327 0.8134 Constraint 1054 1620 5.7782 7.2227 14.4454 0.8126 Constraint 1178 1575 5.4646 6.8308 13.6615 0.8117 Constraint 1178 1603 4.3826 5.4783 10.9566 0.8099 Constraint 980 1438 3.5288 4.4110 8.8219 0.8097 Constraint 1391 1533 4.9538 6.1922 12.3844 0.8085 Constraint 1030 1596 5.4773 6.8466 13.6933 0.8072 Constraint 429 501 4.8951 6.1188 12.2376 0.8058 Constraint 1046 1268 6.0491 7.5614 15.1229 0.8057 Constraint 121 510 5.4349 6.7936 13.5873 0.8020 Constraint 1059 1756 4.8694 6.0867 12.1734 0.8005 Constraint 1399 1548 5.4066 6.7582 13.5165 0.7985 Constraint 256 980 5.4543 6.8178 13.6357 0.7980 Constraint 1374 1471 5.6956 7.1195 14.2389 0.7978 Constraint 1343 1649 4.6480 5.8100 11.6200 0.7973 Constraint 968 1438 4.2914 5.3642 10.7284 0.7960 Constraint 997 1620 5.3296 6.6620 13.3241 0.7913 Constraint 921 1634 5.8185 7.2731 14.5462 0.7901 Constraint 1014 1703 4.0059 5.0074 10.0148 0.7898 Constraint 1125 1246 6.1430 7.6788 15.3576 0.7895 Constraint 164 1030 4.7508 5.9385 11.8771 0.7888 Constraint 1167 1603 5.2621 6.5776 13.1552 0.7878 Constraint 412 521 4.7366 5.9207 11.8414 0.7877 Constraint 1260 1620 5.9420 7.4275 14.8551 0.7860 Constraint 1317 1649 5.4486 6.8107 13.6214 0.7859 Constraint 457 549 5.1857 6.4822 12.9643 0.7852 Constraint 104 557 5.4990 6.8737 13.7474 0.7851 Constraint 1479 1556 5.8087 7.2609 14.5219 0.7849 Constraint 1035 1220 5.6407 7.0508 14.1017 0.7849 Constraint 1587 1678 5.7735 7.2168 14.4336 0.7829 Constraint 77 608 4.9011 6.1264 12.2527 0.7810 Constraint 1014 1603 5.3633 6.7041 13.4082 0.7796 Constraint 256 1374 5.6021 7.0026 14.0052 0.7794 Constraint 530 997 4.7821 5.9777 11.9553 0.7770 Constraint 1293 1587 4.5303 5.6629 11.3258 0.7754 Constraint 1260 1670 5.4920 6.8650 13.7301 0.7750 Constraint 639 1167 4.9597 6.1997 12.3994 0.7741 Constraint 1035 1692 6.1379 7.6723 15.3447 0.7732 Constraint 848 968 5.5901 6.9876 13.9753 0.7725 Constraint 530 783 4.4233 5.5291 11.0582 0.7723 Constraint 285 836 5.2981 6.6227 13.2453 0.7720 Constraint 521 739 6.2471 7.8088 15.6176 0.7717 Constraint 1317 1438 5.6642 7.0803 14.1605 0.7707 Constraint 681 1714 6.3771 7.9714 15.9427 0.7695 Constraint 314 392 5.5315 6.9144 13.8288 0.7693 Constraint 479 722 5.5678 6.9598 13.9195 0.7685 Constraint 908 1596 6.2438 7.8048 15.6095 0.7683 Constraint 97 510 4.5420 5.6775 11.3549 0.7683 Constraint 921 1620 6.1206 7.6508 15.3016 0.7666 Constraint 1125 1260 5.4360 6.7950 13.5899 0.7659 Constraint 47 608 6.3783 7.9729 15.9458 0.7641 Constraint 172 1030 4.7222 5.9027 11.8054 0.7639 Constraint 892 1447 5.2147 6.5184 13.0369 0.7637 Constraint 1399 1575 5.9473 7.4341 14.8682 0.7632 Constraint 690 792 5.0448 6.3060 12.6120 0.7627 Constraint 1117 1533 4.8104 6.0130 12.0260 0.7624 Constraint 1014 1239 5.0908 6.3635 12.7270 0.7623 Constraint 1193 1634 3.3342 4.1677 8.3354 0.7620 Constraint 403 783 4.7575 5.9468 11.8937 0.7612 Constraint 1293 1603 4.2420 5.3025 10.6051 0.7611 Constraint 988 1260 4.3559 5.4449 10.8898 0.7594 Constraint 1284 1603 4.8669 6.0837 12.1673 0.7585 Constraint 1014 1077 5.1380 6.4225 12.8450 0.7575 Constraint 818 937 4.3990 5.4987 10.9974 0.7571 Constraint 1447 1556 4.8761 6.0952 12.1904 0.7564 Constraint 1022 1408 6.1585 7.6981 15.3962 0.7559 Constraint 216 690 4.9865 6.2332 12.4663 0.7552 Constraint 384 530 4.8312 6.0390 12.0780 0.7549 Constraint 1133 1488 4.3367 5.4209 10.8418 0.7547 Constraint 1260 1756 5.9403 7.4253 14.8507 0.7544 Constraint 1054 1634 4.6946 5.8682 11.7365 0.7530 Constraint 698 1133 4.6596 5.8245 11.6489 0.7527 Constraint 1030 1670 6.3218 7.9023 15.8045 0.7526 Constraint 630 1756 5.2311 6.5389 13.0778 0.7526 Constraint 623 1756 4.0975 5.1219 10.2437 0.7526 Constraint 121 639 5.3852 6.7315 13.4629 0.7526 Constraint 77 657 4.9457 6.1821 12.3642 0.7526 Constraint 77 639 5.6443 7.0554 14.1107 0.7526 Constraint 77 630 5.3552 6.6940 13.3880 0.7526 Constraint 66 630 6.3909 7.9886 15.9773 0.7526 Constraint 47 564 4.2439 5.3049 10.6098 0.7526 Constraint 955 1649 5.2748 6.5935 13.1869 0.7506 Constraint 1014 1611 5.4634 6.8293 13.6586 0.7490 Constraint 39 121 5.4598 6.8248 13.6496 0.7488 Constraint 530 1046 5.2106 6.5132 13.0265 0.7481 Constraint 392 501 4.9650 6.2062 12.4124 0.7472 Constraint 1117 1670 4.1890 5.2363 10.4726 0.7439 Constraint 1317 1471 4.8567 6.0709 12.1417 0.7436 Constraint 1220 1503 5.0615 6.3269 12.6539 0.7435 Constraint 988 1447 6.0425 7.5531 15.1062 0.7433 Constraint 829 955 5.2811 6.6014 13.2028 0.7432 Constraint 1358 1620 4.0208 5.0260 10.0520 0.7426 Constraint 1293 1471 5.3396 6.6744 13.3489 0.7426 Constraint 1213 1657 4.3022 5.3778 10.7555 0.7421 Constraint 1471 1603 4.8166 6.0208 12.0416 0.7421 Constraint 690 800 5.0626 6.3282 12.6564 0.7420 Constraint 256 1133 4.5356 5.6695 11.3389 0.7416 Constraint 1228 1603 5.7293 7.1616 14.3233 0.7410 Constraint 1035 1575 5.0775 6.3469 12.6939 0.7410 Constraint 1193 1511 5.7158 7.1447 14.2894 0.7407 Constraint 1193 1503 5.8824 7.3529 14.7059 0.7407 Constraint 564 630 5.5624 6.9530 13.9059 0.7406 Constraint 1488 1556 5.0828 6.3535 12.7070 0.7402 Constraint 557 713 3.9557 4.9446 9.8892 0.7401 Constraint 1068 1720 3.4981 4.3727 8.7453 0.7393 Constraint 285 1133 4.8011 6.0014 12.0028 0.7392 Constraint 980 1703 5.6810 7.1012 14.2025 0.7391 Constraint 1054 1125 6.0403 7.5504 15.1008 0.7384 Constraint 997 1399 6.0006 7.5008 15.0016 0.7382 Constraint 384 564 5.0931 6.3664 12.7328 0.7381 Constraint 435 530 5.1624 6.4530 12.9059 0.7377 Constraint 285 448 5.2729 6.5912 13.1823 0.7370 Constraint 1284 1620 4.9073 6.1341 12.2682 0.7362 Constraint 980 1260 4.1107 5.1383 10.2766 0.7360 Constraint 1046 1343 4.9442 6.1803 12.3605 0.7354 Constraint 1670 1739 5.8442 7.3052 14.6104 0.7342 Constraint 196 1293 4.3147 5.3934 10.7868 0.7329 Constraint 1399 1567 4.9208 6.1510 12.3020 0.7319 Constraint 1317 1567 5.0169 6.2712 12.5424 0.7319 Constraint 1358 1678 6.1719 7.7149 15.4298 0.7291 Constraint 306 1133 5.7353 7.1691 14.3382 0.7286 Constraint 792 968 4.1178 5.1472 10.2945 0.7247 Constraint 1030 1603 5.4631 6.8289 13.6577 0.7232 Constraint 493 756 4.5555 5.6944 11.3889 0.7225 Constraint 306 836 5.1919 6.4899 12.9797 0.7225 Constraint 256 1014 4.3633 5.4542 10.9083 0.7225 Constraint 997 1541 5.2670 6.5838 13.1675 0.7202 Constraint 1213 1351 5.7725 7.2156 14.4313 0.7197 Constraint 1077 1548 5.6855 7.1068 14.2137 0.7176 Constraint 1213 1488 5.0975 6.3719 12.7438 0.7175 Constraint 1149 1603 6.0418 7.5522 15.1045 0.7173 Constraint 557 792 5.3052 6.6315 13.2630 0.7161 Constraint 363 1109 5.9185 7.3982 14.7964 0.7152 Constraint 1022 1596 5.3859 6.7323 13.4647 0.7151 Constraint 1293 1720 5.9309 7.4136 14.8272 0.7149 Constraint 980 1239 4.5632 5.7040 11.4080 0.7147 Constraint 1276 1471 2.2233 2.7791 5.5581 0.7145 Constraint 1059 1649 4.2935 5.3669 10.7338 0.7141 Constraint 233 1301 4.9333 6.1666 12.3332 0.7120 Constraint 665 1054 5.0633 6.3292 12.6583 0.7114 Constraint 538 722 5.6342 7.0427 14.0854 0.7112 Constraint 285 429 4.1227 5.1534 10.3068 0.7106 Constraint 274 443 5.5131 6.8913 13.7826 0.7106 Constraint 256 448 3.3806 4.2257 8.4515 0.7104 Constraint 1455 1587 4.8982 6.1228 12.2455 0.7096 Constraint 1054 1301 4.5099 5.6374 11.2748 0.7092 Constraint 1035 1587 4.8074 6.0092 12.0184 0.7091 Constraint 333 876 5.2065 6.5081 13.0163 0.7072 Constraint 1046 1541 5.3125 6.6407 13.2813 0.7062 Constraint 1022 1268 5.1143 6.3929 12.7858 0.7058 Constraint 1141 1720 4.0714 5.0893 10.1786 0.7057 Constraint 1178 1634 4.8126 6.0158 12.0316 0.7056 Constraint 1455 1556 5.4131 6.7664 13.5327 0.7044 Constraint 848 921 5.5486 6.9358 13.8716 0.7038 Constraint 955 1260 3.5050 4.3812 8.7625 0.7035 Constraint 1092 1533 5.1153 6.3941 12.7883 0.7035 Constraint 216 769 5.0529 6.3161 12.6322 0.7031 Constraint 1193 1519 4.7964 5.9955 11.9910 0.7007 Constraint 241 564 4.5858 5.7323 11.4646 0.6985 Constraint 1301 1471 6.3519 7.9398 15.8797 0.6983 Constraint 1343 1670 6.0620 7.5775 15.1550 0.6978 Constraint 1276 1620 3.0029 3.7536 7.5073 0.6976 Constraint 1158 1596 5.2497 6.5622 13.1243 0.6976 Constraint 1109 1526 5.6392 7.0490 14.0979 0.6976 Constraint 1030 1587 4.5329 5.6661 11.3323 0.6976 Constraint 227 1611 4.0220 5.0274 10.0549 0.6976 Constraint 1030 1343 4.8939 6.1174 12.2348 0.6967 Constraint 1008 1399 3.5642 4.4552 8.9105 0.6963 Constraint 1035 1301 4.2380 5.2975 10.5949 0.6962 Constraint 690 1054 4.6610 5.8262 11.6525 0.6944 Constraint 1416 1526 5.6266 7.0332 14.0665 0.6938 Constraint 1014 1109 4.7721 5.9651 11.9301 0.6936 Constraint 698 800 5.4585 6.8231 13.6463 0.6929 Constraint 963 1479 3.6941 4.6176 9.2352 0.6927 Constraint 829 937 5.5478 6.9348 13.8695 0.6926 Constraint 616 748 4.8920 6.1150 12.2300 0.6920 Constraint 1014 1084 4.8875 6.1093 12.2187 0.6918 Constraint 263 466 6.2493 7.8117 15.6233 0.6913 Constraint 1301 1731 4.5425 5.6782 11.3564 0.6900 Constraint 1276 1764 5.5468 6.9335 13.8671 0.6900 Constraint 1276 1731 6.0343 7.5428 15.0856 0.6900 Constraint 1125 1756 5.1071 6.3839 12.7678 0.6900 Constraint 1059 1748 5.6028 7.0034 14.0069 0.6900 Constraint 1014 1692 6.3197 7.8997 15.7994 0.6900 Constraint 208 1301 5.1890 6.4863 12.9726 0.6899 Constraint 818 930 5.0316 6.2895 12.5791 0.6886 Constraint 285 829 5.5154 6.8942 13.7885 0.6867 Constraint 1427 1526 5.7204 7.1505 14.3011 0.6863 Constraint 1374 1596 4.3989 5.4987 10.9973 0.6860 Constraint 1366 1587 3.8433 4.8041 9.6083 0.6839 Constraint 1284 1611 3.8552 4.8190 9.6380 0.6839 Constraint 1276 1611 5.6766 7.0958 14.1916 0.6839 Constraint 1276 1603 3.2726 4.0907 8.1815 0.6839 Constraint 1193 1657 6.0906 7.6132 15.2264 0.6839 Constraint 1193 1488 2.2581 2.8227 5.6454 0.6839 Constraint 1193 1479 5.7307 7.1634 14.3267 0.6839 Constraint 1178 1587 5.3322 6.6653 13.3306 0.6839 Constraint 1158 1603 4.7118 5.8897 11.7794 0.6839 Constraint 1125 1488 5.4656 6.8320 13.6640 0.6839 Constraint 1068 1714 5.8233 7.2792 14.5583 0.6839 Constraint 1046 1587 5.4323 6.7904 13.5807 0.6839 Constraint 1046 1575 5.3812 6.7265 13.4530 0.6839 Constraint 988 1634 5.7078 7.1348 14.2695 0.6839 Constraint 256 1596 4.4800 5.6001 11.2001 0.6839 Constraint 249 1109 4.7442 5.9302 11.8604 0.6837 Constraint 1309 1391 5.5286 6.9108 13.8216 0.6835 Constraint 443 1068 5.5532 6.9415 13.8830 0.6828 Constraint 722 1317 5.1955 6.4944 12.9888 0.6828 Constraint 1014 1268 4.7146 5.8932 11.7865 0.6822 Constraint 748 1351 5.7714 7.2143 14.4286 0.6797 Constraint 1301 1596 4.5731 5.7164 11.4328 0.6788 Constraint 836 913 4.5234 5.6542 11.3084 0.6784 Constraint 1351 1739 4.9220 6.1525 12.3049 0.6779 Constraint 196 778 4.5833 5.7291 11.4582 0.6775 Constraint 392 538 5.6910 7.1137 14.2275 0.6775 Constraint 564 698 6.0297 7.5371 15.0742 0.6755 Constraint 501 1046 5.0342 6.2927 12.5855 0.6749 Constraint 1054 1358 5.8223 7.2779 14.5558 0.6746 Constraint 1293 1447 5.5549 6.9436 13.8871 0.6741 Constraint 1054 1133 4.7295 5.9119 11.8237 0.6721 Constraint 1046 1556 5.6946 7.1183 14.2365 0.6708 Constraint 713 800 4.6510 5.8138 11.6276 0.6704 Constraint 968 1556 5.1348 6.4184 12.8369 0.6692 Constraint 1092 1670 4.7851 5.9814 11.9628 0.6684 Constraint 493 1022 5.6221 7.0276 14.0552 0.6684 Constraint 227 1077 4.4614 5.5767 11.1534 0.6684 Constraint 196 1030 4.4720 5.5900 11.1799 0.6684 Constraint 1059 1239 4.6011 5.7513 11.5027 0.6669 Constraint 306 892 5.1100 6.3875 12.7750 0.6645 Constraint 963 1382 4.4479 5.5599 11.1198 0.6638 Constraint 1035 1239 4.8438 6.0548 12.1096 0.6627 Constraint 1374 1587 5.4198 6.7747 13.5495 0.6619 Constraint 557 706 6.3295 7.9119 15.8238 0.6617 Constraint 913 1260 5.5261 6.9076 13.8152 0.6604 Constraint 1358 1634 4.9397 6.1746 12.3493 0.6602 Constraint 1268 1382 5.4498 6.8122 13.6245 0.6584 Constraint 1213 1519 5.7229 7.1537 14.3073 0.6582 Constraint 1382 1503 5.5717 6.9646 13.9292 0.6578 Constraint 1309 1382 4.4816 5.6020 11.2040 0.6566 Constraint 294 899 5.1814 6.4768 12.9536 0.6564 Constraint 180 616 6.0873 7.6092 15.2183 0.6563 Constraint 690 818 5.1479 6.4349 12.8697 0.6560 Constraint 363 859 5.6296 7.0370 14.0739 0.6556 Constraint 249 1077 4.8307 6.0384 12.0769 0.6553 Constraint 104 572 5.2866 6.6083 13.2165 0.6553 Constraint 1014 1556 5.0594 6.3243 12.6486 0.6543 Constraint 172 1325 6.0386 7.5483 15.0966 0.6541 Constraint 164 1325 4.8210 6.0262 12.0524 0.6541 Constraint 333 892 5.5410 6.9262 13.8525 0.6532 Constraint 829 899 5.1396 6.4245 12.8490 0.6515 Constraint 180 597 4.4151 5.5188 11.0376 0.6512 Constraint 808 921 5.1750 6.4688 12.9375 0.6503 Constraint 241 466 6.0224 7.5281 15.0561 0.6501 Constraint 1567 1731 4.9928 6.2410 12.4820 0.6459 Constraint 256 1301 5.2470 6.5588 13.1176 0.6457 Constraint 1117 1692 4.8108 6.0135 12.0270 0.6452 Constraint 1084 1301 5.2877 6.6097 13.2194 0.6448 Constraint 963 1260 5.7082 7.1352 14.2705 0.6440 Constraint 1213 1479 4.5572 5.6966 11.3931 0.6439 Constraint 955 1526 4.7719 5.9649 11.9297 0.6437 Constraint 233 501 4.8135 6.0168 12.0337 0.6435 Constraint 792 988 5.7848 7.2310 14.4620 0.6418 Constraint 1014 1408 4.4892 5.6115 11.2230 0.6409 Constraint 1109 1678 4.5771 5.7213 11.4427 0.6406 Constraint 1260 1358 4.1412 5.1765 10.3530 0.6390 Constraint 1054 1471 5.2292 6.5365 13.0731 0.6354 Constraint 722 1293 4.4843 5.6054 11.2107 0.6345 Constraint 208 501 3.6344 4.5430 9.0860 0.6342 Constraint 1125 1268 4.4210 5.5262 11.0524 0.6317 Constraint 792 963 4.8122 6.0152 12.0304 0.6311 Constraint 1059 1620 4.0220 5.0276 10.0551 0.6309 Constraint 172 501 3.6718 4.5897 9.1794 0.6301 Constraint 285 403 6.2285 7.7856 15.5713 0.6291 Constraint 1293 1634 5.4707 6.8383 13.6767 0.6285 Constraint 164 748 4.3729 5.4662 10.9323 0.6284 Constraint 1567 1670 4.7897 5.9871 11.9742 0.6279 Constraint 657 829 5.9263 7.4079 14.8158 0.6266 Constraint 538 756 4.3264 5.4080 10.8160 0.6262 Constraint 412 530 3.7688 4.7111 9.4221 0.6262 Constraint 1213 1670 4.9877 6.2346 12.4692 0.6252 Constraint 921 1479 4.9394 6.1742 12.3484 0.6239 Constraint 208 479 3.5337 4.4172 8.8343 0.6227 Constraint 1213 1494 5.2008 6.5010 13.0020 0.6226 Constraint 955 1293 4.7230 5.9038 11.8076 0.6225 Constraint 1416 1556 5.2372 6.5466 13.0931 0.6224 Constraint 77 448 6.2895 7.8619 15.7239 0.6224 Constraint 1301 1455 5.8133 7.2666 14.5333 0.6218 Constraint 1317 1408 4.9947 6.2434 12.4868 0.6209 Constraint 249 1100 4.3570 5.4463 10.8926 0.6205 Constraint 521 681 4.7086 5.8858 11.7716 0.6192 Constraint 1046 1416 4.7900 5.9875 11.9751 0.6188 Constraint 249 1239 4.7448 5.9310 11.8621 0.6187 Constraint 1035 1149 6.1414 7.6767 15.3534 0.6177 Constraint 154 616 5.6502 7.0628 14.1255 0.6168 Constraint 384 466 5.3413 6.6766 13.3532 0.6164 Constraint 274 557 4.2195 5.2744 10.5487 0.6152 Constraint 988 1284 5.8035 7.2544 14.5088 0.6140 Constraint 557 778 5.7899 7.2374 14.4748 0.6127 Constraint 233 479 5.4468 6.8086 13.6171 0.6121 Constraint 1008 1620 5.1033 6.3791 12.7582 0.6110 Constraint 1220 1488 3.5405 4.4256 8.8512 0.6108 Constraint 306 448 5.6008 7.0010 14.0019 0.6107 Constraint 639 756 4.6495 5.8119 11.6238 0.6106 Constraint 1141 1293 5.4328 6.7910 13.5819 0.6104 Constraint 1260 1447 5.7302 7.1628 14.3256 0.6097 Constraint 800 944 4.9023 6.1279 12.2558 0.6093 Constraint 630 706 4.3825 5.4781 10.9562 0.6080 Constraint 1301 1603 5.5397 6.9246 13.8492 0.6078 Constraint 1077 1447 4.9337 6.1671 12.3342 0.6066 Constraint 1109 1670 5.2007 6.5009 13.0018 0.6061 Constraint 800 913 4.5306 5.6633 11.3266 0.6060 Constraint 1149 1239 3.9825 4.9781 9.9563 0.6053 Constraint 616 756 4.8066 6.0083 12.0166 0.6033 Constraint 1109 1541 6.0149 7.5186 15.0371 0.6029 Constraint 1077 1438 4.9044 6.1306 12.2611 0.6026 Constraint 154 818 4.2384 5.2980 10.5960 0.6024 Constraint 196 1317 5.7405 7.1757 14.3514 0.6018 Constraint 530 681 4.3901 5.4877 10.9753 0.6018 Constraint 112 1092 4.6048 5.7560 11.5120 0.6013 Constraint 1213 1503 4.4561 5.5702 11.1403 0.6005 Constraint 1284 1408 4.8951 6.1188 12.2377 0.5997 Constraint 1575 1731 5.3942 6.7428 13.4856 0.5992 Constraint 557 783 3.9383 4.9228 9.8456 0.5992 Constraint 1260 1391 4.9910 6.2388 12.4776 0.5990 Constraint 1251 1391 5.4160 6.7700 13.5401 0.5990 Constraint 1309 1447 5.3278 6.6598 13.3196 0.5983 Constraint 1014 1301 5.8860 7.3576 14.7151 0.5966 Constraint 1133 1276 4.6483 5.8104 11.6208 0.5963 Constraint 630 859 5.6969 7.1211 14.2422 0.5963 Constraint 1109 1657 4.5871 5.7339 11.4678 0.5959 Constraint 256 457 5.5109 6.8886 13.7772 0.5956 Constraint 1109 1284 4.7502 5.9378 11.8756 0.5950 Constraint 1109 1533 5.4566 6.8208 13.6416 0.5949 Constraint 1141 1692 5.8331 7.2914 14.5827 0.5946 Constraint 241 1260 5.9660 7.4575 14.9151 0.5946 Constraint 589 690 5.3204 6.6505 13.3009 0.5942 Constraint 1117 1731 5.3895 6.7369 13.4738 0.5941 Constraint 1293 1416 5.0846 6.3557 12.7115 0.5939 Constraint 1035 1603 5.0278 6.2847 12.5695 0.5938 Constraint 1109 1683 5.1340 6.4175 12.8350 0.5930 Constraint 384 876 5.2100 6.5125 13.0250 0.5928 Constraint 988 1488 4.7071 5.8839 11.7677 0.5926 Constraint 1268 1374 5.0064 6.2579 12.5159 0.5924 Constraint 435 501 4.8512 6.0641 12.1281 0.5923 Constraint 1268 1358 5.8300 7.2875 14.5749 0.5914 Constraint 549 681 4.3482 5.4352 10.8704 0.5910 Constraint 189 818 5.0098 6.2622 12.5244 0.5908 Constraint 1035 1141 4.6648 5.8310 11.6621 0.5904 Constraint 944 1471 3.9161 4.8952 9.7903 0.5885 Constraint 1035 1374 4.3243 5.4054 10.8108 0.5880 Constraint 256 429 4.3184 5.3980 10.7960 0.5880 Constraint 241 698 5.2683 6.5854 13.1709 0.5868 Constraint 681 792 5.2685 6.5856 13.1712 0.5866 Constraint 769 1008 5.4778 6.8473 13.6946 0.5866 Constraint 892 1479 6.0373 7.5467 15.0933 0.5865 Constraint 1301 1466 5.2174 6.5218 13.0435 0.5861 Constraint 572 665 5.2853 6.6066 13.2133 0.5855 Constraint 1251 1358 4.9955 6.2443 12.4887 0.5853 Constraint 980 1293 5.3812 6.7265 13.4531 0.5840 Constraint 227 1301 3.9157 4.8946 9.7893 0.5837 Constraint 1054 1141 4.5422 5.6778 11.3556 0.5831 Constraint 222 530 5.5329 6.9161 13.8323 0.5825 Constraint 11 77 6.0396 7.5495 15.0991 0.5819 Constraint 1054 1438 4.9340 6.1676 12.3351 0.5817 Constraint 18 82 4.7192 5.8990 11.7980 0.5816 Constraint 1054 1158 4.4291 5.5364 11.0727 0.5812 Constraint 963 1293 4.3078 5.3848 10.7695 0.5811 Constraint 829 1077 4.9759 6.2199 12.4397 0.5808 Constraint 154 848 5.3910 6.7388 13.4776 0.5807 Constraint 980 1268 5.5545 6.9431 13.8862 0.5802 Constraint 698 1054 5.4052 6.7565 13.5129 0.5798 Constraint 836 980 5.3361 6.6701 13.3403 0.5795 Constraint 216 623 5.6559 7.0698 14.1397 0.5790 Constraint 1133 1533 5.8510 7.3138 14.6276 0.5789 Constraint 1466 1596 5.0864 6.3579 12.7159 0.5787 Constraint 1054 1548 4.5390 5.6737 11.3474 0.5771 Constraint 112 1100 5.5431 6.9289 13.8578 0.5764 Constraint 1022 1575 4.6154 5.7693 11.5385 0.5757 Constraint 530 706 6.2375 7.7968 15.5937 0.5744 Constraint 1084 1317 4.8233 6.0292 12.0584 0.5735 Constraint 11 82 5.4626 6.8283 13.6566 0.5733 Constraint 1149 1720 5.1799 6.4748 12.9497 0.5729 Constraint 1014 1587 5.3956 6.7445 13.4890 0.5729 Constraint 955 1488 6.1003 7.6253 15.2506 0.5729 Constraint 944 1466 4.1022 5.1277 10.2554 0.5729 Constraint 421 1125 5.8516 7.3145 14.6291 0.5729 Constraint 384 1125 5.7029 7.1286 14.2572 0.5729 Constraint 274 1133 3.9850 4.9812 9.9624 0.5729 Constraint 227 1046 6.2253 7.7817 15.5633 0.5729 Constraint 227 479 4.2597 5.3246 10.6492 0.5729 Constraint 66 487 6.2978 7.8723 15.7446 0.5729 Constraint 921 1141 4.8605 6.0757 12.1513 0.5726 Constraint 1358 1649 3.6368 4.5460 9.0920 0.5717 Constraint 530 1030 4.6605 5.8257 11.6513 0.5709 Constraint 690 1059 6.1014 7.6268 15.2536 0.5709 Constraint 1251 1739 4.0044 5.0055 10.0109 0.5709 Constraint 1220 1772 6.1638 7.7047 15.4095 0.5709 Constraint 968 1167 5.6412 7.0515 14.1030 0.5693 Constraint 521 756 5.1919 6.4899 12.9797 0.5692 Constraint 1220 1471 5.9487 7.4358 14.8717 0.5685 Constraint 589 665 4.8818 6.1023 12.2045 0.5673 Constraint 263 836 3.9329 4.9161 9.8321 0.5659 Constraint 848 937 4.5511 5.6888 11.3777 0.5657 Constraint 97 579 5.5145 6.8931 13.7862 0.5650 Constraint 1054 1587 5.1300 6.4125 12.8251 0.5643 Constraint 1351 1731 4.8891 6.1114 12.2227 0.5636 Constraint 241 412 5.8403 7.3004 14.6007 0.5636 Constraint 1084 1657 4.3451 5.4314 10.8629 0.5617 Constraint 1141 1228 4.6474 5.8093 11.6186 0.5608 Constraint 66 154 5.6921 7.1151 14.2302 0.5605 Constraint 1317 1596 4.8583 6.0729 12.1458 0.5601 Constraint 1117 1526 5.4606 6.8257 13.6514 0.5598 Constraint 421 937 5.4383 6.7979 13.5959 0.5593 Constraint 208 1374 4.9212 6.1516 12.3031 0.5586 Constraint 980 1193 5.8212 7.2765 14.5531 0.5584 Constraint 1246 1351 5.0443 6.3053 12.6107 0.5576 Constraint 792 997 4.3278 5.4098 10.8196 0.5573 Constraint 1374 1455 4.0726 5.0908 10.1816 0.5563 Constraint 564 778 5.7440 7.1800 14.3600 0.5562 Constraint 980 1084 5.1525 6.4406 12.8813 0.5556 Constraint 421 848 5.3693 6.7116 13.4231 0.5555 Constraint 1213 1533 5.6678 7.0848 14.1695 0.5546 Constraint 769 997 4.1813 5.2266 10.4533 0.5546 Constraint 988 1268 3.8327 4.7909 9.5817 0.5543 Constraint 698 1293 5.5512 6.9391 13.8781 0.5534 Constraint 665 778 4.5766 5.7208 11.4416 0.5531 Constraint 1193 1678 4.6242 5.7803 11.5605 0.5529 Constraint 227 800 5.3295 6.6619 13.3238 0.5525 Constraint 196 748 5.2792 6.5990 13.1981 0.5525 Constraint 808 1293 5.3723 6.7153 13.4306 0.5504 Constraint 1125 1276 5.1287 6.4108 12.8217 0.5503 Constraint 1133 1309 5.6420 7.0525 14.1050 0.5501 Constraint 521 706 4.4207 5.5259 11.0518 0.5498 Constraint 421 665 5.2040 6.5051 13.0101 0.5493 Constraint 1309 1438 4.9532 6.1915 12.3829 0.5491 Constraint 1141 1756 5.1727 6.4659 12.9318 0.5489 Constraint 1260 1382 5.2382 6.5477 13.0955 0.5485 Constraint 1382 1466 4.6471 5.8089 11.6178 0.5483 Constraint 1133 1526 6.0912 7.6140 15.2281 0.5483 Constraint 1133 1511 5.8709 7.3386 14.6772 0.5483 Constraint 1008 1471 5.6080 7.0100 14.0201 0.5481 Constraint 1035 1334 5.2853 6.6066 13.2132 0.5480 Constraint 306 1167 4.7175 5.8968 11.7937 0.5479 Constraint 274 1239 5.4360 6.7950 13.5901 0.5479 Constraint 306 937 4.2532 5.3165 10.6331 0.5476 Constraint 196 769 5.8334 7.2918 14.5836 0.5473 Constraint 104 1100 6.0438 7.5548 15.1096 0.5472 Constraint 1046 1548 4.9502 6.1877 12.3754 0.5466 Constraint 1125 1533 5.6935 7.1169 14.2338 0.5461 Constraint 1084 1503 4.3425 5.4282 10.8563 0.5457 Constraint 616 884 5.5771 6.9714 13.9428 0.5453 Constraint 800 1416 5.3925 6.7406 13.4811 0.5452 Constraint 623 756 4.9377 6.1721 12.3442 0.5451 Constraint 818 892 5.2200 6.5251 13.0501 0.5445 Constraint 1193 1351 6.0458 7.5572 15.1145 0.5443 Constraint 180 589 4.9927 6.2409 12.4818 0.5443 Constraint 963 1620 5.7474 7.1842 14.3684 0.5440 Constraint 392 557 5.5831 6.9789 13.9578 0.5438 Constraint 1022 1416 6.2295 7.7868 15.5737 0.5436 Constraint 216 557 3.8535 4.8169 9.6338 0.5424 Constraint 1366 1556 5.1214 6.4018 12.8036 0.5417 Constraint 196 1077 5.5455 6.9318 13.8637 0.5416 Constraint 1035 1382 5.2558 6.5698 13.1395 0.5407 Constraint 564 748 4.5383 5.6728 11.3456 0.5407 Constraint 1008 1084 5.2741 6.5926 13.1852 0.5397 Constraint 769 1399 6.1022 7.6277 15.2554 0.5392 Constraint 1077 1471 4.8257 6.0321 12.0642 0.5390 Constraint 1301 1649 4.6346 5.7932 11.5864 0.5382 Constraint 1008 1213 4.4633 5.5791 11.1582 0.5377 Constraint 1109 1408 5.0434 6.3043 12.6085 0.5375 Constraint 818 1035 5.6343 7.0428 14.0856 0.5372 Constraint 706 792 5.6542 7.0677 14.1354 0.5370 Constraint 274 530 4.8855 6.1069 12.2138 0.5358 Constraint 1251 1447 5.2290 6.5362 13.0725 0.5355 Constraint 1603 1731 5.0621 6.3276 12.6551 0.5349 Constraint 384 1374 5.6556 7.0695 14.1391 0.5346 Constraint 241 665 4.6509 5.8136 11.6272 0.5336 Constraint 1399 1526 5.9412 7.4265 14.8531 0.5335 Constraint 1220 1739 5.1069 6.3837 12.7673 0.5329 Constraint 263 1204 5.4361 6.7952 13.5903 0.5329 Constraint 294 859 5.0450 6.3063 12.6126 0.5325 Constraint 1054 1466 4.5371 5.6714 11.3427 0.5322 Constraint 274 868 5.2485 6.5607 13.1214 0.5322 Constraint 1014 1620 5.6714 7.0892 14.1785 0.5314 Constraint 713 783 5.6362 7.0452 14.0905 0.5311 Constraint 665 756 4.3980 5.4975 10.9950 0.5311 Constraint 274 968 4.9719 6.2148 12.4297 0.5306 Constraint 1035 1567 5.8238 7.2797 14.5595 0.5303 Constraint 698 1284 5.6235 7.0294 14.0587 0.5297 Constraint 1158 1611 5.3767 6.7209 13.4418 0.5295 Constraint 1100 1519 4.5873 5.7341 11.4682 0.5285 Constraint 294 448 4.2306 5.2883 10.5765 0.5270 Constraint 1556 1703 5.2783 6.5979 13.1957 0.5268 Constraint 778 1293 5.0602 6.3252 12.6505 0.5257 Constraint 299 980 6.3830 7.9788 15.9576 0.5254 Constraint 97 616 4.6559 5.8199 11.6397 0.5254 Constraint 104 521 5.1843 6.4803 12.9607 0.5253 Constraint 241 521 3.7272 4.6591 9.3181 0.5248 Constraint 748 968 4.6419 5.8024 11.6047 0.5248 Constraint 1084 1567 4.9562 6.1952 12.3904 0.5248 Constraint 1141 1246 5.4437 6.8047 13.6094 0.5246 Constraint 1109 1519 5.2178 6.5223 13.0446 0.5244 Constraint 1046 1533 5.0136 6.2670 12.5339 0.5244 Constraint 1109 1649 5.4779 6.8474 13.6947 0.5228 Constraint 808 944 4.3514 5.4392 10.8784 0.5208 Constraint 722 792 3.6636 4.5795 9.1589 0.5201 Constraint 1133 1703 5.4161 6.7701 13.5402 0.5201 Constraint 1141 1603 5.6578 7.0723 14.1445 0.5199 Constraint 800 1260 5.3981 6.7477 13.4953 0.5198 Constraint 639 783 5.0978 6.3723 12.7446 0.5197 Constraint 997 1556 6.0727 7.5909 15.1818 0.5192 Constraint 657 836 4.0732 5.0915 10.1829 0.5191 Constraint 1471 1596 5.1318 6.4147 12.8295 0.5186 Constraint 521 792 5.8444 7.3055 14.6109 0.5182 Constraint 963 1634 3.9390 4.9237 9.8474 0.5180 Constraint 285 808 5.6910 7.1137 14.2274 0.5178 Constraint 1213 1471 4.6384 5.7980 11.5960 0.5174 Constraint 783 980 4.6738 5.8423 11.6846 0.5171 Constraint 306 808 5.0818 6.3523 12.7046 0.5164 Constraint 1239 1343 4.5486 5.6857 11.3715 0.5161 Constraint 778 944 4.6495 5.8119 11.6237 0.5148 Constraint 1427 1541 5.7127 7.1408 14.2817 0.5144 Constraint 384 657 5.6340 7.0425 14.0849 0.5142 Constraint 955 1284 4.3875 5.4844 10.9687 0.5139 Constraint 154 589 5.6335 7.0419 14.0839 0.5138 Constraint 1351 1567 3.6282 4.5352 9.0704 0.5129 Constraint 1301 1611 4.5398 5.6747 11.3494 0.5129 Constraint 1293 1772 5.3493 6.6866 13.3732 0.5129 Constraint 1220 1494 5.5370 6.9212 13.8425 0.5129 Constraint 1204 1494 5.1832 6.4790 12.9580 0.5129 Constraint 1133 1519 4.3502 5.4377 10.8754 0.5129 Constraint 1125 1526 3.1286 3.9108 7.8215 0.5129 Constraint 1125 1519 4.9270 6.1588 12.3176 0.5129 Constraint 1125 1511 4.3146 5.3932 10.7865 0.5129 Constraint 1100 1526 5.1582 6.4477 12.8955 0.5129 Constraint 325 1447 5.6753 7.0941 14.1882 0.5129 Constraint 256 1556 4.5200 5.6500 11.3000 0.5129 Constraint 256 1141 5.1937 6.4921 12.9842 0.5129 Constraint 249 1575 6.2713 7.8391 15.6782 0.5129 Constraint 233 1382 5.2043 6.5054 13.0109 0.5129 Constraint 227 1366 4.4413 5.5516 11.1032 0.5129 Constraint 274 1204 4.7061 5.8826 11.7653 0.5128 Constraint 222 557 5.9679 7.4599 14.9199 0.5128 Constraint 1084 1351 5.7202 7.1502 14.3004 0.5122 Constraint 241 690 4.6749 5.8436 11.6872 0.5118 Constraint 1008 1220 3.9520 4.9400 9.8799 0.5115 Constraint 1109 1309 5.1399 6.4249 12.8498 0.5109 Constraint 778 980 5.4831 6.8539 13.7078 0.5104 Constraint 1213 1703 4.5015 5.6269 11.2538 0.5104 Constraint 963 1533 5.5355 6.9194 13.8388 0.5094 Constraint 375 557 4.4978 5.6223 11.2446 0.5093 Constraint 1084 1276 5.3481 6.6851 13.3702 0.5093 Constraint 1268 1408 4.4819 5.6024 11.2048 0.5089 Constraint 1030 1399 5.3758 6.7197 13.4395 0.5083 Constraint 1008 1109 4.4804 5.6006 11.2011 0.5082 Constraint 189 623 5.0724 6.3404 12.6809 0.5078 Constraint 1046 1720 4.9930 6.2412 12.4824 0.5077 Constraint 1008 1334 6.1102 7.6378 15.2755 0.5075 Constraint 241 769 4.5202 5.6502 11.3005 0.5075 Constraint 216 792 5.0651 6.3314 12.6627 0.5075 Constraint 1309 1455 4.4038 5.5048 11.0095 0.5069 Constraint 222 1293 5.2409 6.5511 13.1022 0.5066 Constraint 829 1447 4.4765 5.5956 11.1913 0.5051 Constraint 1366 1649 4.1099 5.1374 10.2747 0.5046 Constraint 530 769 5.1033 6.3791 12.7581 0.5042 Constraint 233 557 4.3178 5.3973 10.7945 0.5033 Constraint 1427 1533 4.8663 6.0828 12.1656 0.5025 Constraint 274 412 5.9610 7.4513 14.9025 0.5025 Constraint 392 665 4.3710 5.4638 10.9276 0.5024 Constraint 285 1100 5.7335 7.1669 14.3338 0.5023 Constraint 1541 1731 4.4332 5.5416 11.0831 0.5018 Constraint 1084 1533 4.8755 6.0943 12.1887 0.5017 Constraint 944 1416 3.9251 4.9063 9.8126 0.5011 Constraint 1008 1141 4.6789 5.8486 11.6973 0.5009 Constraint 1046 1567 4.2877 5.3596 10.7193 0.5008 Constraint 1014 1293 5.6900 7.1125 14.2249 0.5007 Constraint 963 1611 3.8055 4.7569 9.5137 0.5006 Constraint 564 808 5.4186 6.7732 13.5465 0.5004 Constraint 800 1084 4.9948 6.2435 12.4869 0.5004 Constraint 564 722 5.1779 6.4724 12.9448 0.5003 Constraint 208 510 4.8354 6.0443 12.0885 0.5001 Constraint 698 818 4.7508 5.9385 11.8770 0.5001 Constraint 1035 1276 5.9929 7.4911 14.9823 0.4996 Constraint 154 597 5.1026 6.3782 12.7564 0.4994 Constraint 564 1125 5.2041 6.5051 13.0103 0.4991 Constraint 1035 1109 4.5488 5.6859 11.3719 0.4991 Constraint 1092 1703 5.0307 6.2884 12.5767 0.4987 Constraint 1438 1611 6.0372 7.5466 15.0931 0.4981 Constraint 808 968 5.0721 6.3401 12.6802 0.4979 Constraint 1035 1213 4.9954 6.2442 12.4884 0.4978 Constraint 690 1125 4.2799 5.3499 10.6998 0.4976 Constraint 241 549 5.7728 7.2159 14.4319 0.4976 Constraint 698 778 5.3178 6.6473 13.2946 0.4969 Constraint 1416 1511 5.4674 6.8342 13.6685 0.4967 Constraint 1022 1260 4.9877 6.2347 12.4694 0.4965 Constraint 493 690 4.7807 5.9759 11.9519 0.4958 Constraint 980 1077 4.1606 5.2007 10.4014 0.4953 Constraint 1084 1167 4.6934 5.8668 11.7335 0.4953 Constraint 899 1008 5.7877 7.2347 14.4693 0.4949 Constraint 222 333 4.5726 5.7157 11.4315 0.4948 Constraint 285 937 6.0787 7.5984 15.1968 0.4942 Constraint 980 1228 6.1370 7.6712 15.3424 0.4936 Constraint 549 650 4.5454 5.6818 11.3635 0.4931 Constraint 792 937 5.9395 7.4243 14.8487 0.4931 Constraint 1059 1213 4.3129 5.3911 10.7822 0.4925 Constraint 97 589 6.1182 7.6477 15.2954 0.4924 Constraint 274 690 5.2645 6.5806 13.1612 0.4922 Constraint 443 1100 5.0539 6.3174 12.6348 0.4918 Constraint 263 769 5.5484 6.9356 13.8711 0.4918 Constraint 196 1046 5.0054 6.2568 12.5135 0.4918 Constraint 1391 1488 5.6888 7.1110 14.2220 0.4917 Constraint 1077 1382 5.4184 6.7730 13.5459 0.4915 Constraint 172 510 5.7040 7.1301 14.2601 0.4914 Constraint 180 657 6.2607 7.8258 15.6517 0.4909 Constraint 829 963 5.4881 6.8601 13.7202 0.4906 Constraint 1059 1692 4.5641 5.7052 11.4104 0.4903 Constraint 722 1008 5.0732 6.3415 12.6830 0.4897 Constraint 3 66 5.3857 6.7321 13.4643 0.4895 Constraint 623 937 5.4544 6.8180 13.6359 0.4893 Constraint 818 921 4.7883 5.9853 11.9706 0.4893 Constraint 196 530 5.1365 6.4206 12.8411 0.4888 Constraint 818 908 5.4161 6.7701 13.5403 0.4887 Constraint 800 997 4.0635 5.0794 10.1588 0.4885 Constraint 968 1213 5.4792 6.8490 13.6980 0.4882 Constraint 448 748 4.5362 5.6702 11.3404 0.4875 Constraint 263 549 6.0940 7.6175 15.2349 0.4873 Constraint 1133 1251 5.1809 6.4761 12.9522 0.4873 Constraint 128 968 5.6345 7.0431 14.0862 0.4873 Constraint 690 1046 4.8795 6.0994 12.1988 0.4871 Constraint 521 690 4.9818 6.2272 12.4544 0.4870 Constraint 501 1030 5.0956 6.3695 12.7390 0.4863 Constraint 731 1317 3.9787 4.9734 9.9468 0.4858 Constraint 706 818 5.1302 6.4128 12.8255 0.4857 Constraint 963 1526 4.0034 5.0043 10.0086 0.4851 Constraint 722 818 5.0652 6.3315 12.6631 0.4851 Constraint 722 829 5.2383 6.5478 13.0956 0.4845 Constraint 1246 1678 4.6655 5.8319 11.6637 0.4841 Constraint 1301 1634 5.5903 6.9878 13.9757 0.4839 Constraint 384 557 4.0391 5.0489 10.0979 0.4834 Constraint 1014 1193 5.7361 7.1701 14.3402 0.4829 Constraint 172 538 3.8578 4.8223 9.6446 0.4824 Constraint 429 722 5.5555 6.9444 13.8888 0.4823 Constraint 1084 1325 5.7644 7.2055 14.4111 0.4818 Constraint 937 1158 4.7895 5.9869 11.9738 0.4818 Constraint 579 673 6.1927 7.7409 15.4818 0.4816 Constraint 657 818 5.9623 7.4529 14.9059 0.4815 Constraint 1158 1343 5.2235 6.5294 13.0588 0.4815 Constraint 829 1416 4.8927 6.1158 12.2316 0.4812 Constraint 530 968 5.4594 6.8243 13.6485 0.4800 Constraint 39 189 5.2142 6.5177 13.0354 0.4799 Constraint 921 1167 5.0695 6.3368 12.6737 0.4798 Constraint 589 673 5.0435 6.3044 12.6088 0.4797 Constraint 1077 1158 4.5057 5.6321 11.2642 0.4796 Constraint 1382 1703 5.4723 6.8404 13.6809 0.4794 Constraint 800 868 5.3344 6.6680 13.3361 0.4793 Constraint 1391 1503 5.8594 7.3243 14.6485 0.4792 Constraint 448 899 5.5304 6.9130 13.8261 0.4789 Constraint 579 681 4.8277 6.0346 12.0692 0.4789 Constraint 333 800 5.7731 7.2163 14.4327 0.4782 Constraint 412 690 5.6052 7.0065 14.0129 0.4779 Constraint 274 1109 5.5448 6.9309 13.8619 0.4777 Constraint 435 510 4.6635 5.8293 11.6587 0.4777 Constraint 493 1046 4.3944 5.4930 10.9859 0.4774 Constraint 384 1158 4.8865 6.1082 12.2164 0.4774 Constraint 363 1158 4.0904 5.1130 10.2259 0.4774 Constraint 233 739 6.0957 7.6197 15.2393 0.4774 Constraint 180 510 6.1481 7.6851 15.3702 0.4774 Constraint 164 1399 5.7113 7.1392 14.2783 0.4774 Constraint 249 363 5.1687 6.4609 12.9217 0.4770 Constraint 690 1030 4.7735 5.9669 11.9337 0.4769 Constraint 706 783 5.8477 7.3096 14.6191 0.4765 Constraint 665 944 4.8751 6.0938 12.1876 0.4763 Constraint 1213 1366 5.9380 7.4225 14.8450 0.4762 Constraint 1014 1343 4.8416 6.0520 12.1041 0.4762 Constraint 77 557 4.9406 6.1757 12.3514 0.4758 Constraint 180 681 5.8050 7.2562 14.5124 0.4757 Constraint 172 1092 5.9310 7.4138 14.8276 0.4757 Constraint 136 1149 5.1577 6.4472 12.8943 0.4757 Constraint 128 1125 5.1701 6.4626 12.9252 0.4757 Constraint 128 1117 5.5148 6.8935 13.7871 0.4757 Constraint 112 1178 5.6080 7.0100 14.0201 0.4757 Constraint 112 1149 5.0692 6.3365 12.6730 0.4757 Constraint 112 1125 4.7459 5.9324 11.8648 0.4757 Constraint 104 1125 4.2678 5.3347 10.6695 0.4757 Constraint 493 836 4.3517 5.4397 10.8793 0.4757 Constraint 1030 1541 4.5467 5.6834 11.3667 0.4744 Constraint 189 448 5.7423 7.1779 14.3558 0.4738 Constraint 783 1014 5.2924 6.6155 13.2311 0.4737 Constraint 487 706 4.5877 5.7347 11.4694 0.4735 Constraint 1109 1438 5.5502 6.9378 13.8755 0.4733 Constraint 189 538 5.9475 7.4344 14.8687 0.4725 Constraint 1030 1158 5.5647 6.9558 13.9116 0.4722 Constraint 274 493 4.7240 5.9050 11.8099 0.4721 Constraint 47 968 5.4157 6.7697 13.5393 0.4720 Constraint 1149 1228 5.2091 6.5114 13.0227 0.4718 Constraint 549 783 5.7640 7.2050 14.4100 0.4711 Constraint 829 908 5.7934 7.2417 14.4834 0.4710 Constraint 1246 1657 5.7366 7.1708 14.3415 0.4706 Constraint 1141 1678 4.0569 5.0711 10.1423 0.4703 Constraint 1301 1391 5.8717 7.3396 14.6792 0.4701 Constraint 1100 1678 4.3711 5.4638 10.9276 0.4696 Constraint 1046 1471 5.2084 6.5105 13.0211 0.4691 Constraint 564 756 5.0185 6.2731 12.5463 0.4689 Constraint 681 808 5.7556 7.1945 14.3890 0.4687 Constraint 333 421 5.0885 6.3606 12.7213 0.4682 Constraint 1276 1408 5.3778 6.7223 13.4445 0.4682 Constraint 1068 1447 6.1517 7.6896 15.3793 0.4670 Constraint 1399 1678 5.9738 7.4673 14.9346 0.4668 Constraint 761 1014 5.0729 6.3412 12.6823 0.4664 Constraint 713 818 4.3517 5.4397 10.8794 0.4662 Constraint 299 448 4.8785 6.0982 12.1963 0.4656 Constraint 1084 1541 5.1340 6.4175 12.8350 0.4647 Constraint 1084 1556 5.7448 7.1809 14.3619 0.4643 Constraint 189 1092 5.7542 7.1928 14.3856 0.4641 Constraint 1084 1603 5.3860 6.7325 13.4649 0.4638 Constraint 1035 1260 4.0094 5.0118 10.0236 0.4637 Constraint 1125 1731 5.8812 7.3515 14.7029 0.4632 Constraint 913 1447 5.9848 7.4810 14.9621 0.4631 Constraint 1014 1167 5.2313 6.5391 13.0783 0.4631 Constraint 1309 1466 5.6548 7.0684 14.1369 0.4630 Constraint 1054 1596 5.6148 7.0185 14.0369 0.4626 Constraint 623 913 5.1930 6.4913 12.9826 0.4623 Constraint 1556 1731 5.6604 7.0755 14.1510 0.4621 Constraint 249 818 4.4195 5.5244 11.0487 0.4621 Constraint 299 443 5.3054 6.6318 13.2636 0.4620 Constraint 216 589 4.9157 6.1446 12.2891 0.4619 Constraint 1068 1343 5.6730 7.0912 14.1824 0.4615 Constraint 145 608 6.2838 7.8548 15.7096 0.4609 Constraint 448 908 5.4871 6.8588 13.7177 0.4607 Constraint 421 836 5.5293 6.9116 13.8231 0.4607 Constraint 623 1317 6.1558 7.6947 15.3894 0.4600 Constraint 997 1526 4.6421 5.8026 11.6053 0.4599 Constraint 325 443 4.7911 5.9889 11.9778 0.4594 Constraint 325 421 3.6249 4.5311 9.0622 0.4594 Constraint 1059 1301 4.5571 5.6963 11.3926 0.4594 Constraint 657 876 5.6983 7.1228 14.2457 0.4591 Constraint 1268 1366 5.0778 6.3472 12.6944 0.4588 Constraint 665 1014 5.0596 6.3245 12.6490 0.4578 Constraint 557 769 4.9280 6.1600 12.3199 0.4577 Constraint 698 792 4.8753 6.0941 12.1882 0.4576 Constraint 1035 1343 5.0425 6.3031 12.6062 0.4572 Constraint 1117 1649 5.1631 6.4539 12.9077 0.4564 Constraint 263 521 4.4095 5.5119 11.0239 0.4561 Constraint 1268 1343 4.8868 6.1085 12.2170 0.4558 Constraint 944 1246 5.6942 7.1178 14.2356 0.4555 Constraint 538 778 5.4066 6.7582 13.5164 0.4538 Constraint 630 836 4.6001 5.7502 11.5003 0.4536 Constraint 1204 1447 4.7173 5.8966 11.7932 0.4536 Constraint 1427 1703 5.6673 7.0842 14.1684 0.4533 Constraint 623 761 5.3181 6.6477 13.2954 0.4530 Constraint 1008 1503 4.9159 6.1448 12.2897 0.4527 Constraint 1092 1246 5.2343 6.5429 13.0858 0.4526 Constraint 698 1125 3.3098 4.1372 8.2744 0.4525 Constraint 216 579 6.2103 7.7628 15.5257 0.4525 Constraint 665 968 4.9002 6.1252 12.2504 0.4515 Constraint 1596 1731 5.3439 6.6799 13.3597 0.4512 Constraint 623 848 4.5049 5.6311 11.2622 0.4512 Constraint 47 121 4.8950 6.1187 12.2375 0.4503 Constraint 616 769 4.8429 6.0536 12.1072 0.4502 Constraint 564 944 5.4599 6.8249 13.6498 0.4501 Constraint 1519 1703 5.0773 6.3466 12.6932 0.4496 Constraint 868 1178 5.1481 6.4351 12.8702 0.4496 Constraint 968 1541 4.6842 5.8552 11.7105 0.4495 Constraint 756 1008 5.3867 6.7334 13.4667 0.4492 Constraint 1125 1739 4.8802 6.1003 12.2006 0.4488 Constraint 91 597 5.2489 6.5612 13.1223 0.4486 Constraint 91 589 6.0430 7.5538 15.1076 0.4486 Constraint 988 1301 6.0294 7.5368 15.0735 0.4483 Constraint 748 836 5.3247 6.6558 13.3117 0.4482 Constraint 1193 1293 5.9803 7.4754 14.9507 0.4481 Constraint 285 818 6.3379 7.9224 15.8448 0.4476 Constraint 1325 1399 4.2954 5.3693 10.7385 0.4473 Constraint 1293 1739 4.9528 6.1910 12.3820 0.4468 Constraint 1030 1193 5.7362 7.1703 14.3406 0.4460 Constraint 1447 1611 4.9807 6.2259 12.4517 0.4460 Constraint 1030 1391 4.7264 5.9080 11.8160 0.4457 Constraint 104 1068 4.3468 5.4335 10.8670 0.4457 Constraint 1251 1479 5.8117 7.2647 14.5294 0.4456 Constraint 988 1526 4.6869 5.8586 11.7173 0.4455 Constraint 1548 1703 4.9682 6.2102 12.4204 0.4455 Constraint 1084 1471 4.6914 5.8642 11.7285 0.4452 Constraint 756 836 4.9849 6.2311 12.4622 0.4449 Constraint 1526 1756 5.5012 6.8765 13.7529 0.4448 Constraint 1054 1575 5.4157 6.7696 13.5392 0.4440 Constraint 921 1526 4.9290 6.1613 12.3226 0.4440 Constraint 1556 1678 3.7014 4.6268 9.2535 0.4439 Constraint 1008 1239 5.7426 7.1783 14.3566 0.4439 Constraint 82 180 5.8325 7.2907 14.5813 0.4435 Constraint 1293 1427 5.2584 6.5729 13.1459 0.4433 Constraint 493 783 5.5484 6.9356 13.8711 0.4425 Constraint 333 937 3.8935 4.8669 9.7337 0.4423 Constraint 1634 1731 5.2959 6.6198 13.2397 0.4422 Constraint 665 1125 4.7752 5.9690 11.9381 0.4420 Constraint 263 579 6.0734 7.5917 15.1834 0.4418 Constraint 988 1382 4.7454 5.9318 11.8636 0.4402 Constraint 66 164 4.6535 5.8169 11.6339 0.4399 Constraint 800 1447 4.7207 5.9009 11.8018 0.4394 Constraint 937 1251 5.0800 6.3500 12.7000 0.4391 Constraint 128 493 5.2608 6.5760 13.1521 0.4377 Constraint 1193 1526 6.0005 7.5006 15.0012 0.4374 Constraint 256 1309 5.1586 6.4483 12.8965 0.4374 Constraint 549 706 5.3262 6.6577 13.3154 0.4371 Constraint 1077 1466 4.9078 6.1348 12.2695 0.4371 Constraint 314 818 5.5776 6.9720 13.9441 0.4371 Constraint 233 306 4.4099 5.5123 11.0247 0.4370 Constraint 808 1167 5.3192 6.6489 13.2979 0.4364 Constraint 564 913 5.1841 6.4801 12.9603 0.4364 Constraint 778 1014 4.3424 5.4280 10.8560 0.4362 Constraint 355 944 5.5059 6.8824 13.7648 0.4360 Constraint 222 564 5.6498 7.0622 14.1244 0.4359 Constraint 1246 1317 4.1135 5.1419 10.2837 0.4357 Constraint 1503 1678 4.6817 5.8521 11.7043 0.4352 Constraint 1366 1466 5.2649 6.5811 13.1622 0.4351 Constraint 1408 1511 5.4086 6.7608 13.5216 0.4350 Constraint 722 980 4.7570 5.9462 11.8924 0.4348 Constraint 980 1358 5.1599 6.4498 12.8996 0.4339 Constraint 1109 1447 5.4485 6.8106 13.6212 0.4334 Constraint 1133 1503 3.9346 4.9182 9.8364 0.4331 Constraint 690 944 5.5659 6.9574 13.9148 0.4331 Constraint 1556 1657 5.8641 7.3301 14.6602 0.4316 Constraint 154 681 6.0428 7.5535 15.1069 0.4314 Constraint 1382 1662 6.0036 7.5045 15.0090 0.4314 Constraint 848 1030 5.1642 6.4553 12.9105 0.4312 Constraint 1556 1670 3.5825 4.4781 8.9562 0.4311 Constraint 285 848 5.4837 6.8547 13.7093 0.4307 Constraint 1416 1567 4.1364 5.1705 10.3411 0.4305 Constraint 314 980 4.1110 5.1388 10.2775 0.4300 Constraint 180 650 4.3107 5.3883 10.7766 0.4299 Constraint 913 1416 5.7558 7.1947 14.3894 0.4293 Constraint 1167 1260 4.8811 6.1013 12.2027 0.4291 Constraint 241 314 3.7311 4.6638 9.3277 0.4290 Constraint 980 1503 6.0304 7.5380 15.0761 0.4288 Constraint 448 836 5.0047 6.2558 12.5116 0.4287 Constraint 829 1054 5.1729 6.4662 12.9323 0.4286 Constraint 769 968 5.5408 6.9259 13.8519 0.4282 Constraint 306 443 4.7764 5.9705 11.9409 0.4281 Constraint 196 1301 5.4076 6.7595 13.5190 0.4277 Constraint 136 1358 5.9264 7.4080 14.8161 0.4277 Constraint 241 501 5.3699 6.7124 13.4247 0.4272 Constraint 421 968 4.5609 5.7012 11.4023 0.4272 Constraint 1382 1683 5.9717 7.4647 14.9294 0.4271 Constraint 1141 1374 4.9997 6.2496 12.4993 0.4265 Constraint 91 521 5.8305 7.2882 14.5763 0.4263 Constraint 778 1382 5.7274 7.1592 14.3184 0.4260 Constraint 333 930 5.3258 6.6572 13.3144 0.4259 Constraint 623 1035 4.7090 5.8862 11.7724 0.4258 Constraint 128 557 3.9867 4.9834 9.9667 0.4255 Constraint 639 769 5.3631 6.7039 13.4078 0.4253 Constraint 1035 1503 4.0311 5.0388 10.0777 0.4252 Constraint 216 538 4.6845 5.8556 11.7111 0.4252 Constraint 1014 1276 6.2656 7.8320 15.6640 0.4238 Constraint 884 1301 4.5970 5.7462 11.4924 0.4237 Constraint 1054 1343 4.6038 5.7548 11.5096 0.4237 Constraint 189 944 5.1142 6.3927 12.7855 0.4232 Constraint 848 1008 4.1378 5.1722 10.3444 0.4232 Constraint 1014 1374 5.5708 6.9634 13.9269 0.4231 Constraint 639 1239 5.0672 6.3340 12.6680 0.4214 Constraint 429 665 4.7538 5.9422 11.8845 0.4214 Constraint 1511 1670 5.9885 7.4856 14.9712 0.4211 Constraint 314 421 3.7306 4.6633 9.3266 0.4211 Constraint 274 937 5.0043 6.2553 12.5106 0.4209 Constraint 128 1008 4.3885 5.4857 10.9713 0.4206 Constraint 980 1054 5.0605 6.3256 12.6513 0.4199 Constraint 233 579 5.7466 7.1832 14.3665 0.4199 Constraint 1351 1683 4.6677 5.8346 11.6691 0.4199 Constraint 997 1427 5.4933 6.8666 13.7333 0.4199 Constraint 937 1276 4.7786 5.9733 11.9465 0.4193 Constraint 274 892 5.3641 6.7051 13.4102 0.4184 Constraint 690 968 5.1728 6.4660 12.9320 0.4184 Constraint 1391 1731 4.7551 5.9438 11.8877 0.4172 Constraint 1503 1670 4.9786 6.2233 12.4466 0.4166 Constraint 1133 1603 6.1868 7.7335 15.4670 0.4166 Constraint 1246 1670 6.0454 7.5568 15.1136 0.4166 Constraint 1035 1494 5.3574 6.6968 13.3936 0.4164 Constraint 630 848 5.1986 6.4982 12.9964 0.4163 Constraint 930 1141 4.8241 6.0301 12.0601 0.4163 Constraint 208 650 4.1840 5.2300 10.4600 0.4160 Constraint 1014 1471 3.9835 4.9794 9.9588 0.4157 Constraint 859 1178 5.2688 6.5860 13.1720 0.4147 Constraint 1374 1662 5.1030 6.3788 12.7576 0.4146 Constraint 944 1030 5.0403 6.3004 12.6009 0.4145 Constraint 274 487 5.9490 7.4363 14.8726 0.4140 Constraint 1471 1575 3.7498 4.6872 9.3744 0.4139 Constraint 937 1239 6.2747 7.8433 15.6867 0.4132 Constraint 818 980 5.0323 6.2904 12.5808 0.4128 Constraint 1077 1541 4.5873 5.7341 11.4682 0.4127 Constraint 285 963 5.1491 6.4364 12.8728 0.4127 Constraint 1494 1575 4.7873 5.9842 11.9683 0.4125 Constraint 713 848 4.9331 6.1664 12.3328 0.4123 Constraint 808 955 4.6731 5.8414 11.6829 0.4123 Constraint 997 1358 4.6152 5.7691 11.5381 0.4121 Constraint 988 1351 6.1389 7.6737 15.3473 0.4121 Constraint 164 363 5.0344 6.2930 12.5860 0.4118 Constraint 1325 1447 5.2983 6.6229 13.2458 0.4116 Constraint 761 836 5.2752 6.5940 13.1879 0.4115 Constraint 429 521 5.4494 6.8118 13.6236 0.4114 Constraint 1293 1649 5.2705 6.5881 13.1763 0.4114 Constraint 299 521 6.2929 7.8662 15.7323 0.4114 Constraint 363 876 4.0982 5.1227 10.2454 0.4112 Constraint 1309 1471 5.7866 7.2332 14.4664 0.4109 Constraint 756 1077 5.5352 6.9190 13.8380 0.4108 Constraint 154 968 4.6973 5.8717 11.7434 0.4107 Constraint 227 1133 4.4048 5.5060 11.0120 0.4099 Constraint 1213 1284 4.5509 5.6887 11.3774 0.4096 Constraint 1293 1567 4.5364 5.6705 11.3411 0.4096 Constraint 997 1466 4.8754 6.0943 12.1885 0.4094 Constraint 314 944 5.6551 7.0688 14.1377 0.4094 Constraint 1438 1556 5.2144 6.5180 13.0359 0.4093 Constraint 930 1317 6.0612 7.5765 15.1531 0.4091 Constraint 241 579 5.7930 7.2413 14.4826 0.4084 Constraint 579 808 5.7260 7.1575 14.3149 0.4083 Constraint 412 557 4.1102 5.1377 10.2755 0.4080 Constraint 1284 1416 5.5247 6.9059 13.8119 0.4079 Constraint 521 800 5.7671 7.2088 14.4177 0.4078 Constraint 665 1008 5.1295 6.4118 12.8237 0.4075 Constraint 1077 1533 5.7248 7.1560 14.3119 0.4071 Constraint 769 836 4.5697 5.7122 11.4243 0.4070 Constraint 164 233 5.6391 7.0488 14.0977 0.4069 Constraint 690 848 5.0772 6.3465 12.6931 0.4068 Constraint 955 1167 5.2423 6.5529 13.1058 0.4068 Constraint 1213 1447 5.3262 6.6578 13.3155 0.4067 Constraint 1077 1325 5.1035 6.3794 12.7588 0.4065 Constraint 392 690 5.3389 6.6736 13.3472 0.4062 Constraint 249 913 4.9156 6.1444 12.2889 0.4058 Constraint 1068 1657 6.0095 7.5118 15.0237 0.4057 Constraint 448 876 4.9262 6.1577 12.3155 0.4055 Constraint 233 639 5.8419 7.3024 14.6047 0.4055 Constraint 1077 1748 4.8243 6.0304 12.0608 0.4037 Constraint 722 1125 5.9894 7.4868 14.9736 0.4037 Constraint 263 739 4.4883 5.6103 11.2206 0.4037 Constraint 501 783 5.3366 6.6708 13.3415 0.4035 Constraint 836 908 4.3248 5.4060 10.8120 0.4033 Constraint 1084 1358 5.9815 7.4769 14.9538 0.4033 Constraint 1035 1204 5.6354 7.0443 14.0886 0.4031 Constraint 196 1325 3.2274 4.0343 8.0686 0.4030 Constraint 189 1046 5.3863 6.7329 13.4657 0.4026 Constraint 421 1133 5.6474 7.0592 14.1185 0.4025 Constraint 1054 1541 5.5165 6.8957 13.7913 0.4024 Constraint 294 1030 5.4751 6.8439 13.6879 0.4023 Constraint 1022 1455 4.0405 5.0506 10.1012 0.4023 Constraint 988 1455 6.0384 7.5480 15.0960 0.4023 Constraint 77 1100 5.8109 7.2636 14.5271 0.4023 Constraint 748 818 4.9211 6.1513 12.3027 0.4022 Constraint 1455 1596 5.6851 7.1064 14.2127 0.4021 Constraint 761 1035 5.4118 6.7647 13.5294 0.4016 Constraint 1494 1670 5.0780 6.3475 12.6949 0.4015 Constraint 980 1220 4.6206 5.7758 11.5515 0.4015 Constraint 761 1022 6.2663 7.8328 15.6657 0.4015 Constraint 616 1077 5.1765 6.4706 12.9413 0.4015 Constraint 1620 1756 5.0177 6.2721 12.5443 0.4007 Constraint 1366 1634 5.0062 6.2577 12.5155 0.4007 Constraint 1268 1466 5.3741 6.7176 13.4352 0.4007 Constraint 1133 1399 5.5114 6.8893 13.7786 0.4007 Constraint 1133 1343 4.4470 5.5588 11.1176 0.4007 Constraint 1133 1494 5.9355 7.4193 14.8387 0.4005 Constraint 572 639 4.8162 6.0202 12.0404 0.4005 Constraint 623 836 5.4618 6.8273 13.6546 0.4003 Constraint 756 944 4.9823 6.2278 12.4557 0.4002 Constraint 623 1077 3.6948 4.6185 9.2369 0.4002 Constraint 306 412 4.6892 5.8615 11.7231 0.4002 Constraint 1046 1382 5.0977 6.3721 12.7442 0.4000 Constraint 665 1084 5.9861 7.4827 14.9654 0.3998 Constraint 1366 1455 5.7333 7.1667 14.3333 0.3997 Constraint 233 690 4.7851 5.9813 11.9627 0.3995 Constraint 180 384 5.2003 6.5003 13.0007 0.3994 Constraint 355 579 4.4640 5.5801 11.1601 0.3993 Constraint 429 493 5.0884 6.3605 12.7209 0.3992 Constraint 222 501 5.3155 6.6443 13.2887 0.3992 Constraint 1084 1548 3.5215 4.4018 8.8037 0.3991 Constraint 1054 1494 5.4837 6.8546 13.7091 0.3991 Constraint 1100 1317 5.4039 6.7549 13.5097 0.3990 Constraint 104 493 4.8814 6.1017 12.2035 0.3990 Constraint 1427 1567 4.9660 6.2075 12.4151 0.3989 Constraint 1408 1657 6.0757 7.5946 15.1893 0.3988 Constraint 1239 1317 4.7081 5.8852 11.7703 0.3987 Constraint 1077 1714 5.4330 6.7913 13.5825 0.3981 Constraint 572 657 4.0996 5.1245 10.2491 0.3980 Constraint 1408 1488 5.6379 7.0474 14.0948 0.3979 Constraint 1596 1772 5.3454 6.6818 13.3635 0.3976 Constraint 180 792 5.5414 6.9267 13.8534 0.3976 Constraint 412 808 6.2882 7.8602 15.7205 0.3974 Constraint 314 968 6.0133 7.5166 15.0332 0.3974 Constraint 314 937 4.0160 5.0200 10.0400 0.3974 Constraint 1077 1391 6.1639 7.7049 15.4097 0.3974 Constraint 285 1158 5.7685 7.2106 14.4213 0.3973 Constraint 921 1133 4.5765 5.7206 11.4412 0.3972 Constraint 1125 1764 3.9460 4.9325 9.8650 0.3964 Constraint 988 1471 5.0443 6.3054 12.6107 0.3964 Constraint 421 1100 4.2802 5.3502 10.7005 0.3964 Constraint 493 800 4.5921 5.7401 11.4803 0.3960 Constraint 1059 1567 5.9169 7.3962 14.7923 0.3959 Constraint 421 1008 4.6263 5.7829 11.5658 0.3958 Constraint 256 944 6.1015 7.6268 15.2537 0.3957 Constraint 1511 1678 4.3342 5.4178 10.8355 0.3957 Constraint 538 868 5.6820 7.1024 14.2049 0.3954 Constraint 448 800 5.6746 7.0932 14.1864 0.3951 Constraint 1030 1427 4.6334 5.7917 11.5834 0.3950 Constraint 937 1541 5.6704 7.0880 14.1760 0.3950 Constraint 314 913 6.0644 7.5805 15.1611 0.3950 Constraint 306 899 4.3365 5.4206 10.8413 0.3950 Constraint 375 579 5.5203 6.9003 13.8007 0.3944 Constraint 216 650 4.2240 5.2799 10.5599 0.3943 Constraint 955 1117 5.5488 6.9360 13.8720 0.3940 Constraint 154 1008 5.4368 6.7960 13.5919 0.3938 Constraint 698 1008 5.5323 6.9153 13.8307 0.3933 Constraint 1204 1503 5.0152 6.2690 12.5379 0.3931 Constraint 800 1030 4.8575 6.0719 12.1437 0.3930 Constraint 384 713 4.3292 5.4116 10.8231 0.3928 Constraint 249 1260 5.4805 6.8506 13.7011 0.3927 Constraint 227 1239 5.8404 7.3005 14.6010 0.3927 Constraint 859 930 5.0672 6.3340 12.6681 0.3926 Constraint 1092 1683 6.0685 7.5857 15.1713 0.3925 Constraint 657 968 5.7234 7.1543 14.3085 0.3922 Constraint 1276 1466 5.6636 7.0795 14.1589 0.3921 Constraint 1125 1503 4.6532 5.8165 11.6329 0.3920 Constraint 673 1178 3.4172 4.2714 8.5429 0.3919 Constraint 1408 1503 5.9407 7.4259 14.8519 0.3917 Constraint 443 1046 4.1458 5.1823 10.3645 0.3914 Constraint 579 836 3.9848 4.9810 9.9619 0.3914 Constraint 347 818 5.7332 7.1665 14.3331 0.3914 Constraint 216 306 4.4787 5.5984 11.1968 0.3914 Constraint 650 836 6.0182 7.5228 15.0455 0.3908 Constraint 333 778 4.8166 6.0207 12.0415 0.3904 Constraint 429 657 5.5690 6.9612 13.9224 0.3903 Constraint 333 783 4.9189 6.1486 12.2973 0.3901 Constraint 189 1293 4.3707 5.4634 10.9268 0.3898 Constraint 1008 1133 5.1905 6.4882 12.9763 0.3896 Constraint 180 1438 5.2436 6.5544 13.1089 0.3895 Constraint 333 884 5.0743 6.3429 12.6858 0.3894 Constraint 466 756 4.6441 5.8051 11.6102 0.3894 Constraint 1488 1620 6.1903 7.7379 15.4758 0.3886 Constraint 778 1374 4.2499 5.3124 10.6249 0.3885 Constraint 189 363 4.6491 5.8113 11.6226 0.3884 Constraint 1084 1438 5.3194 6.6493 13.2986 0.3879 Constraint 363 713 4.4555 5.5694 11.1388 0.3878 Constraint 997 1325 5.4818 6.8522 13.7045 0.3878 Constraint 66 608 6.0166 7.5207 15.0414 0.3876 Constraint 800 1014 5.3521 6.6902 13.3803 0.3873 Constraint 274 1149 5.5644 6.9556 13.9111 0.3872 Constraint 392 479 4.5958 5.7448 11.4896 0.3869 Constraint 944 1293 5.2762 6.5953 13.1906 0.3868 Constraint 448 829 4.2054 5.2567 10.5134 0.3867 Constraint 249 501 4.5334 5.6667 11.3335 0.3862 Constraint 1077 1343 4.2682 5.3352 10.6705 0.3861 Constraint 1374 1657 5.5965 6.9956 13.9912 0.3859 Constraint 1228 1756 5.5989 6.9986 13.9972 0.3859 Constraint 1141 1220 5.9456 7.4320 14.8639 0.3857 Constraint 665 1035 4.3452 5.4315 10.8630 0.3856 Constraint 1092 1657 6.1831 7.7289 15.4577 0.3854 Constraint 233 1366 4.8371 6.0463 12.0927 0.3854 Constraint 154 1471 5.5327 6.9159 13.8318 0.3852 Constraint 673 756 4.4730 5.5912 11.1825 0.3852 Constraint 930 1149 4.5708 5.7135 11.4270 0.3850 Constraint 249 1149 4.5189 5.6486 11.2973 0.3846 Constraint 1317 1575 5.1558 6.4448 12.8895 0.3845 Constraint 1351 1670 5.0431 6.3039 12.6078 0.3842 Constraint 1109 1374 4.9043 6.1304 12.2608 0.3839 Constraint 1503 1575 3.8183 4.7728 9.5456 0.3837 Constraint 1228 1488 6.1140 7.6424 15.2849 0.3837 Constraint 616 1662 6.0191 7.5239 15.0478 0.3837 Constraint 216 325 4.8693 6.0866 12.1732 0.3835 Constraint 1133 1366 4.7943 5.9928 11.9857 0.3832 Constraint 731 808 4.9093 6.1366 12.2732 0.3830 Constraint 756 829 4.8874 6.1093 12.2186 0.3826 Constraint 783 988 4.4892 5.6115 11.2229 0.3825 Constraint 1141 1596 5.8333 7.2917 14.5833 0.3825 Constraint 1059 1575 4.4744 5.5931 11.1861 0.3824 Constraint 748 829 4.9942 6.2427 12.4854 0.3823 Constraint 1133 1596 5.9909 7.4887 14.9773 0.3820 Constraint 1092 1268 4.5892 5.7365 11.4731 0.3820 Constraint 1511 1683 4.9494 6.1867 12.3735 0.3819 Constraint 1293 1670 5.4205 6.7756 13.5512 0.3819 Constraint 1014 1503 4.4017 5.5021 11.0041 0.3819 Constraint 1014 1494 4.1446 5.1807 10.3614 0.3819 Constraint 1008 1366 5.4432 6.8040 13.6081 0.3819 Constraint 980 1251 5.6122 7.0153 14.0306 0.3819 Constraint 937 1246 3.2296 4.0370 8.0740 0.3819 Constraint 913 1309 4.8842 6.1053 12.2105 0.3819 Constraint 913 1276 3.8396 4.7995 9.5989 0.3819 Constraint 761 997 3.7905 4.7381 9.4763 0.3819 Constraint 756 1100 5.6708 7.0885 14.1769 0.3819 Constraint 665 1149 4.1277 5.1597 10.3193 0.3819 Constraint 589 1133 4.9162 6.1452 12.2905 0.3819 Constraint 530 1022 4.5086 5.6358 11.2715 0.3819 Constraint 448 1100 5.6000 7.0000 14.0001 0.3819 Constraint 448 1077 6.1099 7.6374 15.2748 0.3819 Constraint 333 1158 6.0013 7.5017 15.0033 0.3819 Constraint 306 1158 6.0775 7.5969 15.1937 0.3819 Constraint 274 1228 3.8223 4.7779 9.5558 0.3819 Constraint 263 479 5.5096 6.8870 13.7740 0.3819 Constraint 233 769 4.3958 5.4948 10.9895 0.3819 Constraint 222 1030 5.3195 6.6493 13.2986 0.3819 Constraint 180 818 5.1584 6.4480 12.8961 0.3819 Constraint 172 769 5.2708 6.5885 13.1770 0.3819 Constraint 121 876 5.2290 6.5363 13.0726 0.3819 Constraint 97 876 3.7846 4.7307 9.4614 0.3819 Constraint 97 180 5.4781 6.8476 13.6951 0.3819 Constraint 1193 1317 4.1783 5.2228 10.4457 0.3819 Constraint 1030 1141 4.3253 5.4066 10.8132 0.3818 Constraint 501 1077 5.9691 7.4614 14.9227 0.3818 Constraint 1548 1670 5.5787 6.9734 13.9469 0.3814 Constraint 487 748 4.7079 5.8849 11.7698 0.3811 Constraint 1325 1649 5.4036 6.7545 13.5090 0.3807 Constraint 1366 1739 6.3240 7.9050 15.8100 0.3806 Constraint 1054 1391 5.2295 6.5369 13.0737 0.3806 Constraint 963 1541 3.8377 4.7972 9.5943 0.3806 Constraint 713 1788 5.2637 6.5796 13.1593 0.3806 Constraint 314 955 5.1002 6.3752 12.7504 0.3806 Constraint 314 921 4.1329 5.1661 10.3322 0.3806 Constraint 314 899 5.1276 6.4095 12.8189 0.3806 Constraint 299 487 6.3869 7.9836 15.9672 0.3806 Constraint 294 980 5.0311 6.2889 12.5779 0.3806 Constraint 256 1035 4.6963 5.8704 11.7407 0.3806 Constraint 256 955 4.7317 5.9146 11.8292 0.3806 Constraint 233 650 6.2713 7.8391 15.6781 0.3806 Constraint 227 1054 5.9912 7.4890 14.9779 0.3806 Constraint 227 988 6.3924 7.9906 15.9811 0.3806 Constraint 222 1756 5.9830 7.4787 14.9575 0.3806 Constraint 216 639 6.2883 7.8604 15.7208 0.3806 Constraint 216 597 5.0639 6.3299 12.6599 0.3806 Constraint 196 1756 6.3887 7.9859 15.9717 0.3806 Constraint 189 1788 3.8601 4.8252 9.6504 0.3806 Constraint 189 597 5.7290 7.1613 14.3226 0.3806 Constraint 164 1788 4.9301 6.1627 12.3254 0.3806 Constraint 154 1788 5.3069 6.6336 13.2672 0.3806 Constraint 145 589 3.3355 4.1693 8.3386 0.3806 Constraint 128 1068 5.2284 6.5354 13.0709 0.3806 Constraint 112 1068 4.7697 5.9621 11.9242 0.3806 Constraint 104 1046 6.0370 7.5462 15.0924 0.3806 Constraint 77 1178 5.8184 7.2730 14.5461 0.3806 Constraint 47 1100 5.9766 7.4707 14.9414 0.3806 Constraint 623 968 5.2549 6.5686 13.1371 0.3805 Constraint 623 1293 5.0590 6.3237 12.6474 0.3802 Constraint 1301 1678 5.1450 6.4312 12.8625 0.3802 Constraint 1634 1703 4.5787 5.7234 11.4467 0.3801 Constraint 196 274 5.3107 6.6384 13.2767 0.3801 Constraint 501 968 5.1643 6.4554 12.9107 0.3796 Constraint 892 1351 5.6737 7.0921 14.1842 0.3790 Constraint 1541 1703 4.9095 6.1368 12.2736 0.3789 Constraint 980 1317 4.4555 5.5694 11.1388 0.3788 Constraint 1100 1399 4.7261 5.9077 11.8154 0.3784 Constraint 1220 1317 5.1484 6.4355 12.8710 0.3783 Constraint 800 1077 5.3196 6.6495 13.2990 0.3780 Constraint 1008 1077 4.1934 5.2418 10.4835 0.3779 Constraint 448 868 4.8513 6.0642 12.1283 0.3778 Constraint 1260 1567 5.5659 6.9574 13.9148 0.3773 Constraint 937 1149 4.9025 6.1282 12.2563 0.3773 Constraint 937 1133 4.2503 5.3129 10.6258 0.3773 Constraint 913 1133 5.1520 6.4401 12.8801 0.3773 Constraint 1220 1756 5.4665 6.8331 13.6661 0.3770 Constraint 493 997 4.5202 5.6502 11.3004 0.3770 Constraint 690 980 5.5682 6.9603 13.9205 0.3769 Constraint 1109 1399 4.0040 5.0050 10.0099 0.3764 Constraint 955 1239 4.3006 5.3758 10.7515 0.3757 Constraint 1471 1611 4.5750 5.7188 11.4375 0.3756 Constraint 1068 1587 5.5885 6.9856 13.9713 0.3756 Constraint 104 690 6.1130 7.6412 15.2824 0.3756 Constraint 657 944 4.6704 5.8380 11.6760 0.3756 Constraint 164 778 5.6375 7.0469 14.0939 0.3756 Constraint 1317 1416 4.1839 5.2299 10.4598 0.3755 Constraint 1479 1596 5.4231 6.7789 13.5577 0.3754 Constraint 1068 1358 6.0383 7.5479 15.0958 0.3752 Constraint 1325 1772 6.0676 7.5845 15.1690 0.3752 Constraint 510 706 5.3247 6.6559 13.3118 0.3751 Constraint 233 1575 6.2064 7.7579 15.5159 0.3751 Constraint 1030 1167 5.5671 6.9588 13.9177 0.3748 Constraint 681 783 4.7105 5.8881 11.7762 0.3744 Constraint 216 333 4.2439 5.3049 10.6098 0.3744 Constraint 1301 1620 5.9120 7.3900 14.7801 0.3740 Constraint 1567 1678 5.2920 6.6151 13.2301 0.3738 Constraint 778 1084 4.5259 5.6574 11.3147 0.3737 Constraint 189 412 5.6194 7.0242 14.0484 0.3732 Constraint 1317 1739 4.5470 5.6838 11.3676 0.3732 Constraint 1022 1683 6.0854 7.6067 15.2134 0.3732 Constraint 988 1620 5.4167 6.7708 13.5417 0.3732 Constraint 1268 1416 4.7979 5.9974 11.9948 0.3731 Constraint 589 778 5.3445 6.6807 13.3613 0.3730 Constraint 868 1447 5.8053 7.2566 14.5132 0.3725 Constraint 808 1260 4.6530 5.8163 11.6326 0.3724 Constraint 530 800 5.8442 7.3052 14.6104 0.3722 Constraint 698 1014 4.5622 5.7027 11.4055 0.3722 Constraint 1084 1284 4.1323 5.1654 10.3308 0.3720 Constraint 836 968 5.3716 6.7144 13.4289 0.3719 Constraint 493 657 5.3902 6.7377 13.4754 0.3718 Constraint 233 713 5.5497 6.9372 13.8743 0.3713 Constraint 216 713 5.4908 6.8635 13.7269 0.3713 Constraint 1068 1556 5.7458 7.1823 14.3646 0.3713 Constraint 1059 1556 5.5274 6.9092 13.8185 0.3713 Constraint 189 564 4.7687 5.9608 11.9217 0.3713 Constraint 657 980 5.5107 6.8884 13.7768 0.3710 Constraint 392 630 5.7918 7.2398 14.4796 0.3709 Constraint 1366 1548 4.5059 5.6324 11.2648 0.3708 Constraint 285 988 4.3174 5.3967 10.7935 0.3708 Constraint 1438 1603 5.5493 6.9366 13.8732 0.3708 Constraint 1575 1703 4.9779 6.2224 12.4447 0.3705 Constraint 392 800 5.3321 6.6652 13.3303 0.3704 Constraint 1077 1399 4.4784 5.5980 11.1959 0.3703 Constraint 1366 1620 3.9394 4.9242 9.8485 0.3701 Constraint 761 988 5.3280 6.6600 13.3201 0.3700 Constraint 748 1260 5.0407 6.3008 12.6017 0.3695 Constraint 1158 1260 4.9305 6.1632 12.3263 0.3688 Constraint 154 1526 5.6147 7.0184 14.0367 0.3688 Constraint 980 1117 5.6570 7.0712 14.1424 0.3685 Constraint 136 564 4.9255 6.1569 12.3137 0.3684 Constraint 392 1141 5.7818 7.2273 14.4545 0.3676 Constraint 363 1141 4.2442 5.3053 10.6106 0.3676 Constraint 164 1351 5.9588 7.4485 14.8970 0.3676 Constraint 1519 1670 3.9395 4.9244 9.8488 0.3675 Constraint 1246 1343 4.2358 5.2947 10.5895 0.3673 Constraint 1125 1494 5.1992 6.4990 12.9979 0.3668 Constraint 222 314 6.0731 7.5914 15.1827 0.3668 Constraint 868 980 4.8686 6.0857 12.1714 0.3661 Constraint 443 1228 5.9226 7.4032 14.8064 0.3654 Constraint 836 1541 5.2130 6.5162 13.0325 0.3649 Constraint 285 930 4.1861 5.2327 10.4653 0.3646 Constraint 233 1556 4.4422 5.5528 11.1056 0.3646 Constraint 1416 1519 4.9782 6.2228 12.4456 0.3642 Constraint 1167 1556 5.5716 6.9645 13.9289 0.3638 Constraint 1488 1596 4.4772 5.5965 11.1929 0.3638 Constraint 800 921 5.6149 7.0187 14.0373 0.3633 Constraint 778 921 5.0408 6.3010 12.6020 0.3631 Constraint 829 1260 4.0867 5.1084 10.2167 0.3629 Constraint 630 1133 5.6964 7.1205 14.2410 0.3627 Constraint 1084 1158 4.7864 5.9829 11.9659 0.3626 Constraint 1213 1692 3.9632 4.9540 9.9079 0.3625 Constraint 1092 1678 5.1353 6.4192 12.8384 0.3625 Constraint 1068 1703 4.9771 6.2213 12.4427 0.3625 Constraint 589 1692 5.4400 6.8000 13.6001 0.3625 Constraint 722 848 5.5455 6.9319 13.8637 0.3624 Constraint 196 493 4.8928 6.1159 12.2319 0.3624 Constraint 285 1125 4.2136 5.2670 10.5340 0.3619 Constraint 274 1125 5.1412 6.4265 12.8529 0.3619 Constraint 748 1008 4.6977 5.8721 11.7441 0.3615 Constraint 1408 1662 4.6174 5.7717 11.5434 0.3615 Constraint 1317 1533 6.3519 7.9399 15.8798 0.3615 Constraint 1293 1533 4.9108 6.1385 12.2769 0.3615 Constraint 487 756 4.7205 5.9006 11.8012 0.3615 Constraint 189 333 4.4568 5.5710 11.1421 0.3615 Constraint 1268 1511 5.3213 6.6516 13.3033 0.3613 Constraint 274 448 4.4498 5.5623 11.1246 0.3612 Constraint 306 1141 3.8317 4.7896 9.5792 0.3610 Constraint 1438 1526 5.2167 6.5209 13.0419 0.3609 Constraint 1268 1351 4.4116 5.5145 11.0290 0.3603 Constraint 1030 1213 4.8744 6.0930 12.1859 0.3600 Constraint 739 1317 5.0890 6.3613 12.7226 0.3600 Constraint 698 1158 5.4607 6.8259 13.6518 0.3593 Constraint 1427 1511 5.6426 7.0533 14.1065 0.3588 Constraint 1293 1556 5.5123 6.8904 13.7807 0.3588 Constraint 1167 1772 5.8372 7.2964 14.5929 0.3588 Constraint 1068 1649 6.2513 7.8141 15.6282 0.3588 Constraint 1068 1634 3.1546 3.9433 7.8865 0.3588 Constraint 1059 1714 6.0622 7.5778 15.1555 0.3588 Constraint 274 1284 5.8274 7.2843 14.5686 0.3587 Constraint 665 1030 5.3675 6.7093 13.4186 0.3586 Constraint 1220 1293 3.3183 4.1479 8.2958 0.3585 Constraint 285 1059 4.0782 5.0977 10.1954 0.3585 Constraint 164 756 4.0424 5.0530 10.1060 0.3585 Constraint 136 722 5.2929 6.6162 13.2323 0.3585 Constraint 1519 1678 4.3373 5.4216 10.8432 0.3583 Constraint 1567 1703 5.0514 6.3143 12.6285 0.3580 Constraint 363 722 5.6718 7.0898 14.1795 0.3580 Constraint 892 1030 4.8403 6.0504 12.1007 0.3579 Constraint 1068 1575 5.9074 7.3842 14.7684 0.3576 Constraint 884 1662 5.3661 6.7077 13.4154 0.3576 Constraint 884 1657 3.7215 4.6519 9.3037 0.3576 Constraint 189 783 6.1370 7.6712 15.3424 0.3576 Constraint 1092 1167 5.2233 6.5291 13.0581 0.3575 Constraint 1059 1246 4.5075 5.6344 11.2688 0.3575 Constraint 1008 1246 5.2979 6.6224 13.2448 0.3573 Constraint 968 1246 3.8153 4.7691 9.5381 0.3573 Constraint 196 1268 5.3394 6.6743 13.3486 0.3573 Constraint 196 1260 5.8454 7.3068 14.6135 0.3573 Constraint 164 1293 4.0817 5.1021 10.2042 0.3573 Constraint 792 859 5.2539 6.5674 13.1347 0.3571 Constraint 392 1117 3.7840 4.7300 9.4600 0.3571 Constraint 1317 1519 5.9921 7.4902 14.9804 0.3570 Constraint 1084 1739 5.8755 7.3444 14.6887 0.3570 Constraint 249 1246 4.3978 5.4973 10.9946 0.3569 Constraint 829 1109 4.7917 5.9896 11.9791 0.3567 Constraint 639 1260 4.6274 5.7843 11.5686 0.3564 Constraint 1109 1692 4.5655 5.7069 11.4137 0.3564 Constraint 1046 1596 5.4924 6.8656 13.7311 0.3564 Constraint 274 930 5.5738 6.9673 13.9346 0.3564 Constraint 1022 1541 4.0964 5.1205 10.2409 0.3562 Constraint 538 769 4.3717 5.4647 10.9293 0.3561 Constraint 930 1133 5.8187 7.2734 14.5468 0.3559 Constraint 1479 1603 4.6380 5.7976 11.5951 0.3558 Constraint 1077 1556 4.6049 5.7562 11.5123 0.3557 Constraint 1059 1548 3.4339 4.2924 8.5848 0.3557 Constraint 778 1603 4.5403 5.6754 11.3507 0.3555 Constraint 1575 1678 4.5222 5.6528 11.3056 0.3555 Constraint 713 1030 4.7126 5.8907 11.7814 0.3553 Constraint 1117 1764 5.7815 7.2268 14.4537 0.3552 Constraint 800 1054 4.7889 5.9861 11.9723 0.3550 Constraint 154 363 4.5419 5.6774 11.3549 0.3548 Constraint 698 980 4.1069 5.1336 10.2672 0.3547 Constraint 1293 1366 4.6884 5.8605 11.7209 0.3546 Constraint 189 1260 4.4050 5.5062 11.0125 0.3544 Constraint 748 1239 5.1606 6.4507 12.9014 0.3539 Constraint 429 623 4.5760 5.7200 11.4399 0.3539 Constraint 792 913 5.6488 7.0610 14.1219 0.3537 Constraint 104 698 5.7851 7.2314 14.4628 0.3534 Constraint 233 1399 5.6193 7.0241 14.0483 0.3533 Constraint 263 530 5.4695 6.8369 13.6739 0.3532 Constraint 783 1035 4.9737 6.2171 12.4343 0.3529 Constraint 1167 1541 5.4499 6.8124 13.6247 0.3528 Constraint 1167 1325 5.7139 7.1424 14.2847 0.3526 Constraint 921 1030 4.7074 5.8843 11.7686 0.3524 Constraint 1488 1634 4.2987 5.3734 10.7469 0.3521 Constraint 241 937 4.7493 5.9367 11.8734 0.3520 Constraint 172 421 4.3016 5.3770 10.7539 0.3519 Constraint 748 1068 3.6023 4.5029 9.0058 0.3516 Constraint 1068 1268 5.7560 7.1950 14.3900 0.3516 Constraint 572 690 5.1047 6.3809 12.7618 0.3513 Constraint 1603 1670 4.8855 6.1069 12.2137 0.3511 Constraint 493 1077 5.6352 7.0440 14.0880 0.3509 Constraint 722 1030 4.4289 5.5361 11.0721 0.3509 Constraint 274 564 5.4977 6.8721 13.7443 0.3509 Constraint 722 1035 5.3372 6.6715 13.3431 0.3507 Constraint 466 1022 5.3521 6.6902 13.3803 0.3507 Constraint 756 1014 3.5309 4.4136 8.8272 0.3505 Constraint 196 421 4.1663 5.2079 10.4158 0.3505 Constraint 1317 1731 5.5408 6.9261 13.8521 0.3499 Constraint 572 681 2.8831 3.6038 7.2077 0.3498 Constraint 429 818 5.8973 7.3717 14.7434 0.3493 Constraint 363 1133 4.0141 5.0177 10.0353 0.3493 Constraint 1391 1634 5.1285 6.4106 12.8213 0.3491 Constraint 274 673 4.8719 6.0898 12.1797 0.3491 Constraint 690 1077 5.2805 6.6007 13.2013 0.3483 Constraint 104 530 4.8146 6.0183 12.0365 0.3480 Constraint 690 778 6.1156 7.6445 15.2890 0.3469 Constraint 363 756 5.7414 7.1768 14.3535 0.3467 Constraint 333 1149 6.1606 7.7007 15.4014 0.3466 Constraint 1213 1408 5.0172 6.2715 12.5429 0.3465 Constraint 778 968 4.3071 5.3839 10.7678 0.3464 Constraint 608 1059 6.1204 7.6505 15.3011 0.3463 Constraint 510 639 5.1612 6.4514 12.9029 0.3462 Constraint 722 808 5.0673 6.3342 12.6684 0.3453 Constraint 748 944 4.7105 5.8881 11.7762 0.3450 Constraint 429 968 5.8131 7.2664 14.5328 0.3450 Constraint 690 829 4.9307 6.1634 12.3267 0.3444 Constraint 104 579 3.9440 4.9300 9.8601 0.3442 Constraint 1479 1611 5.0018 6.2522 12.5044 0.3442 Constraint 1035 1228 5.7589 7.1986 14.3972 0.3441 Constraint 196 1309 5.3463 6.6829 13.3657 0.3441 Constraint 557 639 5.4585 6.8232 13.6463 0.3436 Constraint 1596 1670 4.9640 6.2050 12.4100 0.3435 Constraint 1030 1556 5.5732 6.9665 13.9331 0.3433 Constraint 1649 1731 4.7043 5.8803 11.7606 0.3428 Constraint 403 639 4.9043 6.1304 12.2607 0.3425 Constraint 1351 1714 3.5145 4.3932 8.7863 0.3419 Constraint 1351 1692 5.6226 7.0282 14.0564 0.3419 Constraint 1343 1596 5.3167 6.6459 13.2917 0.3419 Constraint 1325 1739 4.6312 5.7890 11.5780 0.3419 Constraint 1317 1587 4.2758 5.3447 10.6895 0.3419 Constraint 1309 1596 3.0340 3.7925 7.5849 0.3419 Constraint 1309 1587 6.1103 7.6378 15.2757 0.3419 Constraint 1284 1772 4.9699 6.2124 12.4249 0.3419 Constraint 1213 1683 5.4058 6.7573 13.5146 0.3419 Constraint 1204 1692 2.8045 3.5057 7.0113 0.3419 Constraint 1193 1692 6.2952 7.8690 15.7379 0.3419 Constraint 1193 1494 5.1294 6.4118 12.8235 0.3419 Constraint 1193 1366 6.2060 7.7575 15.5150 0.3419 Constraint 1141 1683 5.1028 6.3785 12.7570 0.3419 Constraint 1141 1657 4.1485 5.1857 10.3713 0.3419 Constraint 1133 1374 4.6749 5.8436 11.6872 0.3419 Constraint 1117 1657 5.2703 6.5878 13.1757 0.3419 Constraint 1092 1764 5.9247 7.4059 14.8117 0.3419 Constraint 1092 1548 6.2899 7.8624 15.7248 0.3419 Constraint 1092 1541 4.3997 5.4996 10.9993 0.3419 Constraint 1077 1427 4.2519 5.3149 10.6299 0.3419 Constraint 1068 1603 6.2082 7.7602 15.5205 0.3419 Constraint 1068 1567 4.2284 5.2855 10.5710 0.3419 Constraint 1068 1533 6.2085 7.7606 15.5212 0.3419 Constraint 1054 1714 4.2869 5.3587 10.7174 0.3419 Constraint 1046 1714 4.2869 5.3587 10.7174 0.3419 Constraint 1035 1714 6.0670 7.5837 15.1675 0.3419 Constraint 1030 1276 6.2926 7.8657 15.7314 0.3419 Constraint 1022 1678 6.2849 7.8561 15.7122 0.3419 Constraint 1022 1620 5.6598 7.0748 14.1496 0.3419 Constraint 1022 1611 6.1215 7.6519 15.3038 0.3419 Constraint 1022 1603 4.2914 5.3642 10.7284 0.3419 Constraint 1022 1587 5.9464 7.4330 14.8661 0.3419 Constraint 1022 1276 5.9883 7.4854 14.9709 0.3419 Constraint 1014 1683 6.0785 7.5981 15.1962 0.3419 Constraint 1014 1657 3.1020 3.8775 7.7549 0.3419 Constraint 937 1141 5.8205 7.2756 14.5512 0.3419 Constraint 892 1657 4.3437 5.4296 10.8592 0.3419 Constraint 892 1649 4.2184 5.2730 10.5460 0.3419 Constraint 616 836 5.2418 6.5523 13.1046 0.3419 Constraint 589 1683 3.7037 4.6297 9.2593 0.3419 Constraint 589 1662 4.2759 5.3449 10.6897 0.3419 Constraint 564 1683 4.1377 5.1721 10.3442 0.3419 Constraint 557 808 3.2748 4.0935 8.1870 0.3419 Constraint 521 783 3.3863 4.2329 8.4659 0.3419 Constraint 384 1309 5.6774 7.0968 14.1935 0.3419 Constraint 347 1077 5.8160 7.2700 14.5400 0.3419 Constraint 347 783 4.7080 5.8851 11.7701 0.3419 Constraint 325 1466 5.1208 6.4010 12.8019 0.3419 Constraint 306 1447 5.8397 7.2997 14.5993 0.3419 Constraint 299 1447 4.7786 5.9733 11.9466 0.3419 Constraint 294 836 4.6357 5.7946 11.5892 0.3419 Constraint 285 1022 5.4322 6.7902 13.5805 0.3419 Constraint 256 1382 5.5069 6.8836 13.7672 0.3419 Constraint 256 1366 5.5129 6.8911 13.7821 0.3419 Constraint 256 1059 4.0402 5.0502 10.1005 0.3419 Constraint 233 1309 5.4035 6.7544 13.5089 0.3419 Constraint 222 783 6.1612 7.7015 15.4029 0.3419 Constraint 208 1575 4.0194 5.0242 10.0484 0.3419 Constraint 208 1366 4.7714 5.9642 11.9284 0.3419 Constraint 82 154 4.4365 5.5456 11.0913 0.3419 Constraint 77 665 5.2510 6.5638 13.1275 0.3419 Constraint 698 808 5.1378 6.4223 12.8445 0.3418 Constraint 722 968 5.5654 6.9568 13.9135 0.3415 Constraint 412 681 5.3091 6.6364 13.2729 0.3414 Constraint 154 980 5.0269 6.2836 12.5672 0.3412 Constraint 521 657 5.0009 6.2512 12.5023 0.3409 Constraint 557 963 4.8497 6.0621 12.1242 0.3407 Constraint 955 1109 4.9434 6.1793 12.3585 0.3406 Constraint 657 908 5.2828 6.6035 13.2070 0.3404 Constraint 564 1149 4.4025 5.5031 11.0063 0.3403 Constraint 421 690 4.6070 5.7588 11.5176 0.3398 Constraint 263 859 4.3800 5.4750 10.9500 0.3397 Constraint 988 1084 5.2055 6.5068 13.0137 0.3395 Constraint 1575 1739 5.8129 7.2661 14.5322 0.3388 Constraint 1077 1479 5.1495 6.4369 12.8738 0.3387 Constraint 1109 1178 4.6735 5.8419 11.6838 0.3386 Constraint 121 968 5.9337 7.4171 14.8343 0.3386 Constraint 1084 1479 4.6778 5.8472 11.6945 0.3385 Constraint 1268 1399 4.6947 5.8683 11.7367 0.3384 Constraint 665 937 5.0705 6.3381 12.6762 0.3381 Constraint 1575 1670 4.4561 5.5701 11.1402 0.3380 Constraint 154 392 4.2780 5.3475 10.6949 0.3379 Constraint 1035 1447 5.3050 6.6312 13.2624 0.3378 Constraint 944 1556 4.1114 5.1392 10.2785 0.3377 Constraint 285 368 4.9895 6.2369 12.4738 0.3375 Constraint 899 1035 5.3789 6.7237 13.4473 0.3371 Constraint 899 1030 4.3481 5.4352 10.8703 0.3371 Constraint 121 616 5.9944 7.4930 14.9860 0.3371 Constraint 665 1178 6.0196 7.5244 15.0489 0.3370 Constraint 249 333 4.5783 5.7229 11.4458 0.3369 Constraint 589 769 4.5916 5.7395 11.4791 0.3367 Constraint 748 1374 5.0046 6.2558 12.5116 0.3367 Constraint 748 997 4.9826 6.2283 12.4566 0.3366 Constraint 748 859 4.8159 6.0198 12.0397 0.3364 Constraint 222 1260 3.4621 4.3276 8.6551 0.3363 Constraint 589 1260 5.2454 6.5568 13.1136 0.3359 Constraint 222 997 4.3941 5.4927 10.9854 0.3359 Constraint 521 963 6.0815 7.6018 15.2037 0.3359 Constraint 1100 1284 4.5509 5.6886 11.3772 0.3355 Constraint 487 722 4.8491 6.0614 12.1227 0.3353 Constraint 1317 1455 4.9887 6.2358 12.4717 0.3352 Constraint 769 1260 5.2100 6.5126 13.0251 0.3350 Constraint 650 756 4.2878 5.3597 10.7194 0.3348 Constraint 1054 1533 4.6642 5.8302 11.6605 0.3347 Constraint 665 1158 4.6684 5.8354 11.6709 0.3340 Constraint 164 1046 3.8146 4.7682 9.5364 0.3338 Constraint 196 306 4.8293 6.0366 12.0732 0.3336 Constraint 493 665 5.3751 6.7188 13.4376 0.3336 Constraint 154 241 4.7771 5.9713 11.9427 0.3335 Constraint 164 241 4.3775 5.4719 10.9438 0.3333 Constraint 1158 1251 4.9806 6.2257 12.4514 0.3331 Constraint 189 1408 5.6174 7.0218 14.0436 0.3329 Constraint 657 1077 5.9107 7.3884 14.7768 0.3328 Constraint 1167 1567 4.4493 5.5616 11.1232 0.3327 Constraint 988 1054 5.1083 6.3854 12.7708 0.3327 Constraint 392 1109 4.5741 5.7176 11.4353 0.3322 Constraint 392 1092 6.2737 7.8421 15.6842 0.3322 Constraint 392 1084 4.2200 5.2750 10.5499 0.3322 Constraint 368 1149 6.0606 7.5757 15.1514 0.3322 Constraint 368 1141 4.8565 6.0706 12.1413 0.3322 Constraint 368 1117 5.0390 6.2988 12.5975 0.3322 Constraint 333 1141 4.1564 5.1954 10.3909 0.3322 Constraint 128 1382 5.9830 7.4788 14.9575 0.3322 Constraint 1284 1678 5.3507 6.6883 13.3766 0.3321 Constraint 748 1317 5.1807 6.4759 12.9519 0.3320 Constraint 623 1260 5.1957 6.4946 12.9892 0.3318 Constraint 597 848 5.1306 6.4133 12.8266 0.3317 Constraint 1455 1649 5.7281 7.1601 14.3202 0.3315 Constraint 1268 1455 4.6711 5.8389 11.6778 0.3314 Constraint 608 690 5.2775 6.5969 13.1938 0.3313 Constraint 154 1548 5.9925 7.4907 14.9814 0.3312 Constraint 222 944 5.7877 7.2347 14.4693 0.3311 Constraint 274 681 5.4159 6.7699 13.5397 0.3310 Constraint 980 1133 5.2266 6.5332 13.0665 0.3310 Constraint 1408 1678 5.5486 6.9358 13.8715 0.3309 Constraint 761 848 5.1083 6.3854 12.7708 0.3308 Constraint 1408 1620 4.6613 5.8266 11.6532 0.3307 Constraint 1399 1503 5.8685 7.3357 14.6714 0.3299 Constraint 748 1382 5.1704 6.4630 12.9260 0.3298 Constraint 466 1046 5.1919 6.4898 12.9797 0.3297 Constraint 274 706 4.0248 5.0309 10.0619 0.3297 Constraint 299 968 4.8904 6.1130 12.2261 0.3291 Constraint 443 1239 5.6900 7.1125 14.2250 0.3291 Constraint 363 1167 5.0542 6.3178 12.6356 0.3287 Constraint 421 493 5.6520 7.0650 14.1300 0.3284 Constraint 154 1438 5.6826 7.1033 14.2066 0.3283 Constraint 59 145 5.4700 6.8375 13.6750 0.3282 Constraint 557 997 5.2474 6.5592 13.1185 0.3282 Constraint 121 1077 4.8381 6.0477 12.0953 0.3282 Constraint 1246 1649 4.4133 5.5166 11.0332 0.3281 Constraint 921 1416 3.9546 4.9433 9.8866 0.3280 Constraint 1351 1447 5.3506 6.6882 13.3764 0.3278 Constraint 955 1268 5.2692 6.5864 13.1729 0.3277 Constraint 1447 1649 5.3236 6.6544 13.3089 0.3276 Constraint 180 1471 4.3115 5.3893 10.7787 0.3276 Constraint 829 1239 5.2102 6.5127 13.0255 0.3275 Constraint 955 1084 4.9175 6.1469 12.2938 0.3275 Constraint 859 1351 5.3919 6.7399 13.4798 0.3274 Constraint 980 1046 5.0440 6.3049 12.6099 0.3273 Constraint 1059 1276 4.6820 5.8525 11.7049 0.3273 Constraint 355 564 5.6719 7.0899 14.1798 0.3272 Constraint 968 1447 5.5494 6.9368 13.8735 0.3270 Constraint 1596 1703 5.3282 6.6602 13.3204 0.3266 Constraint 457 808 4.7748 5.9685 11.9371 0.3266 Constraint 1239 1556 4.5405 5.6757 11.3513 0.3263 Constraint 222 836 5.5547 6.9434 13.8867 0.3259 Constraint 299 1141 6.2465 7.8081 15.6162 0.3256 Constraint 1503 1662 5.8393 7.2991 14.5982 0.3256 Constraint 128 579 4.2464 5.3080 10.6160 0.3255 Constraint 530 836 5.8310 7.2887 14.5775 0.3254 Constraint 355 597 6.1353 7.6691 15.3383 0.3253 Constraint 421 557 5.6341 7.0427 14.0854 0.3250 Constraint 868 1587 6.1706 7.7132 15.4264 0.3250 Constraint 876 944 4.6013 5.7517 11.5033 0.3247 Constraint 589 913 5.0219 6.2773 12.5547 0.3247 Constraint 1276 1447 5.2164 6.5205 13.0411 0.3247 Constraint 1596 1756 5.5095 6.8868 13.7736 0.3244 Constraint 196 333 4.3564 5.4455 10.8910 0.3244 Constraint 665 913 6.0090 7.5112 15.0224 0.3243 Constraint 1035 1556 5.5424 6.9280 13.8560 0.3242 Constraint 836 937 5.6956 7.1195 14.2390 0.3242 Constraint 392 564 4.8669 6.0836 12.1673 0.3241 Constraint 429 639 3.8146 4.7682 9.5364 0.3240 Constraint 355 557 5.5942 6.9927 13.9855 0.3239 Constraint 808 1054 4.0780 5.0975 10.1950 0.3238 Constraint 196 564 5.2001 6.5002 13.0003 0.3235 Constraint 1603 1703 4.5787 5.7234 11.4467 0.3230 Constraint 1046 1479 4.4699 5.5874 11.1748 0.3229 Constraint 1466 1533 5.4440 6.8050 13.6099 0.3228 Constraint 616 1068 3.3659 4.2074 8.4148 0.3227 Constraint 443 818 5.1302 6.4127 12.8254 0.3226 Constraint 241 884 5.6715 7.0894 14.1788 0.3221 Constraint 980 1246 4.0510 5.0638 10.1276 0.3219 Constraint 892 1374 4.9758 6.2198 12.4395 0.3219 Constraint 493 1030 5.2553 6.5691 13.1382 0.3219 Constraint 263 713 4.6122 5.7653 11.5306 0.3219 Constraint 241 1239 3.2332 4.0415 8.0830 0.3219 Constraint 172 1293 6.0265 7.5331 15.0662 0.3219 Constraint 164 1317 3.3857 4.2321 8.4642 0.3219 Constraint 154 384 4.2379 5.2974 10.5947 0.3217 Constraint 443 829 6.2775 7.8469 15.6938 0.3216 Constraint 164 597 4.4686 5.5857 11.1714 0.3215 Constraint 384 690 3.9236 4.9045 9.8090 0.3214 Constraint 1014 1317 4.1823 5.2278 10.4556 0.3211 Constraint 1008 1447 5.2392 6.5491 13.0981 0.3211 Constraint 731 800 4.3306 5.4132 10.8265 0.3211 Constraint 1301 1374 3.7164 4.6455 9.2909 0.3209 Constraint 164 564 5.0924 6.3655 12.7309 0.3209 Constraint 1276 1366 5.6997 7.1247 14.2493 0.3206 Constraint 180 608 4.7241 5.9051 11.8103 0.3206 Constraint 1014 1133 5.3998 6.7498 13.4996 0.3197 Constraint 1567 1720 5.1724 6.4655 12.9310 0.3196 Constraint 818 1008 4.6846 5.8558 11.7116 0.3196 Constraint 944 1239 3.9659 4.9573 9.9146 0.3195 Constraint 1533 1756 3.9680 4.9600 9.9200 0.3192 Constraint 403 530 5.5170 6.8963 13.7926 0.3192 Constraint 1649 1756 5.0272 6.2841 12.5681 0.3192 Constraint 1351 1764 3.4485 4.3106 8.6212 0.3191 Constraint 325 564 5.3866 6.7333 13.4666 0.3191 Constraint 1391 1471 4.8544 6.0680 12.1359 0.3180 Constraint 963 1351 5.9564 7.4455 14.8909 0.3180 Constraint 1059 1158 5.3318 6.6647 13.3294 0.3176 Constraint 164 1193 4.9872 6.2341 12.4681 0.3173 Constraint 1438 1587 4.9455 6.1819 12.3637 0.3173 Constraint 778 1068 5.4724 6.8405 13.6809 0.3172 Constraint 1239 1533 5.7291 7.1613 14.3227 0.3172 Constraint 1427 1603 4.8368 6.0461 12.0921 0.3171 Constraint 690 913 5.4050 6.7562 13.5124 0.3170 Constraint 510 665 5.2908 6.6135 13.2270 0.3168 Constraint 355 608 4.1689 5.2111 10.4222 0.3165 Constraint 808 1084 4.1784 5.2230 10.4459 0.3165 Constraint 521 997 4.5514 5.6892 11.3785 0.3153 Constraint 222 1284 3.8254 4.7817 9.5635 0.3153 Constraint 222 1239 3.6014 4.5017 9.0034 0.3153 Constraint 690 1008 5.4803 6.8504 13.7008 0.3151 Constraint 1239 1649 5.5756 6.9695 13.9389 0.3150 Constraint 944 1284 5.3069 6.6336 13.2672 0.3146 Constraint 681 818 5.5977 6.9972 13.9943 0.3143 Constraint 493 829 5.1350 6.4188 12.8376 0.3141 Constraint 1301 1438 4.8453 6.0567 12.1134 0.3137 Constraint 1022 1293 3.8797 4.8497 9.6993 0.3134 Constraint 1213 1416 5.2098 6.5123 13.0245 0.3133 Constraint 665 783 4.7155 5.8944 11.7887 0.3132 Constraint 128 263 4.7854 5.9818 11.9635 0.3132 Constraint 1228 1703 5.3853 6.7317 13.4633 0.3131 Constraint 608 739 5.0821 6.3526 12.7052 0.3128 Constraint 639 1014 6.1506 7.6882 15.3764 0.3124 Constraint 1293 1620 5.0141 6.2676 12.5352 0.3124 Constraint 564 937 4.1701 5.2127 10.4253 0.3117 Constraint 1408 1649 4.9311 6.1639 12.3278 0.3116 Constraint 136 263 5.0160 6.2700 12.5399 0.3115 Constraint 955 1228 5.6042 7.0052 14.0104 0.3113 Constraint 375 630 4.8265 6.0331 12.0662 0.3112 Constraint 227 466 4.7381 5.9226 11.8452 0.3111 Constraint 216 1471 5.7044 7.1305 14.2610 0.3110 Constraint 868 1030 5.2206 6.5258 13.0515 0.3109 Constraint 1382 1519 6.2706 7.8382 15.6764 0.3108 Constraint 1587 1720 5.6367 7.0459 14.0918 0.3102 Constraint 597 876 4.4400 5.5500 11.1001 0.3101 Constraint 623 876 4.5834 5.7293 11.4585 0.3099 Constraint 429 937 5.3221 6.6527 13.3053 0.3098 Constraint 778 997 5.5082 6.8853 13.7706 0.3098 Constraint 1008 1567 5.1553 6.4441 12.8882 0.3092 Constraint 216 1260 5.5464 6.9330 13.8660 0.3091 Constraint 189 1284 5.6063 7.0079 14.0158 0.3091 Constraint 1276 1391 5.4928 6.8660 13.7320 0.3090 Constraint 1008 1343 4.7691 5.9614 11.9227 0.3089 Constraint 521 761 5.2262 6.5328 13.0656 0.3088 Constraint 783 1374 4.0819 5.1024 10.2048 0.3087 Constraint 448 818 5.5819 6.9773 13.9547 0.3082 Constraint 189 1317 6.1772 7.7215 15.4431 0.3082 Constraint 549 639 5.4758 6.8447 13.6895 0.3081 Constraint 443 1438 6.0694 7.5868 15.1736 0.3081 Constraint 443 1408 5.2011 6.5013 13.0026 0.3081 Constraint 808 1416 4.4185 5.5231 11.0461 0.3078 Constraint 769 1014 5.1692 6.4615 12.9230 0.3076 Constraint 1268 1438 5.0588 6.3235 12.6469 0.3076 Constraint 196 325 5.0319 6.2898 12.5796 0.3075 Constraint 256 510 5.1155 6.3943 12.7887 0.3075 Constraint 466 1204 5.1034 6.3792 12.7585 0.3074 Constraint 1117 1678 4.5261 5.6577 11.3153 0.3073 Constraint 249 443 5.4718 6.8398 13.6795 0.3072 Constraint 493 808 4.9248 6.1560 12.3121 0.3071 Constraint 429 630 4.7853 5.9817 11.9633 0.3071 Constraint 392 639 4.0954 5.1192 10.2384 0.3071 Constraint 154 1046 4.5117 5.6396 11.2792 0.3071 Constraint 616 1100 4.3811 5.4764 10.9527 0.3070 Constraint 241 1309 6.0188 7.5235 15.0470 0.3070 Constraint 222 1343 5.3432 6.6790 13.3579 0.3070 Constraint 1494 1662 4.6645 5.8306 11.6611 0.3060 Constraint 1488 1662 4.9408 6.1760 12.3521 0.3060 Constraint 1117 1293 4.4032 5.5040 11.0079 0.3058 Constraint 829 997 5.2628 6.5785 13.1570 0.3054 Constraint 538 761 5.6357 7.0447 14.0893 0.3047 Constraint 783 1008 5.9343 7.4179 14.8359 0.3044 Constraint 783 921 4.7373 5.9216 11.8432 0.3042 Constraint 713 1239 4.6040 5.7550 11.5100 0.3041 Constraint 1239 1447 5.6403 7.0504 14.1009 0.3040 Constraint 756 988 4.2196 5.2745 10.5489 0.3039 Constraint 1334 1416 5.4595 6.8243 13.6487 0.3036 Constraint 1167 1351 4.4426 5.5533 11.1065 0.3035 Constraint 665 980 4.7972 5.9964 11.9929 0.3035 Constraint 1447 1764 4.4901 5.6126 11.2252 0.3035 Constraint 836 1301 5.8740 7.3425 14.6851 0.3034 Constraint 1167 1317 6.0296 7.5370 15.0739 0.3033 Constraint 222 1317 4.1215 5.1518 10.3036 0.3033 Constraint 538 913 4.8485 6.0606 12.1213 0.3029 Constraint 1575 1720 4.1663 5.2079 10.4158 0.3025 Constraint 392 818 5.4963 6.8703 13.7407 0.3025 Constraint 848 1466 5.6234 7.0293 14.0585 0.3023 Constraint 673 1158 4.7086 5.8857 11.7715 0.3021 Constraint 955 1427 5.6412 7.0515 14.1029 0.3017 Constraint 208 1030 5.3146 6.6432 13.2865 0.3016 Constraint 263 538 5.7411 7.1764 14.3528 0.3013 Constraint 1325 1416 4.6966 5.8708 11.7415 0.3012 Constraint 808 1178 4.8356 6.0444 12.0889 0.3011 Constraint 1022 1193 4.8174 6.0218 12.0436 0.3011 Constraint 443 1077 5.6777 7.0971 14.1943 0.3009 Constraint 412 1068 5.3653 6.7066 13.4133 0.3009 Constraint 164 1334 6.1041 7.6301 15.2603 0.3009 Constraint 82 572 4.9039 6.1298 12.2597 0.3008 Constraint 808 1077 4.4196 5.5245 11.0489 0.3008 Constraint 1213 1343 5.2607 6.5759 13.1517 0.3005 Constraint 325 608 3.9117 4.8896 9.7791 0.3004 Constraint 756 1068 3.8859 4.8573 9.7147 0.3002 Constraint 557 1022 6.0240 7.5299 15.0599 0.3002 Constraint 557 968 4.6692 5.8365 11.6730 0.3002 Constraint 836 1438 5.7988 7.2484 14.4969 0.3002 Constraint 1149 1556 6.1342 7.6678 15.3355 0.3001 Constraint 1251 1408 5.7125 7.1406 14.2813 0.2998 Constraint 189 306 4.5943 5.7429 11.4858 0.2995 Constraint 1556 1649 4.4729 5.5912 11.1823 0.2994 Constraint 665 884 5.4253 6.7816 13.5633 0.2994 Constraint 233 538 5.3556 6.6945 13.3889 0.2991 Constraint 1149 1548 3.8747 4.8433 9.6866 0.2987 Constraint 1109 1325 5.1592 6.4490 12.8979 0.2986 Constraint 510 698 4.7447 5.9309 11.8619 0.2985 Constraint 1239 1438 5.7706 7.2132 14.4265 0.2983 Constraint 429 530 4.7860 5.9824 11.9649 0.2983 Constraint 955 1382 4.8098 6.0123 12.0246 0.2980 Constraint 208 285 5.6467 7.0584 14.1168 0.2976 Constraint 937 1301 5.9955 7.4943 14.9887 0.2976 Constraint 988 1077 5.1011 6.3763 12.7526 0.2975 Constraint 884 1276 4.8651 6.0814 12.1628 0.2972 Constraint 1391 1756 5.6197 7.0246 14.0492 0.2971 Constraint 306 1239 5.0402 6.3002 12.6005 0.2968 Constraint 249 1293 4.0856 5.1070 10.2140 0.2968 Constraint 208 1325 6.1259 7.6573 15.3146 0.2968 Constraint 196 1358 6.2912 7.8640 15.7280 0.2968 Constraint 189 1325 6.0239 7.5299 15.0598 0.2968 Constraint 189 980 5.3429 6.6786 13.3572 0.2968 Constraint 164 1382 5.5201 6.9001 13.8002 0.2968 Constraint 164 1358 4.8011 6.0013 12.0026 0.2968 Constraint 136 1391 6.3498 7.9373 15.8746 0.2968 Constraint 848 1167 5.4953 6.8691 13.7383 0.2968 Constraint 1251 1351 4.4708 5.5885 11.1769 0.2965 Constraint 868 1548 4.1127 5.1409 10.2819 0.2965 Constraint 639 1141 5.1060 6.3825 12.7650 0.2965 Constraint 1092 1178 5.8493 7.3117 14.6234 0.2965 Constraint 77 892 5.0604 6.3255 12.6510 0.2964 Constraint 421 538 5.9996 7.4995 14.9989 0.2964 Constraint 196 285 4.5651 5.7064 11.4128 0.2959 Constraint 800 1374 5.7695 7.2119 14.4237 0.2955 Constraint 589 968 5.5001 6.8751 13.7502 0.2955 Constraint 355 479 5.4529 6.8161 13.6322 0.2953 Constraint 549 623 5.3026 6.6282 13.2564 0.2950 Constraint 392 1008 4.8564 6.0705 12.1411 0.2950 Constraint 1438 1620 4.5815 5.7269 11.4537 0.2949 Constraint 1068 1374 4.2585 5.3231 10.6462 0.2944 Constraint 347 421 5.4570 6.8212 13.6424 0.2943 Constraint 1358 1596 5.1617 6.4521 12.9043 0.2942 Constraint 1030 1471 5.1997 6.4997 12.9993 0.2941 Constraint 256 501 3.6915 4.6144 9.2288 0.2939 Constraint 808 1575 5.8066 7.2583 14.5166 0.2938 Constraint 800 1575 4.4189 5.5236 11.0472 0.2938 Constraint 808 913 5.0650 6.3312 12.6624 0.2935 Constraint 1228 1479 5.7166 7.1458 14.2915 0.2932 Constraint 564 769 4.7027 5.8784 11.7568 0.2932 Constraint 800 1035 5.5676 6.9595 13.9190 0.2930 Constraint 1466 1567 4.6179 5.7724 11.5447 0.2928 Constraint 1059 1731 4.3323 5.4154 10.8308 0.2927 Constraint 241 673 4.9310 6.1638 12.3275 0.2926 Constraint 616 778 4.9748 6.2185 12.4371 0.2926 Constraint 623 778 4.7534 5.9418 11.8836 0.2921 Constraint 121 1479 5.1694 6.4618 12.9236 0.2918 Constraint 884 963 4.8462 6.0577 12.1154 0.2916 Constraint 392 493 4.7031 5.8789 11.7577 0.2916 Constraint 1167 1533 4.2804 5.3505 10.7011 0.2915 Constraint 227 530 4.0139 5.0174 10.0348 0.2910 Constraint 47 154 5.3760 6.7200 13.4401 0.2904 Constraint 623 1084 4.7191 5.8988 11.7977 0.2900 Constraint 421 521 5.2187 6.5234 13.0469 0.2900 Constraint 538 968 5.2408 6.5511 13.1021 0.2897 Constraint 241 657 6.0956 7.6195 15.2390 0.2895 Constraint 783 1260 5.3567 6.6959 13.3918 0.2890 Constraint 792 868 4.1284 5.1605 10.3210 0.2887 Constraint 1251 1325 4.5016 5.6270 11.2541 0.2887 Constraint 104 222 5.1807 6.4758 12.9517 0.2886 Constraint 227 538 4.2903 5.3629 10.7257 0.2885 Constraint 756 1374 5.3908 6.7385 13.4771 0.2884 Constraint 829 1167 4.9017 6.1271 12.2542 0.2882 Constraint 154 1077 5.1541 6.4426 12.8853 0.2882 Constraint 189 968 4.6640 5.8301 11.6601 0.2879 Constraint 564 1084 3.9286 4.9108 9.8215 0.2878 Constraint 403 493 5.4020 6.7526 13.5051 0.2877 Constraint 412 1447 4.8082 6.0103 12.0206 0.2875 Constraint 392 1167 6.2591 7.8239 15.6478 0.2875 Constraint 392 1133 6.2891 7.8614 15.7228 0.2875 Constraint 384 1035 4.6886 5.8608 11.7216 0.2875 Constraint 384 1008 4.2875 5.3594 10.7188 0.2875 Constraint 698 1092 5.8481 7.3102 14.6203 0.2874 Constraint 392 748 4.7256 5.9070 11.8140 0.2873 Constraint 384 630 4.2715 5.3394 10.6788 0.2873 Constraint 650 761 5.1019 6.3773 12.7547 0.2870 Constraint 392 530 3.5119 4.3899 8.7798 0.2868 Constraint 1358 1548 5.8062 7.2577 14.5154 0.2867 Constraint 673 988 4.8235 6.0293 12.0586 0.2867 Constraint 392 510 5.0274 6.2843 12.5685 0.2866 Constraint 955 1193 5.2910 6.6138 13.2276 0.2865 Constraint 1511 1662 4.2318 5.2898 10.5796 0.2865 Constraint 988 1317 5.0748 6.3435 12.6869 0.2865 Constraint 623 1284 5.1554 6.4442 12.8885 0.2865 Constraint 608 748 5.3715 6.7143 13.4287 0.2865 Constraint 589 1100 4.1579 5.1973 10.3947 0.2865 Constraint 493 1068 5.4237 6.7796 13.5593 0.2865 Constraint 443 1125 5.4310 6.7888 13.5775 0.2865 Constraint 392 1204 5.2173 6.5216 13.0431 0.2865 Constraint 392 1158 5.6829 7.1036 14.2072 0.2865 Constraint 333 1204 4.3322 5.4152 10.8304 0.2865 Constraint 333 1167 4.9779 6.2224 12.4449 0.2865 Constraint 325 616 5.6872 7.1090 14.2180 0.2865 Constraint 274 1260 4.2354 5.2943 10.5886 0.2865 Constraint 274 1251 4.2350 5.2938 10.5876 0.2865 Constraint 274 1193 4.4406 5.5507 11.1015 0.2865 Constraint 263 1251 4.7008 5.8760 11.7520 0.2865 Constraint 263 1228 5.6217 7.0272 14.0544 0.2865 Constraint 256 1077 4.8911 6.1139 12.2278 0.2865 Constraint 249 1284 4.0553 5.0691 10.1382 0.2865 Constraint 241 1284 3.0984 3.8730 7.7461 0.2865 Constraint 241 1276 4.6420 5.8025 11.6050 0.2865 Constraint 241 1251 3.8881 4.8601 9.7202 0.2865 Constraint 241 1228 5.0739 6.3424 12.6848 0.2865 Constraint 241 997 5.4095 6.7618 13.5237 0.2865 Constraint 233 1158 5.1503 6.4379 12.8759 0.2865 Constraint 222 1309 3.1767 3.9708 7.9417 0.2865 Constraint 222 1268 4.0267 5.0333 10.0667 0.2865 Constraint 216 1309 5.4723 6.8404 13.6809 0.2865 Constraint 208 1178 5.7928 7.2410 14.4820 0.2865 Constraint 172 1343 5.3601 6.7001 13.4002 0.2865 Constraint 164 1284 6.3144 7.8930 15.7860 0.2865 Constraint 91 479 6.2970 7.8712 15.7425 0.2865 Constraint 216 913 5.5067 6.8834 13.7668 0.2863 Constraint 1059 1260 5.4260 6.7825 13.5650 0.2863 Constraint 196 800 5.7290 7.1612 14.3224 0.2861 Constraint 557 930 4.9669 6.2086 12.4173 0.2861 Constraint 1100 1447 4.6266 5.7832 11.5665 0.2860 Constraint 1133 1634 5.7556 7.1945 14.3890 0.2856 Constraint 1213 1382 5.6677 7.0846 14.1691 0.2856 Constraint 1284 1488 5.8270 7.2838 14.5676 0.2855 Constraint 731 980 4.8223 6.0278 12.0557 0.2855 Constraint 1488 1611 5.0731 6.3413 12.6826 0.2854 Constraint 1488 1603 5.9593 7.4491 14.8982 0.2854 Constraint 1141 1649 5.3306 6.6632 13.3264 0.2854 Constraint 1030 1204 4.4706 5.5883 11.1766 0.2854 Constraint 1022 1533 5.9038 7.3797 14.7595 0.2854 Constraint 1022 1204 5.0480 6.3100 12.6199 0.2854 Constraint 457 836 6.3791 7.9738 15.9476 0.2854 Constraint 859 1317 5.1437 6.4297 12.8593 0.2854 Constraint 937 1494 5.7484 7.1854 14.3709 0.2852 Constraint 47 623 5.1509 6.4387 12.8774 0.2850 Constraint 47 589 5.9748 7.4686 14.9371 0.2850 Constraint 608 1268 4.3530 5.4412 10.8824 0.2848 Constraint 59 968 4.9623 6.2028 12.4056 0.2847 Constraint 1008 1358 4.5458 5.6822 11.3644 0.2845 Constraint 538 1141 4.3591 5.4489 10.8978 0.2840 Constraint 829 1268 5.3914 6.7392 13.4785 0.2840 Constraint 1251 1334 4.0835 5.1043 10.2086 0.2835 Constraint 808 988 4.5876 5.7345 11.4691 0.2835 Constraint 829 1014 5.0119 6.2649 12.5297 0.2834 Constraint 630 913 4.9502 6.1878 12.3756 0.2832 Constraint 1334 1408 4.9991 6.2489 12.4977 0.2830 Constraint 1125 1251 5.2040 6.5050 13.0100 0.2824 Constraint 1077 1657 5.8109 7.2636 14.5273 0.2823 Constraint 1100 1167 5.5690 6.9613 13.9225 0.2821 Constraint 616 876 5.9726 7.4658 14.9316 0.2821 Constraint 1408 1703 4.2244 5.2805 10.5610 0.2821 Constraint 748 1408 5.3680 6.7100 13.4200 0.2820 Constraint 1133 1447 5.0861 6.3576 12.7153 0.2818 Constraint 1260 1511 3.8457 4.8071 9.6142 0.2817 Constraint 443 1374 5.7819 7.2274 14.4547 0.2815 Constraint 1351 1703 4.9731 6.2164 12.4328 0.2810 Constraint 222 921 5.7130 7.1413 14.2826 0.2809 Constraint 623 1054 4.9229 6.1536 12.3072 0.2807 Constraint 59 154 4.7385 5.9231 11.8461 0.2807 Constraint 1317 1620 5.0685 6.3357 12.6713 0.2806 Constraint 756 1343 4.2928 5.3660 10.7321 0.2804 Constraint 172 579 4.4299 5.5374 11.0748 0.2804 Constraint 1325 1720 5.2288 6.5360 13.0720 0.2804 Constraint 263 706 5.6604 7.0754 14.1509 0.2802 Constraint 1447 1678 5.3491 6.6864 13.3728 0.2802 Constraint 1100 1178 4.8652 6.0815 12.1631 0.2800 Constraint 623 1100 4.8786 6.0983 12.1966 0.2799 Constraint 1455 1670 5.8722 7.3403 14.6805 0.2798 Constraint 944 1046 5.0228 6.2785 12.5570 0.2798 Constraint 1293 1455 4.9138 6.1423 12.2846 0.2796 Constraint 249 968 4.4640 5.5800 11.1599 0.2795 Constraint 564 800 5.1250 6.4063 12.8125 0.2795 Constraint 263 997 5.2961 6.6201 13.2401 0.2794 Constraint 216 1239 5.6078 7.0097 14.0194 0.2793 Constraint 263 690 4.4341 5.5427 11.0853 0.2792 Constraint 899 1548 4.5173 5.6466 11.2932 0.2786 Constraint 1213 1358 5.8942 7.3678 14.7356 0.2775 Constraint 836 1503 5.1433 6.4292 12.8584 0.2775 Constraint 538 1008 5.2503 6.5628 13.1257 0.2773 Constraint 1526 1764 4.6894 5.8618 11.7236 0.2773 Constraint 1587 1670 5.6597 7.0746 14.1491 0.2772 Constraint 172 241 4.3213 5.4017 10.8033 0.2772 Constraint 836 955 4.3969 5.4961 10.9923 0.2772 Constraint 1251 1343 4.6960 5.8700 11.7401 0.2772 Constraint 18 91 5.1062 6.3827 12.7654 0.2772 Constraint 783 955 5.0803 6.3504 12.7007 0.2770 Constraint 968 1494 4.9644 6.2055 12.4110 0.2769 Constraint 968 1077 5.1908 6.4885 12.9771 0.2769 Constraint 1239 1634 5.2814 6.6017 13.2034 0.2767 Constraint 892 1008 4.6227 5.7784 11.5568 0.2766 Constraint 263 564 5.1104 6.3880 12.7760 0.2764 Constraint 274 722 5.7523 7.1904 14.3807 0.2763 Constraint 1109 1343 5.2994 6.6242 13.2485 0.2762 Constraint 589 756 4.2116 5.2645 10.5291 0.2762 Constraint 868 1575 4.7824 5.9779 11.9559 0.2759 Constraint 189 808 4.7979 5.9974 11.9947 0.2755 Constraint 1301 1657 4.5061 5.6327 11.2653 0.2753 Constraint 363 538 5.5533 6.9416 13.8832 0.2749 Constraint 818 1408 4.8078 6.0097 12.0194 0.2749 Constraint 836 1447 4.9938 6.2423 12.4845 0.2746 Constraint 59 997 4.5616 5.7020 11.4041 0.2745 Constraint 630 769 5.2314 6.5393 13.0786 0.2745 Constraint 384 968 5.0970 6.3712 12.7424 0.2744 Constraint 756 859 5.4160 6.7700 13.5401 0.2743 Constraint 829 1084 5.0092 6.2615 12.5230 0.2742 Constraint 859 937 4.8845 6.1056 12.2111 0.2742 Constraint 1408 1764 4.8533 6.0666 12.1332 0.2740 Constraint 808 892 3.9764 4.9705 9.9411 0.2738 Constraint 1293 1479 6.1782 7.7228 15.4456 0.2738 Constraint 778 1141 4.9034 6.1292 12.2584 0.2737 Constraint 1427 1596 5.6549 7.0686 14.1373 0.2736 Constraint 314 1100 6.1644 7.7054 15.4109 0.2735 Constraint 1228 1447 5.5784 6.9730 13.9460 0.2735 Constraint 1284 1399 4.9072 6.1340 12.2680 0.2735 Constraint 1317 1479 5.5855 6.9819 13.9639 0.2733 Constraint 241 1030 5.2580 6.5725 13.1450 0.2733 Constraint 285 375 5.2798 6.5997 13.1994 0.2733 Constraint 1284 1447 5.6833 7.1041 14.2082 0.2733 Constraint 1109 1251 5.1622 6.4527 12.9054 0.2732 Constraint 944 1399 5.2418 6.5522 13.1044 0.2732 Constraint 690 1014 4.7979 5.9973 11.9946 0.2731 Constraint 1077 1587 6.1517 7.6896 15.3792 0.2731 Constraint 980 1141 5.2810 6.6012 13.2024 0.2730 Constraint 136 538 5.8105 7.2631 14.5262 0.2728 Constraint 222 698 5.0375 6.2969 12.5937 0.2728 Constraint 722 1092 5.0764 6.3455 12.6910 0.2728 Constraint 180 363 5.0651 6.3313 12.6627 0.2726 Constraint 706 1014 5.5473 6.9341 13.8683 0.2726 Constraint 66 189 4.2167 5.2709 10.5418 0.2724 Constraint 1035 1133 5.1391 6.4239 12.8477 0.2724 Constraint 836 1167 5.0278 6.2847 12.5694 0.2722 Constraint 988 1109 5.2078 6.5098 13.0195 0.2722 Constraint 196 363 4.9403 6.1754 12.3508 0.2721 Constraint 572 868 5.1935 6.4919 12.9838 0.2720 Constraint 299 665 4.7427 5.9284 11.8568 0.2720 Constraint 1046 1438 4.9091 6.1364 12.2727 0.2719 Constraint 639 778 5.0001 6.2502 12.5003 0.2713 Constraint 829 1035 5.3296 6.6620 13.3239 0.2713 Constraint 1022 1084 5.6263 7.0328 14.0656 0.2712 Constraint 1351 1438 5.9649 7.4562 14.9124 0.2709 Constraint 944 1141 5.0168 6.2709 12.5419 0.2708 Constraint 1466 1587 5.2111 6.5138 13.0276 0.2708 Constraint 1109 1471 5.2635 6.5794 13.1588 0.2707 Constraint 145 616 5.8558 7.3198 14.6395 0.2707 Constraint 778 1408 4.8954 6.1192 12.2385 0.2706 Constraint 384 836 5.9530 7.4412 14.8825 0.2705 Constraint 564 968 4.7233 5.9042 11.8083 0.2701 Constraint 1649 1720 4.5029 5.6287 11.2574 0.2701 Constraint 731 944 5.0051 6.2564 12.5128 0.2700 Constraint 216 1466 5.0870 6.3587 12.7174 0.2699 Constraint 913 1301 3.7832 4.7290 9.4581 0.2698 Constraint 722 944 5.0211 6.2764 12.5527 0.2697 Constraint 1035 1416 4.8217 6.0271 12.0542 0.2696 Constraint 836 1567 5.0671 6.3338 12.6677 0.2696 Constraint 1109 1351 5.4746 6.8433 13.6866 0.2695 Constraint 363 690 5.9645 7.4556 14.9112 0.2694 Constraint 1117 1284 4.9434 6.1793 12.3585 0.2690 Constraint 944 1109 5.3178 6.6472 13.2944 0.2689 Constraint 1077 1620 4.8706 6.0882 12.1765 0.2689 Constraint 392 698 5.2122 6.5153 13.0306 0.2688 Constraint 836 1293 4.2186 5.2732 10.5464 0.2685 Constraint 136 355 4.1187 5.1484 10.2967 0.2684 Constraint 448 997 5.8400 7.3000 14.6000 0.2682 Constraint 1030 1756 5.1830 6.4788 12.9576 0.2682 Constraint 778 1343 6.1371 7.6714 15.3428 0.2681 Constraint 756 818 5.0539 6.3174 12.6347 0.2678 Constraint 848 930 5.1791 6.4739 12.9477 0.2672 Constraint 325 859 5.3770 6.7212 13.4424 0.2672 Constraint 980 1657 4.4853 5.6066 11.2132 0.2667 Constraint 597 1293 5.3038 6.6297 13.2594 0.2666 Constraint 189 657 4.5484 5.6854 11.3709 0.2665 Constraint 665 769 4.7154 5.8942 11.7885 0.2665 Constraint 1447 1657 5.0119 6.2649 12.5298 0.2665 Constraint 1438 1678 4.3047 5.3809 10.7618 0.2665 Constraint 112 1077 5.9823 7.4779 14.9558 0.2665 Constraint 616 722 4.3111 5.3889 10.7778 0.2663 Constraint 1092 1479 2.7411 3.4264 6.8527 0.2661 Constraint 673 778 4.6524 5.8155 11.6310 0.2661 Constraint 698 1317 6.1296 7.6621 15.3241 0.2661 Constraint 164 412 5.0835 6.3543 12.7087 0.2660 Constraint 589 761 5.7140 7.1425 14.2849 0.2659 Constraint 154 944 5.5026 6.8782 13.7564 0.2655 Constraint 1228 1325 5.0072 6.2590 12.5180 0.2655 Constraint 299 690 5.0437 6.3046 12.6092 0.2654 Constraint 616 1092 3.8305 4.7882 9.5763 0.2653 Constraint 501 859 5.9637 7.4546 14.9092 0.2652 Constraint 808 1109 5.4719 6.8399 13.6798 0.2652 Constraint 1301 1382 4.3408 5.4260 10.8520 0.2651 Constraint 713 1374 5.9686 7.4608 14.9216 0.2651 Constraint 713 829 4.9621 6.2026 12.4053 0.2650 Constraint 1141 1548 5.4251 6.7813 13.5627 0.2649 Constraint 1548 1634 4.4496 5.5620 11.1239 0.2648 Constraint 698 848 5.0703 6.3379 12.6758 0.2648 Constraint 1567 1714 4.4231 5.5289 11.0578 0.2644 Constraint 530 761 4.3886 5.4857 10.9714 0.2642 Constraint 778 1455 4.9044 6.1305 12.2610 0.2641 Constraint 216 1399 5.6955 7.1194 14.2388 0.2639 Constraint 216 1374 4.9301 6.1626 12.3252 0.2639 Constraint 1251 1488 5.8656 7.3321 14.6641 0.2638 Constraint 1317 1714 5.1345 6.4181 12.8362 0.2635 Constraint 1158 1567 4.8475 6.0594 12.1188 0.2635 Constraint 913 1030 4.7379 5.9224 11.8448 0.2634 Constraint 818 1178 5.5459 6.9323 13.8647 0.2633 Constraint 164 263 5.2043 6.5053 13.0106 0.2632 Constraint 227 968 6.0133 7.5167 15.0333 0.2631 Constraint 1519 1603 4.8630 6.0787 12.1574 0.2628 Constraint 657 868 5.0595 6.3244 12.6487 0.2627 Constraint 800 937 4.8205 6.0257 12.0513 0.2627 Constraint 1246 1620 6.0483 7.5603 15.1206 0.2626 Constraint 39 216 4.9778 6.2223 12.4446 0.2625 Constraint 1427 1519 4.8773 6.0967 12.1933 0.2624 Constraint 1399 1488 5.4853 6.8567 13.7133 0.2624 Constraint 639 884 4.3041 5.3801 10.7603 0.2623 Constraint 739 818 5.3040 6.6301 13.2601 0.2622 Constraint 639 1035 5.6408 7.0511 14.1021 0.2622 Constraint 164 623 4.7323 5.9154 11.8307 0.2621 Constraint 1220 1703 5.2522 6.5653 13.1306 0.2621 Constraint 196 521 5.5615 6.9519 13.9038 0.2621 Constraint 1526 1731 5.8722 7.3402 14.6804 0.2619 Constraint 412 608 5.9261 7.4076 14.8152 0.2616 Constraint 263 722 5.1864 6.4830 12.9659 0.2616 Constraint 1059 1141 5.0247 6.2809 12.5618 0.2616 Constraint 285 1178 5.9459 7.4324 14.8647 0.2614 Constraint 274 859 5.4127 6.7659 13.5317 0.2614 Constraint 47 997 6.0897 7.6121 15.2242 0.2614 Constraint 510 913 4.4541 5.5676 11.1351 0.2614 Constraint 639 1158 4.9833 6.2291 12.4582 0.2610 Constraint 859 1503 5.6085 7.0107 14.0214 0.2609 Constraint 196 997 5.4809 6.8512 13.7023 0.2608 Constraint 572 756 5.4360 6.7950 13.5900 0.2607 Constraint 1511 1596 4.1113 5.1391 10.2783 0.2607 Constraint 572 913 5.1450 6.4312 12.8624 0.2605 Constraint 227 493 5.7229 7.1536 14.3073 0.2604 Constraint 650 1022 5.2809 6.6012 13.2024 0.2604 Constraint 731 1325 6.0549 7.5687 15.1373 0.2603 Constraint 384 681 4.7314 5.9143 11.8286 0.2599 Constraint 164 306 5.4597 6.8246 13.6493 0.2599 Constraint 1239 1471 4.9110 6.1387 12.2774 0.2598 Constraint 384 792 5.1852 6.4815 12.9630 0.2597 Constraint 306 429 5.2632 6.5790 13.1581 0.2596 Constraint 608 769 4.1611 5.2014 10.4028 0.2595 Constraint 868 1008 4.4937 5.6171 11.2342 0.2594 Constraint 1100 1343 4.3270 5.4088 10.8175 0.2593 Constraint 589 876 4.1661 5.2076 10.4152 0.2589 Constraint 421 589 5.3457 6.6822 13.3643 0.2588 Constraint 375 778 5.3995 6.7494 13.4987 0.2586 Constraint 189 1526 4.1426 5.1783 10.3566 0.2584 Constraint 1014 1149 4.2457 5.3072 10.6143 0.2582 Constraint 564 1030 5.1011 6.3764 12.7528 0.2581 Constraint 557 1178 5.9514 7.4393 14.8786 0.2575 Constraint 1567 1739 5.3590 6.6987 13.3975 0.2574 Constraint 1466 1575 6.2597 7.8246 15.6493 0.2573 Constraint 164 299 4.6806 5.8507 11.7014 0.2573 Constraint 466 868 5.0874 6.3592 12.7184 0.2572 Constraint 1035 1548 5.9915 7.4893 14.9786 0.2570 Constraint 443 1204 5.0265 6.2831 12.5663 0.2568 Constraint 421 1228 5.8633 7.3291 14.6583 0.2568 Constraint 657 848 5.0880 6.3600 12.7201 0.2568 Constraint 1556 1739 4.0695 5.0869 10.1738 0.2567 Constraint 564 1158 4.0612 5.0765 10.1529 0.2564 Constraint 530 1068 5.1691 6.4614 12.9227 0.2564 Constraint 1035 1358 4.5671 5.7089 11.4177 0.2563 Constraint 739 1494 5.9545 7.4432 14.8864 0.2562 Constraint 1519 1596 5.5624 6.9530 13.9059 0.2561 Constraint 616 1059 5.8329 7.2912 14.5823 0.2561 Constraint 908 1519 6.0778 7.5973 15.1946 0.2559 Constraint 868 1519 5.7860 7.2325 14.4651 0.2557 Constraint 1117 1276 4.7161 5.8951 11.7901 0.2556 Constraint 955 1634 5.1507 6.4384 12.8768 0.2555 Constraint 930 1260 3.5815 4.4769 8.9537 0.2553 Constraint 1649 1772 4.0628 5.0785 10.1569 0.2552 Constraint 196 1239 5.7192 7.1490 14.2980 0.2552 Constraint 1438 1575 4.9195 6.1494 12.2987 0.2551 Constraint 690 1374 5.2123 6.5154 13.0307 0.2549 Constraint 233 1030 4.7372 5.9215 11.8430 0.2548 Constraint 227 564 5.4248 6.7810 13.5619 0.2548 Constraint 1158 1533 5.0806 6.3507 12.7015 0.2545 Constraint 1309 1416 5.6156 7.0195 14.0391 0.2545 Constraint 564 1059 4.9872 6.2340 12.4680 0.2543 Constraint 333 412 5.4975 6.8718 13.7437 0.2543 Constraint 1030 1109 5.1622 6.4527 12.9055 0.2543 Constraint 769 848 4.8160 6.0200 12.0400 0.2542 Constraint 868 968 5.2911 6.6139 13.2279 0.2542 Constraint 1391 1649 4.5582 5.6978 11.3955 0.2540 Constraint 968 1046 4.4771 5.5964 11.1928 0.2539 Constraint 363 501 4.4744 5.5929 11.1859 0.2539 Constraint 639 892 5.0051 6.2563 12.5127 0.2537 Constraint 145 448 5.7260 7.1574 14.3149 0.2536 Constraint 208 429 5.5791 6.9739 13.9478 0.2536 Constraint 698 829 5.5952 6.9940 13.9880 0.2536 Constraint 172 435 5.6450 7.0563 14.1126 0.2533 Constraint 1662 1731 5.9858 7.4823 14.9646 0.2533 Constraint 681 778 4.8827 6.1033 12.2067 0.2532 Constraint 249 859 4.8502 6.0628 12.1256 0.2532 Constraint 59 892 4.3958 5.4948 10.9895 0.2531 Constraint 538 937 5.3583 6.6978 13.3957 0.2531 Constraint 884 955 4.7825 5.9781 11.9562 0.2530 Constraint 836 1533 4.7667 5.9583 11.9167 0.2530 Constraint 493 859 3.8303 4.7878 9.5757 0.2527 Constraint 429 510 4.1615 5.2019 10.4038 0.2527 Constraint 104 1228 4.5166 5.6458 11.2916 0.2524 Constraint 443 549 4.6813 5.8516 11.7033 0.2524 Constraint 538 713 4.9234 6.1542 12.3084 0.2523 Constraint 11 128 4.9546 6.1933 12.3866 0.2522 Constraint 608 1293 3.6937 4.6171 9.2343 0.2522 Constraint 196 294 5.1343 6.4179 12.8358 0.2522 Constraint 249 538 5.0103 6.2629 12.5257 0.2521 Constraint 384 1447 4.9991 6.2489 12.4978 0.2520 Constraint 363 818 4.9846 6.2308 12.4616 0.2519 Constraint 769 1293 5.5019 6.8774 13.7548 0.2518 Constraint 412 722 5.3534 6.6917 13.3834 0.2517 Constraint 274 1141 4.4427 5.5534 11.1068 0.2517 Constraint 530 868 5.7919 7.2398 14.4797 0.2516 Constraint 208 487 5.6076 7.0095 14.0189 0.2515 Constraint 1204 1479 5.2543 6.5679 13.1357 0.2514 Constraint 657 913 4.0026 5.0033 10.0065 0.2510 Constraint 1391 1657 5.0699 6.3373 12.6747 0.2509 Constraint 368 913 4.5831 5.7289 11.4577 0.2508 Constraint 722 1014 5.0425 6.3031 12.6063 0.2507 Constraint 899 1167 5.0442 6.3052 12.6104 0.2505 Constraint 208 1008 4.8411 6.0514 12.1027 0.2504 Constraint 189 572 5.7473 7.1842 14.3683 0.2504 Constraint 731 955 4.6611 5.8263 11.6527 0.2504 Constraint 997 1494 5.0961 6.3701 12.7402 0.2502 Constraint 1603 1683 4.4633 5.5791 11.1583 0.2502 Constraint 333 1228 4.5492 5.6865 11.3730 0.2500 Constraint 196 538 5.3134 6.6417 13.2834 0.2499 Constraint 443 968 5.8317 7.2896 14.5792 0.2496 Constraint 868 937 5.0618 6.3273 12.6546 0.2495 Constraint 274 698 3.8922 4.8652 9.7305 0.2495 Constraint 769 1351 5.6020 7.0025 14.0051 0.2493 Constraint 1133 1317 5.7636 7.2045 14.4089 0.2493 Constraint 930 1293 5.1770 6.4712 12.9424 0.2492 Constraint 325 572 6.0575 7.5719 15.1438 0.2492 Constraint 1301 1427 4.5291 5.6613 11.3227 0.2490 Constraint 325 448 5.9528 7.4410 14.8820 0.2490 Constraint 249 479 5.4886 6.8608 13.7216 0.2489 Constraint 792 1008 5.5045 6.8807 13.7613 0.2489 Constraint 443 557 5.3366 6.6708 13.3415 0.2488 Constraint 363 908 5.1681 6.4601 12.9202 0.2486 Constraint 1317 1764 3.8997 4.8746 9.7491 0.2486 Constraint 859 1268 3.8181 4.7726 9.5452 0.2486 Constraint 263 435 6.1735 7.7169 15.4338 0.2483 Constraint 121 1471 5.2632 6.5790 13.1579 0.2483 Constraint 921 1427 6.0093 7.5117 15.0233 0.2482 Constraint 944 1251 4.3432 5.4289 10.8579 0.2481 Constraint 913 1334 5.0483 6.3103 12.6207 0.2481 Constraint 963 1284 6.2482 7.8103 15.6205 0.2479 Constraint 128 944 5.5120 6.8901 13.7801 0.2479 Constraint 1109 1620 4.9067 6.1334 12.2668 0.2477 Constraint 1447 1756 5.3431 6.6789 13.3577 0.2475 Constraint 368 493 4.3982 5.4978 10.9956 0.2475 Constraint 1438 1731 5.2184 6.5230 13.0461 0.2472 Constraint 792 1014 4.7558 5.9448 11.8896 0.2471 Constraint 908 1260 4.0965 5.1206 10.2412 0.2469 Constraint 808 1059 4.6797 5.8496 11.6992 0.2468 Constraint 1014 1678 4.3665 5.4581 10.9163 0.2467 Constraint 748 1293 5.2276 6.5345 13.0690 0.2465 Constraint 1438 1596 4.2725 5.3407 10.6814 0.2464 Constraint 748 913 5.4500 6.8125 13.6250 0.2463 Constraint 980 1213 5.2490 6.5612 13.1224 0.2461 Constraint 1167 1657 5.2259 6.5324 13.0648 0.2456 Constraint 800 955 5.3690 6.7112 13.4225 0.2456 Constraint 274 665 4.5981 5.7476 11.4952 0.2455 Constraint 1358 1703 5.5662 6.9577 13.9154 0.2453 Constraint 145 538 3.9049 4.8812 9.7623 0.2453 Constraint 706 800 5.2476 6.5594 13.1189 0.2453 Constraint 1059 1358 4.8128 6.0160 12.0319 0.2452 Constraint 778 913 4.9796 6.2246 12.4491 0.2452 Constraint 1526 1703 5.0003 6.2504 12.5008 0.2448 Constraint 572 1149 4.9529 6.1911 12.3822 0.2448 Constraint 1541 1748 4.3789 5.4736 10.9472 0.2446 Constraint 1293 1391 4.8488 6.0610 12.1220 0.2445 Constraint 572 748 5.5451 6.9313 13.8627 0.2443 Constraint 665 1239 6.0785 7.5981 15.1961 0.2443 Constraint 1541 1739 5.7010 7.1263 14.2526 0.2438 Constraint 722 1408 5.1181 6.3976 12.7952 0.2437 Constraint 1284 1366 5.0324 6.2905 12.5810 0.2436 Constraint 1427 1575 5.2774 6.5967 13.1934 0.2434 Constraint 222 955 4.8702 6.0878 12.1756 0.2433 Constraint 25 97 5.4142 6.7678 13.5355 0.2429 Constraint 249 756 4.6727 5.8408 11.6817 0.2429 Constraint 769 1317 6.0129 7.5161 15.0323 0.2426 Constraint 274 1293 4.9816 6.2270 12.4540 0.2426 Constraint 233 1268 4.4602 5.5753 11.1506 0.2425 Constraint 968 1133 5.1736 6.4670 12.9340 0.2423 Constraint 466 1213 5.5311 6.9139 13.8278 0.2422 Constraint 466 1193 5.1024 6.3780 12.7560 0.2422 Constraint 196 1343 3.8026 4.7533 9.5066 0.2422 Constraint 196 1526 6.0101 7.5127 15.0253 0.2421 Constraint 859 1334 4.5926 5.7407 11.4814 0.2420 Constraint 859 1309 4.9302 6.1627 12.3254 0.2420 Constraint 1447 1670 4.0974 5.1217 10.2434 0.2419 Constraint 1092 1488 5.3229 6.6536 13.3072 0.2418 Constraint 294 1204 5.7430 7.1787 14.3574 0.2418 Constraint 466 968 5.5952 6.9940 13.9880 0.2417 Constraint 892 1334 4.9526 6.1908 12.3816 0.2415 Constraint 836 1391 4.8129 6.0162 12.0323 0.2413 Constraint 299 1438 5.3363 6.6704 13.3408 0.2413 Constraint 189 1438 5.5515 6.9394 13.8789 0.2413 Constraint 1309 1408 5.0193 6.2742 12.5483 0.2407 Constraint 572 1158 4.7633 5.9542 11.9083 0.2407 Constraint 347 448 4.1844 5.2305 10.4611 0.2407 Constraint 294 713 4.3467 5.4334 10.8667 0.2407 Constraint 1109 1503 5.0290 6.2863 12.5725 0.2407 Constraint 783 868 5.0136 6.2670 12.5340 0.2406 Constraint 673 892 5.5439 6.9299 13.8597 0.2406 Constraint 1046 1455 5.5843 6.9803 13.9607 0.2406 Constraint 1014 1228 5.9652 7.4565 14.9130 0.2406 Constraint 913 1239 5.0536 6.3170 12.6341 0.2405 Constraint 722 1438 4.8666 6.0832 12.1665 0.2405 Constraint 493 868 4.5781 5.7226 11.4452 0.2405 Constraint 274 657 5.7435 7.1794 14.3588 0.2405 Constraint 274 769 5.2365 6.5456 13.0912 0.2405 Constraint 937 1268 3.2372 4.0465 8.0929 0.2404 Constraint 930 1268 6.1344 7.6680 15.3361 0.2404 Constraint 347 1133 6.0739 7.5923 15.1846 0.2404 Constraint 355 818 5.6855 7.1069 14.2138 0.2404 Constraint 1334 1634 5.4283 6.7854 13.5708 0.2404 Constraint 937 1260 5.6898 7.1122 14.2244 0.2401 Constraint 1511 1587 4.2253 5.2816 10.5633 0.2401 Constraint 375 818 5.9836 7.4795 14.9590 0.2401 Constraint 154 608 5.8459 7.3074 14.6148 0.2400 Constraint 479 706 5.3528 6.6910 13.3819 0.2399 Constraint 136 274 4.9178 6.1473 12.2945 0.2399 Constraint 769 1466 4.1482 5.1852 10.3704 0.2398 Constraint 681 859 5.4715 6.8394 13.6788 0.2397 Constraint 731 1309 5.6158 7.0197 14.0394 0.2397 Constraint 59 589 5.3107 6.6384 13.2768 0.2397 Constraint 47 665 3.5700 4.4624 8.9249 0.2397 Constraint 47 639 5.8525 7.3156 14.6313 0.2397 Constraint 1575 1657 5.3890 6.7363 13.4725 0.2395 Constraint 800 1382 5.5626 6.9533 13.9065 0.2393 Constraint 549 698 5.2374 6.5467 13.0935 0.2391 Constraint 256 1268 5.7318 7.1648 14.3296 0.2390 Constraint 448 579 5.7863 7.2329 14.4659 0.2390 Constraint 363 443 4.7457 5.9321 11.8643 0.2389 Constraint 623 739 4.5841 5.7301 11.4602 0.2388 Constraint 1141 1351 5.5747 6.9684 13.9368 0.2386 Constraint 1447 1587 5.1036 6.3795 12.7590 0.2385 Constraint 944 1022 5.0836 6.3544 12.7089 0.2384 Constraint 892 1228 4.8568 6.0710 12.1421 0.2384 Constraint 892 1204 6.1006 7.6258 15.2515 0.2384 Constraint 756 868 4.9066 6.1332 12.2664 0.2384 Constraint 748 1268 4.9329 6.1661 12.3323 0.2383 Constraint 421 829 5.6164 7.0204 14.0409 0.2382 Constraint 443 1399 5.7890 7.2363 14.4726 0.2381 Constraint 421 1408 5.1774 6.4718 12.9436 0.2381 Constraint 412 1408 5.2548 6.5685 13.1369 0.2381 Constraint 375 1447 5.3117 6.6396 13.2792 0.2381 Constraint 731 818 4.5816 5.7270 11.4541 0.2380 Constraint 639 1268 5.0193 6.2741 12.5481 0.2379 Constraint 443 538 6.1681 7.7101 15.4203 0.2379 Constraint 375 698 5.6125 7.0156 14.0312 0.2376 Constraint 375 673 4.9280 6.1600 12.3199 0.2376 Constraint 368 466 5.2321 6.5401 13.0802 0.2375 Constraint 164 538 5.0239 6.2799 12.5597 0.2374 Constraint 829 1178 3.5127 4.3909 8.7818 0.2374 Constraint 1133 1678 5.9167 7.3959 14.7919 0.2373 Constraint 448 859 4.0812 5.1016 10.2031 0.2372 Constraint 1030 1620 5.8873 7.3591 14.7182 0.2372 Constraint 1178 1731 4.9865 6.2331 12.4663 0.2370 Constraint 112 579 5.7367 7.1709 14.3417 0.2370 Constraint 608 1301 5.2504 6.5630 13.1259 0.2366 Constraint 800 1293 5.4355 6.7944 13.5888 0.2365 Constraint 616 1125 5.8867 7.3584 14.7168 0.2364 Constraint 848 1575 3.8734 4.8418 9.6835 0.2363 Constraint 557 937 4.7895 5.9869 11.9737 0.2362 Constraint 997 1519 6.0557 7.5696 15.1393 0.2362 Constraint 639 876 4.5656 5.7070 11.4139 0.2360 Constraint 968 1519 5.2384 6.5479 13.0959 0.2359 Constraint 479 997 4.9063 6.1329 12.2658 0.2359 Constraint 164 501 5.3282 6.6603 13.3205 0.2358 Constraint 639 761 4.5834 5.7292 11.4585 0.2358 Constraint 698 988 4.5680 5.7099 11.4199 0.2357 Constraint 241 1293 4.9667 6.2084 12.4168 0.2356 Constraint 128 1228 5.1819 6.4773 12.9547 0.2356 Constraint 818 955 4.6955 5.8693 11.7387 0.2356 Constraint 164 848 5.3817 6.7271 13.4542 0.2355 Constraint 690 769 5.6048 7.0060 14.0120 0.2354 Constraint 196 412 4.6151 5.7689 11.5378 0.2354 Constraint 299 608 4.8852 6.1066 12.2131 0.2354 Constraint 650 769 5.1137 6.3922 12.7843 0.2353 Constraint 1022 1239 4.8248 6.0310 12.0621 0.2350 Constraint 769 859 5.2763 6.5953 13.1907 0.2349 Constraint 501 1100 5.6570 7.0713 14.1426 0.2344 Constraint 1374 1683 3.9654 4.9567 9.9135 0.2344 Constraint 128 1193 4.8481 6.0602 12.1203 0.2342 Constraint 564 1046 4.8036 6.0045 12.0091 0.2342 Constraint 778 1447 5.5441 6.9301 13.8601 0.2341 Constraint 756 955 5.5490 6.9362 13.8724 0.2340 Constraint 673 1014 4.1820 5.2276 10.4551 0.2338 Constraint 988 1575 5.8932 7.3666 14.7331 0.2337 Constraint 510 673 4.7773 5.9717 11.9433 0.2336 Constraint 616 761 4.7264 5.9080 11.8160 0.2335 Constraint 189 375 5.2537 6.5671 13.1342 0.2333 Constraint 59 189 4.9752 6.2191 12.4381 0.2333 Constraint 876 955 4.7837 5.9797 11.9593 0.2333 Constraint 937 1293 4.5360 5.6700 11.3399 0.2333 Constraint 1149 1351 5.2994 6.6243 13.2485 0.2332 Constraint 1117 1416 5.0663 6.3329 12.6658 0.2332 Constraint 913 1382 4.9768 6.2210 12.4420 0.2332 Constraint 665 1077 5.7915 7.2394 14.4788 0.2331 Constraint 800 1408 4.9301 6.1627 12.3253 0.2331 Constraint 216 1382 5.0922 6.3653 12.7306 0.2330 Constraint 325 706 5.9114 7.3893 14.7786 0.2328 Constraint 285 706 5.4144 6.7679 13.5359 0.2328 Constraint 493 650 4.8580 6.0725 12.1451 0.2327 Constraint 363 748 6.2013 7.7517 15.5033 0.2326 Constraint 314 412 5.3626 6.7032 13.4064 0.2324 Constraint 1603 1739 5.2979 6.6224 13.2448 0.2324 Constraint 564 681 3.3381 4.1726 8.3452 0.2323 Constraint 384 538 5.8980 7.3725 14.7450 0.2323 Constraint 325 681 5.4751 6.8439 13.6878 0.2323 Constraint 104 216 4.6006 5.7508 11.5016 0.2323 Constraint 1293 1438 5.1069 6.3837 12.7673 0.2321 Constraint 731 829 4.8185 6.0231 12.0463 0.2320 Constraint 848 1438 5.3540 6.6925 13.3849 0.2316 Constraint 249 868 6.2979 7.8724 15.7448 0.2314 Constraint 443 510 5.9805 7.4756 14.9512 0.2314 Constraint 623 944 4.3723 5.4654 10.9308 0.2314 Constraint 392 589 5.6837 7.1047 14.2094 0.2312 Constraint 448 665 5.0332 6.2915 12.5830 0.2311 Constraint 564 713 4.7230 5.9037 11.8074 0.2310 Constraint 241 1077 5.2723 6.5904 13.1808 0.2310 Constraint 1268 1447 4.9994 6.2492 12.4984 0.2309 Constraint 128 501 4.9684 6.2105 12.4211 0.2309 Constraint 892 963 5.2075 6.5094 13.0188 0.2307 Constraint 1246 1634 5.0583 6.3229 12.6458 0.2305 Constraint 1634 1756 5.2532 6.5665 13.1331 0.2301 Constraint 756 980 4.6058 5.7572 11.5144 0.2301 Constraint 980 1587 5.4789 6.8486 13.6973 0.2300 Constraint 808 1603 4.7976 5.9970 11.9939 0.2300 Constraint 722 859 5.4129 6.7661 13.5322 0.2298 Constraint 189 549 5.6806 7.1008 14.2015 0.2298 Constraint 363 493 5.0929 6.3662 12.7324 0.2297 Constraint 713 1260 4.8728 6.0910 12.1819 0.2297 Constraint 128 421 4.1281 5.1601 10.3203 0.2295 Constraint 955 1141 5.1559 6.4449 12.8897 0.2295 Constraint 222 510 5.1510 6.4387 12.8774 0.2293 Constraint 1084 1519 4.1694 5.2117 10.4234 0.2293 Constraint 154 375 6.1881 7.7351 15.4702 0.2293 Constraint 493 1408 4.8174 6.0218 12.0436 0.2292 Constraint 403 479 5.9496 7.4370 14.8739 0.2292 Constraint 172 333 4.8280 6.0349 12.0699 0.2291 Constraint 164 333 4.1135 5.1419 10.2837 0.2291 Constraint 913 1466 5.4005 6.7506 13.5012 0.2290 Constraint 748 980 5.3824 6.7280 13.4561 0.2290 Constraint 650 748 5.3513 6.6891 13.3783 0.2290 Constraint 1141 1533 4.8001 6.0001 12.0002 0.2289 Constraint 836 1268 4.7392 5.9240 11.8479 0.2288 Constraint 457 597 4.5585 5.6981 11.3962 0.2286 Constraint 722 1351 5.2607 6.5759 13.1518 0.2285 Constraint 429 690 4.8083 6.0103 12.0207 0.2284 Constraint 955 1556 4.8986 6.1233 12.2465 0.2284 Constraint 557 899 4.7481 5.9351 11.8702 0.2281 Constraint 466 913 4.9265 6.1581 12.3163 0.2278 Constraint 623 706 4.3098 5.3872 10.7744 0.2275 Constraint 579 761 5.1575 6.4469 12.8937 0.2273 Constraint 921 1260 5.3832 6.7290 13.4581 0.2273 Constraint 1213 1620 5.3539 6.6924 13.3848 0.2272 Constraint 988 1399 5.0300 6.2875 12.5749 0.2271 Constraint 748 1325 5.3834 6.7293 13.4585 0.2270 Constraint 368 665 5.6632 7.0789 14.1579 0.2269 Constraint 808 899 4.0438 5.0547 10.1094 0.2268 Constraint 1268 1533 5.5662 6.9577 13.9154 0.2267 Constraint 549 616 4.6160 5.7700 11.5401 0.2267 Constraint 421 564 5.7178 7.1473 14.2946 0.2265 Constraint 97 466 4.8808 6.1010 12.2019 0.2265 Constraint 713 1526 5.4302 6.7877 13.5754 0.2265 Constraint 980 1276 5.6438 7.0548 14.1095 0.2264 Constraint 944 1276 4.3631 5.4539 10.9078 0.2264 Constraint 884 1334 4.1816 5.2270 10.4540 0.2264 Constraint 859 1343 4.6543 5.8179 11.6358 0.2264 Constraint 355 429 4.4306 5.5382 11.0764 0.2264 Constraint 347 429 6.0623 7.5779 15.1557 0.2264 Constraint 249 1228 5.6236 7.0295 14.0590 0.2264 Constraint 249 1213 5.4667 6.8334 13.6667 0.2264 Constraint 136 1366 5.0775 6.3469 12.6938 0.2264 Constraint 549 778 5.3460 6.6825 13.3651 0.2263 Constraint 1149 1260 5.2251 6.5314 13.0628 0.2262 Constraint 756 884 4.6987 5.8734 11.7467 0.2262 Constraint 597 673 4.6943 5.8678 11.7357 0.2261 Constraint 731 836 4.7584 5.9480 11.8961 0.2261 Constraint 564 1092 5.9580 7.4475 14.8950 0.2260 Constraint 285 1246 5.4932 6.8666 13.7331 0.2260 Constraint 285 1239 4.0508 5.0635 10.1270 0.2260 Constraint 249 1301 5.4055 6.7568 13.5137 0.2260 Constraint 180 944 5.8388 7.2985 14.5970 0.2260 Constraint 128 1416 5.8719 7.3399 14.6798 0.2260 Constraint 104 1416 4.6454 5.8067 11.6135 0.2260 Constraint 1059 1317 4.6387 5.7984 11.5967 0.2260 Constraint 189 1343 4.2948 5.3685 10.7371 0.2260 Constraint 800 1046 5.3988 6.7485 13.4971 0.2257 Constraint 930 1416 6.0660 7.5825 15.1650 0.2255 Constraint 783 1366 6.3306 7.9132 15.8264 0.2255 Constraint 1317 1427 4.4643 5.5803 11.1606 0.2255 Constraint 557 1046 4.6029 5.7537 11.5073 0.2253 Constraint 443 657 3.9717 4.9646 9.9292 0.2253 Constraint 1046 1158 4.8682 6.0852 12.1704 0.2252 Constraint 1008 1587 5.6169 7.0211 14.0422 0.2252 Constraint 189 263 4.7951 5.9939 11.9878 0.2252 Constraint 1427 1634 5.0885 6.3606 12.7212 0.2251 Constraint 630 761 4.5307 5.6633 11.3266 0.2250 Constraint 1059 1204 4.8590 6.0738 12.1476 0.2250 Constraint 836 1077 5.7643 7.2054 14.4107 0.2247 Constraint 172 412 3.9776 4.9721 9.9441 0.2246 Constraint 392 597 4.9326 6.1658 12.3316 0.2246 Constraint 39 1054 5.3664 6.7081 13.4161 0.2245 Constraint 263 698 4.9769 6.2211 12.4422 0.2243 Constraint 1575 1714 5.5551 6.9439 13.8877 0.2243 Constraint 1511 1603 5.5811 6.9764 13.9528 0.2243 Constraint 713 859 4.1054 5.1317 10.2634 0.2242 Constraint 443 1158 5.1702 6.4628 12.9255 0.2242 Constraint 189 274 4.6779 5.8474 11.6947 0.2241 Constraint 650 783 5.7977 7.2471 14.4942 0.2241 Constraint 756 1408 6.0438 7.5547 15.1094 0.2239 Constraint 510 892 4.4888 5.6110 11.2221 0.2239 Constraint 698 1030 4.3794 5.4743 10.9485 0.2239 Constraint 1620 1772 5.7006 7.1258 14.2516 0.2237 Constraint 597 713 4.0396 5.0494 10.0989 0.2237 Constraint 128 384 5.0531 6.3164 12.6328 0.2235 Constraint 1351 1772 4.7219 5.9023 11.8046 0.2235 Constraint 1260 1351 5.6242 7.0303 14.0606 0.2235 Constraint 859 1008 5.6366 7.0457 14.0914 0.2234 Constraint 1022 1109 4.5094 5.6368 11.2736 0.2234 Constraint 263 876 5.5162 6.8952 13.7905 0.2233 Constraint 1084 1488 5.6488 7.0610 14.1221 0.2232 Constraint 392 521 4.6641 5.8301 11.6602 0.2230 Constraint 448 623 4.0053 5.0066 10.0132 0.2230 Constraint 1251 1511 5.2627 6.5784 13.1567 0.2230 Constraint 368 698 4.3558 5.4448 10.8895 0.2228 Constraint 1193 1596 5.1782 6.4728 12.9456 0.2227 Constraint 164 294 5.0806 6.3507 12.7014 0.2227 Constraint 572 722 4.8286 6.0357 12.0714 0.2227 Constraint 333 1117 5.3856 6.7320 13.4639 0.2225 Constraint 980 1092 5.7253 7.1566 14.3132 0.2225 Constraint 997 1293 4.8917 6.1146 12.2292 0.2224 Constraint 589 937 5.3588 6.6986 13.3971 0.2224 Constraint 104 1193 6.1112 7.6390 15.2780 0.2222 Constraint 616 739 5.5280 6.9101 13.8201 0.2222 Constraint 1059 1678 4.4842 5.6053 11.2105 0.2222 Constraint 164 355 4.7932 5.9915 11.9830 0.2221 Constraint 818 1014 4.1291 5.1614 10.3228 0.2220 Constraint 955 1213 4.6642 5.8303 11.6605 0.2220 Constraint 944 1213 5.2711 6.5889 13.1779 0.2220 Constraint 836 1334 5.4605 6.8256 13.6512 0.2218 Constraint 487 1438 5.0596 6.3245 12.6490 0.2218 Constraint 208 384 5.2065 6.5081 13.0162 0.2218 Constraint 859 1541 6.2256 7.7819 15.5639 0.2217 Constraint 1309 1427 5.7882 7.2353 14.4706 0.2215 Constraint 1059 1634 5.2318 6.5397 13.0794 0.2215 Constraint 1634 1692 5.6147 7.0184 14.0369 0.2215 Constraint 1519 1611 4.9607 6.2009 12.4017 0.2213 Constraint 241 792 5.0478 6.3098 12.6196 0.2213 Constraint 792 955 4.3168 5.3960 10.7921 0.2212 Constraint 859 1325 5.1983 6.4979 12.9957 0.2212 Constraint 256 1030 4.7427 5.9284 11.8569 0.2212 Constraint 154 274 5.4863 6.8578 13.7157 0.2209 Constraint 921 1239 5.1726 6.4657 12.9315 0.2209 Constraint 859 1035 6.0101 7.5127 15.0253 0.2209 Constraint 1246 1447 5.3788 6.7235 13.4470 0.2208 Constraint 616 1054 5.6758 7.0948 14.1896 0.2204 Constraint 403 1117 5.9765 7.4706 14.9412 0.2201 Constraint 1334 1596 5.0529 6.3161 12.6323 0.2198 Constraint 892 1325 6.1969 7.7462 15.4923 0.2198 Constraint 208 1284 5.6748 7.0935 14.1869 0.2198 Constraint 208 1213 3.4646 4.3307 8.6614 0.2198 Constraint 164 1022 6.2312 7.7889 15.5779 0.2198 Constraint 368 443 4.5173 5.6466 11.2932 0.2198 Constraint 997 1438 5.2244 6.5305 13.0610 0.2197 Constraint 448 572 4.8374 6.0467 12.0934 0.2195 Constraint 792 980 3.6736 4.5920 9.1839 0.2195 Constraint 1301 1670 5.2407 6.5509 13.1018 0.2194 Constraint 355 800 4.7826 5.9782 11.9565 0.2192 Constraint 739 1519 4.4577 5.5721 11.1442 0.2191 Constraint 172 1193 5.9023 7.3779 14.7558 0.2191 Constraint 189 1309 4.7228 5.9035 11.8069 0.2191 Constraint 630 868 5.0652 6.3315 12.6630 0.2191 Constraint 731 892 4.7828 5.9785 11.9571 0.2191 Constraint 314 403 5.2631 6.5789 13.1577 0.2188 Constraint 1059 1133 3.8795 4.8494 9.6988 0.2186 Constraint 1293 1756 5.2080 6.5100 13.0200 0.2185 Constraint 128 355 4.5267 5.6584 11.3168 0.2185 Constraint 1068 1213 3.7028 4.6284 9.2569 0.2184 Constraint 97 829 5.6660 7.0826 14.1651 0.2184 Constraint 1068 1548 5.7981 7.2477 14.4954 0.2184 Constraint 783 944 5.3145 6.6431 13.2862 0.2183 Constraint 829 1100 5.3283 6.6604 13.3208 0.2183 Constraint 722 1374 5.6526 7.0658 14.1315 0.2182 Constraint 208 579 6.0299 7.5373 15.0747 0.2181 Constraint 128 363 4.8568 6.0710 12.1420 0.2179 Constraint 384 748 5.5217 6.9021 13.8041 0.2178 Constraint 868 955 5.3402 6.6753 13.3506 0.2177 Constraint 1374 1620 4.9887 6.2359 12.4717 0.2175 Constraint 392 769 5.2611 6.5763 13.1526 0.2174 Constraint 249 698 4.8155 6.0193 12.0387 0.2173 Constraint 836 1325 4.3603 5.4504 10.9008 0.2172 Constraint 128 818 5.4186 6.7732 13.5465 0.2170 Constraint 739 829 5.7792 7.2240 14.4481 0.2170 Constraint 368 530 5.8806 7.3508 14.7015 0.2170 Constraint 955 1030 4.6490 5.8113 11.6226 0.2167 Constraint 868 1268 6.2185 7.7732 15.5463 0.2167 Constraint 713 997 4.5470 5.6838 11.3675 0.2166 Constraint 154 355 5.3250 6.6562 13.3125 0.2164 Constraint 783 1293 5.6386 7.0482 14.0965 0.2164 Constraint 808 997 5.2644 6.5804 13.1609 0.2163 Constraint 274 1117 4.9388 6.1734 12.3469 0.2163 Constraint 1014 1125 4.9072 6.1340 12.2681 0.2161 Constraint 538 1133 4.9316 6.1645 12.3291 0.2161 Constraint 713 1317 6.0008 7.5010 15.0020 0.2159 Constraint 623 1068 5.9676 7.4595 14.9190 0.2159 Constraint 608 1092 6.2274 7.7843 15.5686 0.2159 Constraint 222 1178 5.2172 6.5215 13.0431 0.2159 Constraint 136 1008 3.6774 4.5967 9.1934 0.2159 Constraint 136 997 5.2074 6.5092 13.0184 0.2159 Constraint 429 868 5.2475 6.5594 13.1188 0.2156 Constraint 899 968 4.7095 5.8869 11.7739 0.2155 Constraint 1587 1714 4.5801 5.7251 11.4502 0.2154 Constraint 818 1427 4.6538 5.8172 11.6345 0.2153 Constraint 650 778 5.5547 6.9434 13.8869 0.2152 Constraint 908 1228 5.3669 6.7087 13.4173 0.2151 Constraint 196 968 5.1565 6.4456 12.8912 0.2150 Constraint 164 968 5.1994 6.4993 12.9985 0.2150 Constraint 39 1046 5.5352 6.9191 13.8381 0.2150 Constraint 848 1408 5.1773 6.4716 12.9431 0.2148 Constraint 196 355 5.4166 6.7707 13.5414 0.2147 Constraint 698 913 4.7837 5.9796 11.9593 0.2145 Constraint 172 572 5.8652 7.3315 14.6630 0.2145 Constraint 1408 1692 4.4832 5.6040 11.2081 0.2144 Constraint 1526 1788 4.0193 5.0241 10.0481 0.2144 Constraint 1193 1358 5.7889 7.2362 14.4723 0.2144 Constraint 208 274 4.8131 6.0164 12.0328 0.2143 Constraint 955 1035 5.2531 6.5664 13.1328 0.2142 Constraint 557 1167 4.1805 5.2256 10.4513 0.2141 Constraint 1030 1268 6.0161 7.5201 15.0403 0.2139 Constraint 572 698 5.4987 6.8733 13.7467 0.2138 Constraint 572 713 4.7960 5.9950 11.9901 0.2138 Constraint 579 756 4.5661 5.7076 11.4152 0.2136 Constraint 208 968 5.0360 6.2950 12.5900 0.2136 Constraint 180 968 4.2362 5.2953 10.5906 0.2136 Constraint 818 1167 5.3554 6.6943 13.3885 0.2135 Constraint 306 1399 5.6482 7.0602 14.1204 0.2135 Constraint 403 564 5.3309 6.6636 13.3271 0.2133 Constraint 510 756 5.8232 7.2790 14.5580 0.2133 Constraint 285 968 4.9802 6.2252 12.4505 0.2133 Constraint 572 1748 3.9680 4.9600 9.9200 0.2133 Constraint 997 1587 4.7370 5.9213 11.8425 0.2133 Constraint 1399 1649 5.0498 6.3122 12.6244 0.2132 Constraint 538 1149 5.8934 7.3668 14.7336 0.2132 Constraint 299 997 4.9453 6.1816 12.3632 0.2132 Constraint 136 579 4.9894 6.2368 12.4735 0.2132 Constraint 665 1317 5.7577 7.1972 14.3943 0.2131 Constraint 3 154 5.0731 6.3413 12.6827 0.2130 Constraint 769 1611 4.2174 5.2717 10.5434 0.2129 Constraint 222 1494 5.9560 7.4449 14.8899 0.2129 Constraint 164 1526 5.0555 6.3194 12.6388 0.2129 Constraint 104 1204 6.1033 7.6292 15.2583 0.2129 Constraint 748 848 5.2060 6.5075 13.0150 0.2129 Constraint 493 1008 5.7053 7.1316 14.2633 0.2128 Constraint 698 836 5.2791 6.5989 13.1978 0.2127 Constraint 392 968 4.5961 5.7452 11.4904 0.2127 Constraint 908 1301 4.3220 5.4025 10.8049 0.2127 Constraint 597 884 4.7324 5.9156 11.8311 0.2127 Constraint 249 848 4.7827 5.9784 11.9568 0.2127 Constraint 501 997 4.1210 5.1512 10.3025 0.2125 Constraint 1213 1317 5.4610 6.8262 13.6524 0.2124 Constraint 829 1246 4.3299 5.4124 10.8247 0.2124 Constraint 756 1731 5.6770 7.0963 14.1925 0.2124 Constraint 731 1739 6.2158 7.7698 15.5396 0.2124 Constraint 722 1764 5.9410 7.4263 14.8526 0.2124 Constraint 172 1358 6.3637 7.9546 15.9092 0.2124 Constraint 325 836 5.6899 7.1124 14.2249 0.2121 Constraint 748 1059 5.5862 6.9828 13.9655 0.2120 Constraint 466 778 5.9298 7.4122 14.8244 0.2120 Constraint 25 1100 5.8433 7.3041 14.6083 0.2120 Constraint 1008 1228 5.6889 7.1111 14.2221 0.2120 Constraint 778 1260 5.4785 6.8481 13.6963 0.2117 Constraint 1035 1455 4.3988 5.4985 10.9970 0.2117 Constraint 216 1213 4.9584 6.1980 12.3961 0.2116 Constraint 347 1158 5.8552 7.3191 14.6381 0.2115 Constraint 325 748 6.2272 7.7840 15.5680 0.2115 Constraint 189 1366 6.0623 7.5779 15.1558 0.2115 Constraint 164 1374 4.1484 5.1854 10.3709 0.2115 Constraint 968 1109 5.1048 6.3810 12.7620 0.2115 Constraint 836 1634 5.4737 6.8421 13.6843 0.2115 Constraint 180 299 4.6701 5.8377 11.6754 0.2114 Constraint 154 466 5.2575 6.5718 13.1437 0.2114 Constraint 294 968 5.4876 6.8595 13.7190 0.2110 Constraint 1084 1494 4.6309 5.7886 11.5771 0.2109 Constraint 616 713 4.1016 5.1270 10.2540 0.2109 Constraint 698 1141 5.1329 6.4162 12.8324 0.2107 Constraint 172 657 5.4224 6.7780 13.5560 0.2107 Constraint 778 1077 5.1043 6.3803 12.7607 0.2107 Constraint 421 657 3.4079 4.2599 8.5198 0.2106 Constraint 412 657 3.9654 4.9568 9.9135 0.2106 Constraint 836 1035 4.8203 6.0254 12.0508 0.2105 Constraint 429 713 5.2426 6.5533 13.1066 0.2105 Constraint 650 1427 5.4969 6.8712 13.7423 0.2104 Constraint 792 1260 5.0719 6.3399 12.6798 0.2103 Constraint 1662 1772 5.9396 7.4245 14.8490 0.2102 Constraint 1309 1548 6.1863 7.7329 15.4659 0.2101 Constraint 222 493 4.8326 6.0408 12.0815 0.2100 Constraint 222 665 5.6751 7.0939 14.1878 0.2099 Constraint 549 913 5.6141 7.0176 14.0352 0.2099 Constraint 521 836 6.0866 7.6083 15.2165 0.2099 Constraint 285 876 5.9228 7.4035 14.8071 0.2099 Constraint 1178 1268 4.8174 6.0217 12.0435 0.2097 Constraint 1503 1703 4.9673 6.2091 12.4183 0.2095 Constraint 274 997 5.1085 6.3856 12.7713 0.2091 Constraint 392 937 4.6542 5.8177 11.6354 0.2091 Constraint 1158 1447 5.6409 7.0511 14.1021 0.2090 Constraint 908 1035 4.4176 5.5221 11.0441 0.2090 Constraint 128 274 5.6867 7.1084 14.2168 0.2090 Constraint 783 1030 5.3775 6.7218 13.4437 0.2089 Constraint 538 944 5.5118 6.8898 13.7796 0.2086 Constraint 597 690 4.0655 5.0818 10.1637 0.2086 Constraint 421 997 4.7172 5.8965 11.7930 0.2085 Constraint 1382 1620 5.3056 6.6321 13.2641 0.2085 Constraint 673 1141 4.7346 5.9182 11.8365 0.2083 Constraint 899 980 5.0996 6.3745 12.7491 0.2081 Constraint 698 769 4.3498 5.4372 10.8745 0.2081 Constraint 589 848 4.7623 5.9529 11.9057 0.2079 Constraint 538 808 5.5629 6.9536 13.9073 0.2078 Constraint 1092 1720 5.0359 6.2949 12.5898 0.2078 Constraint 597 739 4.9564 6.1954 12.3909 0.2078 Constraint 579 963 6.3083 7.8854 15.7708 0.2078 Constraint 384 706 6.2863 7.8579 15.7158 0.2078 Constraint 690 1351 5.4043 6.7554 13.5108 0.2077 Constraint 913 1556 6.0927 7.6159 15.2317 0.2077 Constraint 597 908 4.0663 5.0829 10.1658 0.2076 Constraint 589 908 5.7463 7.1829 14.3657 0.2076 Constraint 121 1399 5.8440 7.3050 14.6101 0.2076 Constraint 783 892 4.8455 6.0568 12.1137 0.2075 Constraint 657 756 5.5893 6.9866 13.9733 0.2075 Constraint 1022 1149 5.4512 6.8140 13.6281 0.2073 Constraint 299 756 5.0483 6.3104 12.6207 0.2073 Constraint 112 222 5.4456 6.8070 13.6141 0.2073 Constraint 479 713 5.7596 7.1995 14.3990 0.2072 Constraint 1149 1533 6.0723 7.5904 15.1808 0.2071 Constraint 884 1399 4.5422 5.6777 11.3554 0.2071 Constraint 597 748 5.7152 7.1441 14.2881 0.2071 Constraint 241 435 6.0312 7.5390 15.0779 0.2071 Constraint 227 487 6.0596 7.5744 15.1489 0.2071 Constraint 208 314 5.5567 6.9459 13.8918 0.2071 Constraint 1008 1416 5.6230 7.0288 14.0575 0.2070 Constraint 1022 1511 3.8618 4.8272 9.6544 0.2069 Constraint 429 564 5.3680 6.7100 13.4199 0.2068 Constraint 421 698 5.3359 6.6699 13.3399 0.2068 Constraint 538 1748 5.5190 6.8988 13.7975 0.2066 Constraint 82 538 3.9229 4.9036 9.8072 0.2066 Constraint 263 1008 4.8758 6.0948 12.1896 0.2065 Constraint 968 1399 4.4855 5.6068 11.2136 0.2065 Constraint 1014 1334 4.5958 5.7447 11.4895 0.2065 Constraint 913 1293 4.9407 6.1759 12.3518 0.2064 Constraint 748 868 4.9472 6.1840 12.3680 0.2064 Constraint 1109 1511 5.6357 7.0446 14.0892 0.2064 Constraint 77 493 5.2950 6.6187 13.2374 0.2064 Constraint 1239 1526 5.0035 6.2544 12.5088 0.2063 Constraint 180 1213 6.0156 7.5195 15.0391 0.2061 Constraint 521 650 5.4300 6.7874 13.5749 0.2060 Constraint 800 988 4.8609 6.0761 12.1521 0.2060 Constraint 1141 1556 6.1485 7.6857 15.3714 0.2059 Constraint 713 1519 4.3679 5.4599 10.9198 0.2059 Constraint 706 1519 6.2007 7.7509 15.5018 0.2059 Constraint 623 908 5.6748 7.0935 14.1869 0.2059 Constraint 510 968 5.6994 7.1242 14.2484 0.2058 Constraint 921 1109 5.5360 6.9200 13.8400 0.2056 Constraint 1575 1649 4.0668 5.0835 10.1670 0.2056 Constraint 1366 1657 4.6446 5.8057 11.6114 0.2055 Constraint 154 1030 4.5288 5.6611 11.3221 0.2055 Constraint 913 1284 4.6698 5.8372 11.6745 0.2054 Constraint 412 1100 5.1550 6.4437 12.8874 0.2054 Constraint 306 848 5.9554 7.4442 14.8884 0.2054 Constraint 299 1167 4.0019 5.0023 10.0047 0.2054 Constraint 172 1204 6.2719 7.8399 15.6798 0.2054 Constraint 128 1399 4.9375 6.1719 12.3438 0.2054 Constraint 829 1193 6.1539 7.6923 15.3847 0.2051 Constraint 808 1251 6.1518 7.6897 15.3794 0.2051 Constraint 722 1399 5.9441 7.4301 14.8602 0.2051 Constraint 355 792 6.0870 7.6087 15.2174 0.2051 Constraint 848 1548 6.2146 7.7682 15.5364 0.2051 Constraint 306 1466 6.3118 7.8897 15.7794 0.2051 Constraint 630 1141 5.1898 6.4873 12.9746 0.2050 Constraint 549 769 5.8060 7.2575 14.5150 0.2049 Constraint 363 487 5.6616 7.0770 14.1540 0.2047 Constraint 1054 1611 5.4789 6.8486 13.6972 0.2047 Constraint 630 731 5.0570 6.3212 12.6424 0.2047 Constraint 285 859 6.2791 7.8489 15.6978 0.2047 Constraint 274 899 5.2025 6.5032 13.0063 0.2047 Constraint 227 1158 3.7642 4.7053 9.4106 0.2047 Constraint 1382 1541 5.0881 6.3602 12.7203 0.2047 Constraint 1382 1533 4.1774 5.2218 10.4436 0.2047 Constraint 1309 1748 5.6303 7.0379 14.0758 0.2047 Constraint 128 368 5.6583 7.0729 14.1458 0.2047 Constraint 521 1391 5.6462 7.0578 14.1156 0.2046 Constraint 808 1455 5.0395 6.2993 12.5986 0.2045 Constraint 145 263 5.5031 6.8789 13.7579 0.2045 Constraint 944 1268 5.2476 6.5595 13.1191 0.2045 Constraint 1438 1670 5.0394 6.2993 12.5986 0.2045 Constraint 1239 1620 5.3868 6.7335 13.4671 0.2043 Constraint 808 1068 4.8918 6.1147 12.2295 0.2042 Constraint 136 1548 4.1896 5.2370 10.4741 0.2042 Constraint 180 457 4.6444 5.8055 11.6111 0.2041 Constraint 673 1117 4.9373 6.1717 12.3434 0.2041 Constraint 501 944 5.3111 6.6389 13.2778 0.2040 Constraint 706 778 4.5878 5.7347 11.4694 0.2040 Constraint 921 1382 5.6938 7.1173 14.2346 0.2040 Constraint 868 1035 5.4655 6.8319 13.6638 0.2040 Constraint 761 1008 4.3772 5.4716 10.9431 0.2039 Constraint 421 579 4.6395 5.7993 11.5986 0.2036 Constraint 285 510 6.0267 7.5334 15.0668 0.2036 Constraint 1158 1556 5.3135 6.6419 13.2838 0.2034 Constraint 154 412 4.9465 6.1831 12.3662 0.2034 Constraint 521 859 4.9828 6.2285 12.4571 0.2034 Constraint 510 1046 5.3672 6.7090 13.4180 0.2034 Constraint 448 968 3.3339 4.1674 8.3348 0.2030 Constraint 448 963 5.8679 7.3348 14.6697 0.2030 Constraint 1149 1246 5.4464 6.8080 13.6159 0.2029 Constraint 128 466 4.2695 5.3368 10.6737 0.2028 Constraint 368 501 5.1157 6.3946 12.7892 0.2028 Constraint 899 1077 5.5953 6.9942 13.9884 0.2028 Constraint 899 1054 3.3602 4.2002 8.4004 0.2028 Constraint 876 1054 4.8233 6.0291 12.0582 0.2028 Constraint 868 1077 4.8863 6.1079 12.2158 0.2028 Constraint 739 968 4.9867 6.2334 12.4668 0.2027 Constraint 713 968 4.1384 5.1730 10.3460 0.2027 Constraint 466 1239 5.8248 7.2810 14.5621 0.2025 Constraint 818 1438 4.7881 5.9851 11.9702 0.2025 Constraint 616 1293 5.5324 6.9156 13.8311 0.2024 Constraint 274 538 4.3942 5.4927 10.9855 0.2023 Constraint 154 1494 5.3767 6.7208 13.4416 0.2023 Constraint 1309 1739 5.2860 6.6075 13.2150 0.2022 Constraint 1008 1683 6.0370 7.5463 15.0925 0.2022 Constraint 657 859 5.1066 6.3832 12.7665 0.2022 Constraint 657 884 5.1972 6.4965 12.9930 0.2022 Constraint 808 1325 4.4356 5.5445 11.0891 0.2021 Constraint 1246 1382 4.5449 5.6811 11.3621 0.2021 Constraint 1533 1748 4.4999 5.6249 11.2498 0.2020 Constraint 944 1533 5.3240 6.6550 13.3099 0.2019 Constraint 1141 1503 5.3542 6.6928 13.3855 0.2018 Constraint 1117 1503 4.9992 6.2490 12.4981 0.2018 Constraint 589 868 5.1462 6.4328 12.8655 0.2017 Constraint 859 1193 4.5585 5.6981 11.3963 0.2017 Constraint 306 1204 4.5132 5.6414 11.2829 0.2017 Constraint 285 1228 4.5638 5.7048 11.4096 0.2017 Constraint 256 1228 5.4758 6.8448 13.6895 0.2017 Constraint 783 1084 5.2818 6.6022 13.2044 0.2016 Constraint 501 913 5.6477 7.0597 14.1194 0.2015 Constraint 128 1438 5.6932 7.1165 14.2329 0.2013 Constraint 47 263 4.9152 6.1440 12.2879 0.2013 Constraint 403 937 5.0251 6.2813 12.5627 0.2011 Constraint 616 913 5.2118 6.5148 13.0296 0.2011 Constraint 263 493 4.6398 5.7997 11.5995 0.2010 Constraint 579 713 4.5035 5.6294 11.2587 0.2009 Constraint 808 1133 5.6668 7.0835 14.1669 0.2007 Constraint 1149 1756 4.9086 6.1357 12.2714 0.2007 Constraint 145 384 4.7072 5.8839 11.7679 0.2007 Constraint 1657 1731 4.8854 6.1067 12.2134 0.2005 Constraint 630 756 5.1003 6.3754 12.7508 0.2005 Constraint 1343 1683 5.9885 7.4857 14.9713 0.2005 Constraint 1548 1756 4.5183 5.6479 11.2957 0.2005 Constraint 876 1438 5.7991 7.2489 14.4978 0.2003 Constraint 557 800 5.2323 6.5403 13.0806 0.2003 Constraint 510 731 4.3293 5.4117 10.8233 0.2003 Constraint 1228 1466 4.8705 6.0881 12.1762 0.2002 Constraint 876 1077 4.1035 5.1294 10.2587 0.2000 Constraint 222 673 5.5848 6.9810 13.9620 0.1999 Constraint 921 1317 6.0470 7.5588 15.1175 0.1999 Constraint 493 1054 5.5637 6.9546 13.9092 0.1999 Constraint 384 589 4.7966 5.9958 11.9916 0.1998 Constraint 154 1447 5.4760 6.8450 13.6899 0.1998 Constraint 1366 1603 5.5246 6.9057 13.8115 0.1998 Constraint 1220 1748 6.0294 7.5368 15.0736 0.1998 Constraint 876 1399 5.4044 6.7556 13.5111 0.1998 Constraint 208 1391 3.6683 4.5854 9.1708 0.1998 Constraint 299 630 4.3509 5.4386 10.8772 0.1998 Constraint 848 980 4.9832 6.2290 12.4580 0.1997 Constraint 792 944 5.6295 7.0369 14.0738 0.1996 Constraint 681 876 5.3062 6.6327 13.2655 0.1996 Constraint 997 1366 6.0081 7.5102 15.0203 0.1995 Constraint 1301 1408 4.7337 5.9171 11.8342 0.1993 Constraint 249 564 4.8963 6.1204 12.2407 0.1993 Constraint 216 412 4.3950 5.4938 10.9876 0.1992 Constraint 630 1193 5.9208 7.4010 14.8021 0.1991 Constraint 363 706 6.2121 7.7651 15.5302 0.1991 Constraint 263 1301 6.1134 7.6418 15.2835 0.1991 Constraint 263 1293 5.3581 6.6976 13.3952 0.1991 Constraint 1125 1567 5.7170 7.1462 14.2924 0.1991 Constraint 1178 1511 5.8523 7.3153 14.6307 0.1991 Constraint 1109 1567 5.4229 6.7786 13.5573 0.1991 Constraint 868 1731 5.3888 6.7360 13.4720 0.1990 Constraint 756 892 5.1060 6.3825 12.7649 0.1988 Constraint 899 1046 4.4491 5.5614 11.1228 0.1988 Constraint 443 1213 4.0002 5.0003 10.0006 0.1988 Constraint 47 256 4.6187 5.7734 11.5467 0.1987 Constraint 748 1358 5.4948 6.8685 13.7369 0.1986 Constraint 884 1193 5.8672 7.3340 14.6680 0.1986 Constraint 466 937 4.6600 5.8250 11.6500 0.1985 Constraint 800 892 5.4916 6.8645 13.7289 0.1985 Constraint 1046 1503 4.5353 5.6692 11.3383 0.1985 Constraint 1455 1657 2.4726 3.0908 6.1815 0.1984 Constraint 1100 1503 4.7656 5.9570 11.9140 0.1984 Constraint 1100 1479 5.7220 7.1525 14.3049 0.1984 Constraint 97 363 4.4947 5.6184 11.2368 0.1984 Constraint 657 1399 5.1163 6.3954 12.7909 0.1984 Constraint 884 1471 4.9876 6.2345 12.4690 0.1982 Constraint 639 868 4.8801 6.1002 12.2003 0.1981 Constraint 274 1603 5.5048 6.8810 13.7620 0.1981 Constraint 164 572 4.8384 6.0480 12.0960 0.1980 Constraint 412 549 4.6721 5.8402 11.6803 0.1980 Constraint 1059 1220 6.1663 7.7079 15.4158 0.1979 Constraint 800 1167 5.1602 6.4502 12.9004 0.1979 Constraint 579 1178 5.1020 6.3775 12.7551 0.1979 Constraint 363 1178 6.0436 7.5545 15.1091 0.1979 Constraint 299 1399 5.7144 7.1430 14.2861 0.1979 Constraint 955 1178 4.4242 5.5302 11.0604 0.1978 Constraint 1325 1427 5.7332 7.1665 14.3330 0.1978 Constraint 530 937 5.3637 6.7047 13.4093 0.1977 Constraint 66 572 4.4977 5.6222 11.2443 0.1977 Constraint 1054 1213 5.8800 7.3500 14.7000 0.1975 Constraint 778 868 4.9586 6.1983 12.3966 0.1975 Constraint 1408 1670 5.6891 7.1113 14.2227 0.1973 Constraint 189 1141 5.2095 6.5118 13.0236 0.1972 Constraint 538 1046 5.4824 6.8530 13.7061 0.1972 Constraint 216 1447 5.5243 6.9054 13.8108 0.1971 Constraint 216 1246 5.2196 6.5246 13.0491 0.1969 Constraint 66 263 4.4780 5.5975 11.1951 0.1969 Constraint 457 572 5.1455 6.4318 12.8637 0.1968 Constraint 306 501 4.4981 5.6226 11.2452 0.1965 Constraint 944 1054 4.9478 6.1848 12.3696 0.1965 Constraint 1246 1479 4.3079 5.3849 10.7699 0.1965 Constraint 241 713 3.7561 4.6951 9.3902 0.1964 Constraint 128 435 4.1299 5.1624 10.3247 0.1964 Constraint 639 1054 4.6359 5.7949 11.5898 0.1963 Constraint 256 859 5.8978 7.3722 14.7445 0.1963 Constraint 673 818 5.5534 6.9417 13.8835 0.1961 Constraint 1611 1703 5.5316 6.9145 13.8289 0.1961 Constraint 421 572 4.9090 6.1362 12.2724 0.1959 Constraint 1466 1657 5.9209 7.4012 14.8023 0.1959 Constraint 1276 1488 2.7155 3.3944 6.7888 0.1959 Constraint 1260 1634 5.6541 7.0676 14.1351 0.1959 Constraint 121 1092 4.4845 5.6057 11.2114 0.1959 Constraint 154 233 4.5763 5.7204 11.4408 0.1958 Constraint 681 868 4.8582 6.0727 12.1454 0.1957 Constraint 429 748 5.6032 7.0040 14.0080 0.1955 Constraint 690 937 5.0517 6.3146 12.6292 0.1954 Constraint 1008 1068 5.5908 6.9885 13.9770 0.1953 Constraint 233 1077 4.9636 6.2045 12.4090 0.1949 Constraint 145 285 4.6999 5.8749 11.7499 0.1948 Constraint 274 731 5.0849 6.3561 12.7122 0.1947 Constraint 818 1399 6.0859 7.6074 15.2149 0.1947 Constraint 429 589 4.2414 5.3017 10.6035 0.1946 Constraint 623 859 4.5389 5.6737 11.3473 0.1946 Constraint 1054 1567 4.1769 5.2211 10.4422 0.1946 Constraint 968 1471 5.5632 6.9540 13.9080 0.1945 Constraint 112 216 4.8543 6.0679 12.1358 0.1944 Constraint 97 818 5.1958 6.4948 12.9896 0.1944 Constraint 769 1382 5.2543 6.5678 13.1356 0.1943 Constraint 908 1030 5.4192 6.7740 13.5479 0.1942 Constraint 818 1447 4.3625 5.4532 10.9063 0.1942 Constraint 731 1008 5.3140 6.6425 13.2851 0.1941 Constraint 208 299 4.4032 5.5040 11.0079 0.1941 Constraint 778 1109 5.2990 6.6237 13.2475 0.1940 Constraint 1092 1503 6.2411 7.8013 15.6027 0.1939 Constraint 412 731 5.2017 6.5022 13.0044 0.1939 Constraint 673 1374 4.9852 6.2315 12.4630 0.1939 Constraint 136 222 5.8745 7.3431 14.6862 0.1939 Constraint 690 1382 5.2467 6.5583 13.1166 0.1938 Constraint 306 698 5.6519 7.0648 14.1297 0.1937 Constraint 47 597 5.6895 7.1119 14.2239 0.1937 Constraint 1309 1756 4.5584 5.6980 11.3960 0.1936 Constraint 249 1141 5.0954 6.3693 12.7386 0.1936 Constraint 1008 1756 4.4982 5.6227 11.2454 0.1936 Constraint 623 769 4.9040 6.1300 12.2601 0.1935 Constraint 778 1059 5.3468 6.6835 13.3671 0.1934 Constraint 616 1046 5.1249 6.4061 12.8122 0.1934 Constraint 690 1634 4.2912 5.3641 10.7281 0.1934 Constraint 876 980 5.9351 7.4188 14.8377 0.1933 Constraint 1466 1756 5.5577 6.9471 13.8942 0.1933 Constraint 769 913 4.8057 6.0071 12.0142 0.1932 Constraint 77 154 4.8714 6.0892 12.1784 0.1931 Constraint 955 1133 5.4936 6.8671 13.7341 0.1931 Constraint 748 1204 5.8714 7.3393 14.6785 0.1929 Constraint 968 1178 5.1520 6.4400 12.8800 0.1928 Constraint 706 988 4.7856 5.9820 11.9640 0.1927 Constraint 1167 1678 5.4729 6.8411 13.6821 0.1927 Constraint 1167 1649 4.8405 6.0506 12.1012 0.1927 Constraint 1603 1764 5.6899 7.1124 14.2247 0.1925 Constraint 980 1068 4.8676 6.0845 12.1691 0.1925 Constraint 1587 1657 4.3465 5.4332 10.8664 0.1924 Constraint 564 908 4.8241 6.0301 12.0603 0.1923 Constraint 706 1408 4.6553 5.8192 11.6384 0.1922 Constraint 1109 1466 4.7688 5.9610 11.9219 0.1921 Constraint 859 1416 4.9437 6.1797 12.3594 0.1921 Constraint 921 1246 4.7136 5.8919 11.7839 0.1921 Constraint 657 1008 5.1633 6.4541 12.9083 0.1919 Constraint 963 1416 5.8734 7.3418 14.6835 0.1917 Constraint 538 657 5.3097 6.6371 13.2741 0.1917 Constraint 189 1471 4.9654 6.2067 12.4135 0.1916 Constraint 1399 1511 5.6772 7.0964 14.1929 0.1915 Constraint 589 1748 4.3779 5.4723 10.9447 0.1915 Constraint 368 921 5.8087 7.2608 14.5217 0.1915 Constraint 1125 1228 5.4756 6.8445 13.6890 0.1915 Constraint 1427 1777 6.0976 7.6220 15.2439 0.1915 Constraint 1620 1703 5.3758 6.7198 13.4396 0.1914 Constraint 154 294 5.1673 6.4592 12.9184 0.1913 Constraint 549 892 4.8852 6.1065 12.2130 0.1913 Constraint 792 1447 5.0849 6.3561 12.7123 0.1913 Constraint 748 892 4.7799 5.9749 11.9498 0.1912 Constraint 859 1204 4.7925 5.9907 11.9814 0.1912 Constraint 955 1077 5.2521 6.5652 13.1303 0.1911 Constraint 1228 1471 5.3925 6.7407 13.4813 0.1911 Constraint 748 1084 5.3619 6.7024 13.4048 0.1911 Constraint 608 1260 5.1322 6.4153 12.8306 0.1911 Constraint 913 1251 4.7645 5.9557 11.9113 0.1910 Constraint 908 1276 4.1486 5.1857 10.3714 0.1910 Constraint 892 1309 4.9090 6.1362 12.2725 0.1910 Constraint 884 1325 4.1574 5.1967 10.3934 0.1910 Constraint 884 1309 3.8963 4.8704 9.7409 0.1910 Constraint 589 1158 5.2314 6.5392 13.0784 0.1910 Constraint 589 1125 2.9488 3.6860 7.3719 0.1910 Constraint 589 899 5.5732 6.9665 13.9330 0.1910 Constraint 579 930 3.8087 4.7609 9.5218 0.1910 Constraint 572 1228 4.9430 6.1787 12.3575 0.1910 Constraint 572 1204 6.2281 7.7852 15.5703 0.1910 Constraint 538 1204 5.4378 6.7972 13.5945 0.1910 Constraint 538 1193 5.0800 6.3500 12.7000 0.1910 Constraint 538 1158 5.0640 6.3300 12.6599 0.1910 Constraint 521 639 4.5306 5.6633 11.3266 0.1910 Constraint 501 769 4.5877 5.7347 11.4694 0.1910 Constraint 493 1100 5.1752 6.4690 12.9380 0.1910 Constraint 487 650 5.1823 6.4779 12.9558 0.1910 Constraint 421 1158 3.7469 4.6836 9.3672 0.1910 Constraint 421 1109 6.2839 7.8548 15.7096 0.1910 Constraint 384 1100 3.9438 4.9298 9.8595 0.1910 Constraint 368 1204 4.9374 6.1718 12.3436 0.1910 Constraint 363 1100 6.2550 7.8188 15.6376 0.1910 Constraint 363 1077 6.2267 7.7834 15.5668 0.1910 Constraint 355 457 4.9281 6.1602 12.3203 0.1910 Constraint 355 448 3.5539 4.4423 8.8847 0.1910 Constraint 347 1228 6.3043 7.8804 15.7609 0.1910 Constraint 347 1204 3.3972 4.2465 8.4930 0.1910 Constraint 333 1220 6.2763 7.8454 15.6907 0.1910 Constraint 325 1092 6.2509 7.8136 15.6272 0.1910 Constraint 325 479 4.8135 6.0169 12.0338 0.1910 Constraint 314 1167 4.0777 5.0972 10.1944 0.1910 Constraint 314 1077 5.8766 7.3458 14.6916 0.1910 Constraint 306 1193 5.1239 6.4048 12.8096 0.1910 Constraint 294 1077 5.0841 6.3552 12.7104 0.1910 Constraint 294 1046 6.2953 7.8691 15.7381 0.1910 Constraint 294 739 6.2776 7.8470 15.6940 0.1910 Constraint 285 1077 3.9195 4.8994 9.7987 0.1910 Constraint 274 1220 4.4873 5.6092 11.2183 0.1910 Constraint 274 1213 4.2098 5.2622 10.5244 0.1910 Constraint 274 1167 5.1025 6.3781 12.7563 0.1910 Constraint 274 429 5.0419 6.3023 12.6046 0.1910 Constraint 263 608 4.6480 5.8100 11.6200 0.1910 Constraint 256 1158 4.0364 5.0455 10.0911 0.1910 Constraint 256 1054 4.6900 5.8625 11.7251 0.1910 Constraint 256 1046 4.3863 5.4829 10.9657 0.1910 Constraint 256 479 4.3348 5.4185 10.8371 0.1910 Constraint 249 1178 6.0315 7.5393 15.0787 0.1910 Constraint 249 1158 3.0529 3.8161 7.6322 0.1910 Constraint 249 1125 3.9087 4.8859 9.7718 0.1910 Constraint 241 1213 5.8184 7.2731 14.5461 0.1910 Constraint 241 1204 3.9225 4.9031 9.8062 0.1910 Constraint 241 963 4.6420 5.8025 11.6050 0.1910 Constraint 233 1251 6.2147 7.7684 15.5368 0.1910 Constraint 227 1213 5.2681 6.5851 13.1701 0.1910 Constraint 227 1178 3.1950 3.9938 7.9875 0.1910 Constraint 227 1030 4.8395 6.0493 12.0987 0.1910 Constraint 227 769 6.2258 7.7822 15.5645 0.1910 Constraint 222 1228 6.3905 7.9882 15.9763 0.1910 Constraint 196 1213 4.2097 5.2621 10.5241 0.1910 Constraint 189 1334 5.5443 6.9304 13.8608 0.1910 Constraint 189 1022 5.5564 6.9456 13.8911 0.1910 Constraint 172 1246 3.9678 4.9598 9.9196 0.1910 Constraint 172 1239 2.8487 3.5609 7.1218 0.1910 Constraint 172 1213 3.7290 4.6613 9.3225 0.1910 Constraint 172 1054 6.3910 7.9888 15.9776 0.1910 Constraint 172 968 4.8050 6.0062 12.0124 0.1910 Constraint 172 937 5.8308 7.2885 14.5770 0.1910 Constraint 172 748 4.1544 5.1930 10.3861 0.1910 Constraint 164 1366 2.9601 3.7002 7.4003 0.1910 Constraint 164 1343 3.6213 4.5267 9.0533 0.1910 Constraint 164 1077 5.7333 7.1666 14.3332 0.1910 Constraint 154 1317 5.6660 7.0826 14.1651 0.1910 Constraint 136 1399 3.1473 3.9341 7.8682 0.1910 Constraint 136 1030 5.5095 6.8869 13.7738 0.1910 Constraint 128 1391 5.8505 7.3131 14.6262 0.1910 Constraint 128 1366 5.0651 6.3314 12.6629 0.1910 Constraint 104 608 6.0020 7.5025 15.0050 0.1910 Constraint 82 756 4.1627 5.2034 10.4068 0.1910 Constraint 82 510 4.0416 5.0520 10.1039 0.1910 Constraint 783 1678 3.5893 4.4867 8.9734 0.1909 Constraint 1455 1788 5.2080 6.5099 13.0199 0.1908 Constraint 136 530 3.9965 4.9956 9.9912 0.1908 Constraint 66 274 4.9941 6.2426 12.4853 0.1907 Constraint 731 1408 3.7594 4.6993 9.3985 0.1906 Constraint 294 868 5.3200 6.6500 13.2999 0.1906 Constraint 818 988 6.3344 7.9180 15.8360 0.1906 Constraint 1239 1382 4.5408 5.6761 11.3521 0.1906 Constraint 1548 1748 5.3561 6.6952 13.3903 0.1906 Constraint 1276 1503 6.0885 7.6107 15.2213 0.1906 Constraint 1084 1447 5.3663 6.7079 13.4159 0.1905 Constraint 639 748 5.2064 6.5079 13.0159 0.1905 Constraint 944 1204 5.9671 7.4589 14.9178 0.1905 Constraint 128 848 4.5768 5.7210 11.4420 0.1905 Constraint 778 1416 4.9360 6.1700 12.3399 0.1904 Constraint 944 1158 4.4073 5.5091 11.0182 0.1904 Constraint 299 657 4.7393 5.9241 11.8483 0.1904 Constraint 1084 1620 4.3534 5.4417 10.8835 0.1903 Constraint 1077 1455 4.6623 5.8279 11.6557 0.1903 Constraint 1068 1479 3.9444 4.9305 9.8610 0.1903 Constraint 1046 1511 4.4854 5.6067 11.2135 0.1903 Constraint 1046 1488 4.6939 5.8673 11.7347 0.1903 Constraint 997 1575 3.6773 4.5967 9.1933 0.1903 Constraint 892 1399 5.8405 7.3006 14.6012 0.1903 Constraint 884 1427 4.3939 5.4924 10.9847 0.1903 Constraint 859 1466 6.2088 7.7610 15.5219 0.1903 Constraint 848 1427 5.2716 6.5895 13.1790 0.1903 Constraint 769 1494 5.4401 6.8001 13.6002 0.1903 Constraint 769 1488 5.5676 6.9595 13.9191 0.1903 Constraint 739 1488 5.1828 6.4785 12.9570 0.1903 Constraint 650 1777 6.0981 7.6226 15.2452 0.1903 Constraint 597 722 4.1145 5.1431 10.2862 0.1903 Constraint 306 868 5.3611 6.7014 13.4028 0.1903 Constraint 285 868 5.5839 6.9798 13.9597 0.1903 Constraint 241 921 4.2018 5.2522 10.5044 0.1903 Constraint 233 435 6.0972 7.6215 15.2431 0.1903 Constraint 216 980 4.8670 6.0837 12.1674 0.1903 Constraint 216 808 6.2459 7.8073 15.6147 0.1903 Constraint 208 778 5.0375 6.2968 12.5936 0.1903 Constraint 208 748 5.9787 7.4733 14.9467 0.1903 Constraint 196 1788 6.2781 7.8477 15.6954 0.1903 Constraint 189 681 5.5624 6.9530 13.9060 0.1903 Constraint 164 1533 5.4149 6.7687 13.5374 0.1903 Constraint 164 1220 3.8390 4.7988 9.5976 0.1903 Constraint 154 1541 4.2717 5.3396 10.6792 0.1903 Constraint 154 1533 6.1129 7.6411 15.2822 0.1903 Constraint 136 1541 5.8318 7.2897 14.5794 0.1903 Constraint 136 1533 5.7273 7.1592 14.3184 0.1903 Constraint 136 1251 5.1728 6.4660 12.9320 0.1903 Constraint 136 1220 5.1950 6.4938 12.9876 0.1903 Constraint 128 1220 5.5148 6.8935 13.7871 0.1903 Constraint 112 1260 5.6033 7.0041 14.0082 0.1903 Constraint 112 1251 5.0368 6.2960 12.5919 0.1903 Constraint 112 1228 4.7657 5.9572 11.9143 0.1903 Constraint 77 1260 5.8162 7.2703 14.5405 0.1903 Constraint 1054 1309 4.1103 5.1379 10.2758 0.1901 Constraint 761 980 3.7739 4.7174 9.4347 0.1899 Constraint 639 859 5.5227 6.9034 13.8068 0.1896 Constraint 930 1284 4.4453 5.5566 11.1132 0.1895 Constraint 1416 1620 4.7600 5.9500 11.8999 0.1893 Constraint 128 549 5.7011 7.1264 14.2528 0.1889 Constraint 848 1178 3.3608 4.2010 8.4019 0.1889 Constraint 589 859 5.6079 7.0099 14.0198 0.1888 Constraint 616 908 5.6586 7.0733 14.1466 0.1887 Constraint 104 333 4.8498 6.0622 12.1244 0.1887 Constraint 493 968 5.0420 6.3025 12.6050 0.1887 Constraint 756 921 5.6987 7.1233 14.2467 0.1886 Constraint 189 285 5.1759 6.4699 12.9399 0.1886 Constraint 457 859 5.5761 6.9701 13.9403 0.1884 Constraint 104 800 5.3802 6.7253 13.4505 0.1884 Constraint 761 1054 4.7931 5.9914 11.9828 0.1882 Constraint 1268 1427 4.9187 6.1484 12.2969 0.1882 Constraint 944 1193 5.3675 6.7094 13.4187 0.1880 Constraint 564 1293 5.9999 7.4999 14.9998 0.1878 Constraint 1193 1670 6.1351 7.6689 15.3379 0.1878 Constraint 368 673 5.7893 7.2366 14.4733 0.1878 Constraint 355 1466 4.2633 5.3291 10.6582 0.1878 Constraint 208 1382 4.9124 6.1405 12.2809 0.1878 Constraint 59 363 5.2534 6.5668 13.1336 0.1878 Constraint 665 761 5.7804 7.2255 14.4509 0.1877 Constraint 657 769 4.9435 6.1794 12.3589 0.1877 Constraint 657 761 4.9961 6.2452 12.4904 0.1877 Constraint 274 1158 5.8448 7.3060 14.6120 0.1876 Constraint 263 1141 5.9125 7.3907 14.7814 0.1876 Constraint 216 1391 4.7026 5.8782 11.7564 0.1876 Constraint 154 435 5.5836 6.9796 13.9591 0.1876 Constraint 121 1084 4.2591 5.3239 10.6479 0.1876 Constraint 121 435 4.5718 5.7147 11.4295 0.1876 Constraint 189 299 4.5267 5.6584 11.3168 0.1876 Constraint 868 1649 5.2469 6.5587 13.1174 0.1875 Constraint 274 403 5.4314 6.7893 13.5785 0.1872 Constraint 713 937 5.5657 6.9572 13.9143 0.1870 Constraint 913 1046 4.8890 6.1112 12.2224 0.1870 Constraint 249 325 5.7637 7.2047 14.4093 0.1869 Constraint 314 1158 5.6488 7.0610 14.1220 0.1869 Constraint 421 1030 5.5708 6.9635 13.9270 0.1868 Constraint 955 1046 5.3664 6.7080 13.4160 0.1867 Constraint 673 1035 4.3074 5.3843 10.7685 0.1867 Constraint 1351 1720 5.4954 6.8693 13.7386 0.1866 Constraint 1334 1788 4.5548 5.6935 11.3870 0.1866 Constraint 1334 1526 6.1997 7.7496 15.4992 0.1866 Constraint 412 1374 6.3527 7.9409 15.8819 0.1866 Constraint 97 487 4.4447 5.5559 11.1118 0.1866 Constraint 937 1284 5.3961 6.7452 13.4903 0.1863 Constraint 1276 1374 5.8951 7.3689 14.7379 0.1862 Constraint 968 1260 5.4276 6.7845 13.5689 0.1862 Constraint 616 848 5.5410 6.9262 13.8524 0.1861 Constraint 1488 1748 5.7325 7.1657 14.3313 0.1861 Constraint 392 713 5.4355 6.7943 13.5886 0.1860 Constraint 1054 1193 3.9976 4.9970 9.9940 0.1860 Constraint 564 1054 5.9950 7.4938 14.9876 0.1859 Constraint 128 510 4.9082 6.1352 12.2705 0.1858 Constraint 1260 1438 4.2258 5.2823 10.5645 0.1858 Constraint 448 549 5.2891 6.6113 13.2227 0.1856 Constraint 1008 1158 5.6009 7.0011 14.0022 0.1856 Constraint 1284 1739 6.1654 7.7067 15.4135 0.1854 Constraint 375 761 5.5835 6.9794 13.9588 0.1854 Constraint 375 756 4.3619 5.4523 10.9047 0.1854 Constraint 306 1382 5.5402 6.9253 13.8506 0.1854 Constraint 457 1167 5.1207 6.4008 12.8017 0.1854 Constraint 792 899 5.5243 6.9053 13.8107 0.1854 Constraint 698 1382 5.1683 6.4604 12.9208 0.1851 Constraint 306 706 4.5388 5.6735 11.3469 0.1850 Constraint 665 829 4.4873 5.6091 11.2182 0.1850 Constraint 1334 1756 4.9162 6.1452 12.2904 0.1849 Constraint 564 1748 4.2824 5.3530 10.7059 0.1849 Constraint 355 1447 5.5917 6.9896 13.9792 0.1849 Constraint 299 557 4.2371 5.2963 10.5927 0.1849 Constraint 299 792 5.3133 6.6417 13.2833 0.1847 Constraint 1416 1692 6.0884 7.6105 15.2210 0.1847 Constraint 1366 1611 4.6768 5.8460 11.6920 0.1847 Constraint 1125 1777 6.2682 7.8352 15.6705 0.1847 Constraint 1117 1511 5.4754 6.8443 13.6885 0.1847 Constraint 128 412 4.9151 6.1439 12.2878 0.1847 Constraint 818 997 4.4219 5.5274 11.0547 0.1841 Constraint 608 913 4.8993 6.1241 12.2482 0.1841 Constraint 698 1408 5.3694 6.7118 13.4235 0.1841 Constraint 783 859 4.6317 5.7897 11.5794 0.1839 Constraint 1008 1260 4.7005 5.8756 11.7512 0.1839 Constraint 913 1213 3.8637 4.8296 9.6591 0.1838 Constraint 421 608 5.6899 7.1124 14.2248 0.1838 Constraint 299 1603 4.5191 5.6488 11.2976 0.1837 Constraint 557 868 5.0089 6.2611 12.5223 0.1837 Constraint 783 1059 5.4504 6.8131 13.6261 0.1836 Constraint 836 1054 4.4401 5.5501 11.1003 0.1834 Constraint 333 479 5.9716 7.4646 14.9291 0.1833 Constraint 988 1059 5.3364 6.6705 13.3410 0.1832 Constraint 955 1503 5.2424 6.5529 13.1059 0.1832 Constraint 1466 1788 4.7912 5.9890 11.9780 0.1832 Constraint 375 908 5.4750 6.8437 13.6875 0.1831 Constraint 589 783 4.7388 5.9234 11.8469 0.1830 Constraint 1358 1511 4.9780 6.2225 12.4449 0.1829 Constraint 1408 1739 5.4980 6.8725 13.7450 0.1829 Constraint 783 1054 5.0912 6.3640 12.7280 0.1828 Constraint 421 1620 6.1252 7.6565 15.3131 0.1828 Constraint 421 1587 5.0943 6.3679 12.7359 0.1828 Constraint 274 501 5.3845 6.7307 13.4614 0.1827 Constraint 59 1008 5.7071 7.1339 14.2677 0.1825 Constraint 1526 1748 3.4379 4.2974 8.5948 0.1824 Constraint 1117 1479 6.2178 7.7722 15.5444 0.1824 Constraint 1596 1662 4.8349 6.0436 12.0872 0.1822 Constraint 1251 1703 5.7976 7.2470 14.4940 0.1819 Constraint 208 572 5.3131 6.6414 13.2827 0.1819 Constraint 136 285 5.4187 6.7734 13.5468 0.1819 Constraint 899 1178 5.2257 6.5321 13.0642 0.1818 Constraint 836 1649 5.1936 6.4919 12.9839 0.1818 Constraint 836 1109 4.8829 6.1036 12.2073 0.1818 Constraint 1427 1620 5.6311 7.0389 14.0778 0.1817 Constraint 778 1479 5.9052 7.3815 14.7629 0.1812 Constraint 412 848 4.3965 5.4956 10.9912 0.1811 Constraint 731 1374 5.1207 6.4009 12.8017 0.1810 Constraint 616 690 5.8178 7.2722 14.5445 0.1808 Constraint 493 937 5.4805 6.8507 13.7013 0.1808 Constraint 1620 1720 4.8386 6.0482 12.0964 0.1808 Constraint 639 937 4.6599 5.8248 11.6497 0.1807 Constraint 1030 1239 5.5728 6.9660 13.9320 0.1806 Constraint 572 778 4.2963 5.3703 10.7407 0.1806 Constraint 1596 1678 5.0340 6.2925 12.5850 0.1805 Constraint 608 681 5.4342 6.7927 13.5854 0.1804 Constraint 1374 1703 5.3159 6.6448 13.2897 0.1804 Constraint 466 859 5.8841 7.3551 14.7101 0.1804 Constraint 164 608 3.4668 4.3335 8.6669 0.1803 Constraint 955 1596 4.5166 5.6457 11.2914 0.1803 Constraint 944 1548 6.2283 7.7853 15.5707 0.1802 Constraint 944 1526 4.3238 5.4047 10.8094 0.1802 Constraint 913 1548 6.3744 7.9680 15.9359 0.1802 Constraint 913 1526 4.3236 5.4045 10.8090 0.1802 Constraint 908 1526 4.5170 5.6463 11.2925 0.1802 Constraint 1141 1455 4.7507 5.9384 11.8768 0.1802 Constraint 263 1133 4.1196 5.1495 10.2989 0.1800 Constraint 189 829 5.0861 6.3576 12.7152 0.1800 Constraint 412 564 5.1340 6.4175 12.8351 0.1799 Constraint 955 1204 5.0730 6.3413 12.6826 0.1796 Constraint 1567 1756 5.6097 7.0121 14.0243 0.1793 Constraint 1471 1703 5.1633 6.4542 12.9083 0.1792 Constraint 530 829 4.7987 5.9983 11.9967 0.1792 Constraint 1092 1301 5.2236 6.5295 13.0591 0.1791 Constraint 233 1133 5.2377 6.5471 13.0942 0.1791 Constraint 1246 1408 5.7297 7.1621 14.3242 0.1789 Constraint 1030 1301 6.0076 7.5095 15.0189 0.1788 Constraint 1100 1382 4.6551 5.8189 11.6378 0.1788 Constraint 443 589 5.2706 6.5882 13.1764 0.1787 Constraint 104 564 4.4298 5.5372 11.0744 0.1787 Constraint 944 1587 5.8493 7.3116 14.6232 0.1786 Constraint 673 1149 6.0489 7.5612 15.1223 0.1786 Constraint 564 884 5.0936 6.3670 12.7340 0.1786 Constraint 392 722 6.2755 7.8443 15.6886 0.1785 Constraint 698 955 4.6880 5.8600 11.7200 0.1785 Constraint 1575 1662 5.1847 6.4809 12.9618 0.1785 Constraint 97 333 5.2929 6.6161 13.2321 0.1784 Constraint 818 1077 4.6270 5.7837 11.5674 0.1782 Constraint 549 1125 4.2070 5.2588 10.5176 0.1781 Constraint 196 572 3.9635 4.9543 9.9087 0.1779 Constraint 1035 1309 5.6525 7.0656 14.1312 0.1779 Constraint 521 722 5.0414 6.3017 12.6035 0.1779 Constraint 1178 1503 5.1222 6.4027 12.8055 0.1778 Constraint 876 1084 4.4899 5.6124 11.2248 0.1777 Constraint 836 1030 4.6594 5.8242 11.6484 0.1776 Constraint 1374 1649 5.3559 6.6949 13.3898 0.1776 Constraint 1117 1408 5.5910 6.9887 13.9774 0.1776 Constraint 980 1100 4.2049 5.2561 10.5122 0.1772 Constraint 249 457 4.7971 5.9964 11.9927 0.1772 Constraint 608 848 5.4735 6.8418 13.6837 0.1772 Constraint 363 913 5.1379 6.4223 12.8446 0.1772 Constraint 443 1030 4.2305 5.2881 10.5763 0.1772 Constraint 549 1351 5.7483 7.1854 14.3708 0.1770 Constraint 256 1239 4.3990 5.4987 10.9974 0.1770 Constraint 227 1268 5.1972 6.4966 12.9931 0.1770 Constraint 136 557 5.1881 6.4851 12.9703 0.1770 Constraint 180 630 5.4206 6.7758 13.5515 0.1769 Constraint 1575 1764 5.6787 7.0983 14.1967 0.1766 Constraint 1077 1634 5.4223 6.7779 13.5558 0.1764 Constraint 778 988 4.5819 5.7273 11.4547 0.1764 Constraint 154 1366 5.3068 6.6335 13.2669 0.1763 Constraint 1268 1391 5.3149 6.6436 13.2871 0.1763 Constraint 392 913 5.1873 6.4842 12.9683 0.1763 Constraint 818 1416 4.4149 5.5187 11.0374 0.1762 Constraint 233 1239 5.9338 7.4172 14.8345 0.1762 Constraint 227 510 4.8576 6.0719 12.1439 0.1762 Constraint 1030 1309 4.6635 5.8294 11.6587 0.1762 Constraint 457 690 4.3920 5.4900 10.9800 0.1760 Constraint 1533 1731 5.4141 6.7677 13.5354 0.1759 Constraint 944 1077 5.4347 6.7934 13.5868 0.1759 Constraint 673 963 4.9174 6.1467 12.2934 0.1759 Constraint 274 589 4.9262 6.1578 12.3156 0.1758 Constraint 487 913 5.7211 7.1514 14.3028 0.1758 Constraint 325 868 4.6847 5.8558 11.7117 0.1758 Constraint 487 731 5.4180 6.7725 13.5449 0.1756 Constraint 1519 1634 5.7533 7.1916 14.3832 0.1756 Constraint 493 913 3.9324 4.9155 9.8310 0.1755 Constraint 589 1077 5.2242 6.5302 13.0604 0.1755 Constraint 1167 1416 5.3680 6.7100 13.4201 0.1753 Constraint 1030 1748 5.8406 7.3008 14.6015 0.1753 Constraint 908 1054 4.9676 6.2095 12.4191 0.1753 Constraint 333 493 4.9039 6.1299 12.2598 0.1753 Constraint 818 1054 5.4589 6.8237 13.6473 0.1752 Constraint 1587 1731 5.4960 6.8700 13.7401 0.1752 Constraint 579 1301 5.1840 6.4800 12.9600 0.1751 Constraint 731 1438 5.6846 7.1058 14.2115 0.1750 Constraint 690 1408 5.2617 6.5771 13.1543 0.1749 Constraint 549 630 5.3825 6.7281 13.4562 0.1747 Constraint 848 997 5.7115 7.1394 14.2788 0.1745 Constraint 164 384 4.5672 5.7090 11.4180 0.1744 Constraint 403 572 4.5202 5.6502 11.3005 0.1742 Constraint 1416 1503 5.2867 6.6084 13.2168 0.1741 Constraint 1526 1634 4.6789 5.8486 11.6972 0.1741 Constraint 1030 1220 4.3882 5.4853 10.9705 0.1741 Constraint 921 1556 3.8949 4.8686 9.7371 0.1741 Constraint 1366 1662 4.6809 5.8511 11.7022 0.1740 Constraint 769 944 4.3099 5.3873 10.7746 0.1739 Constraint 997 1471 5.5764 6.9706 13.9411 0.1738 Constraint 285 769 4.5557 5.6946 11.3892 0.1738 Constraint 1022 1720 5.7572 7.1965 14.3930 0.1737 Constraint 739 1358 6.0712 7.5891 15.1781 0.1737 Constraint 1293 1399 5.8744 7.3430 14.6861 0.1736 Constraint 549 690 5.2658 6.5823 13.1646 0.1735 Constraint 549 657 4.7466 5.9332 11.8665 0.1735 Constraint 623 1447 5.3466 6.6833 13.3665 0.1734 Constraint 256 493 5.6360 7.0449 14.0899 0.1734 Constraint 47 944 5.1689 6.4612 12.9223 0.1733 Constraint 868 1301 4.7935 5.9919 11.9837 0.1732 Constraint 589 1054 5.6386 7.0483 14.0965 0.1732 Constraint 1193 1268 5.3989 6.7486 13.4971 0.1731 Constraint 1158 1276 4.9561 6.1952 12.3904 0.1730 Constraint 443 623 5.7552 7.1940 14.3880 0.1730 Constraint 1284 1703 5.3038 6.6297 13.2595 0.1730 Constraint 800 1141 5.2916 6.6145 13.2289 0.1729 Constraint 639 930 4.6687 5.8359 11.6718 0.1729 Constraint 706 1117 5.9064 7.3830 14.7660 0.1729 Constraint 848 1447 4.3414 5.4268 10.8535 0.1728 Constraint 579 1678 3.9785 4.9731 9.9462 0.1726 Constraint 557 1703 4.5438 5.6798 11.3596 0.1726 Constraint 557 1678 4.9265 6.1581 12.3162 0.1726 Constraint 630 1109 5.4819 6.8523 13.7047 0.1723 Constraint 731 1014 4.6083 5.7604 11.5208 0.1723 Constraint 172 294 4.9127 6.1408 12.2817 0.1721 Constraint 66 892 5.2618 6.5773 13.1546 0.1720 Constraint 572 944 5.5106 6.8882 13.7764 0.1720 Constraint 1133 1408 4.9224 6.1531 12.3061 0.1720 Constraint 639 908 4.7323 5.9154 11.8308 0.1719 Constraint 333 521 4.9531 6.1914 12.3828 0.1717 Constraint 722 955 5.2458 6.5573 13.1145 0.1716 Constraint 579 769 5.1650 6.4562 12.9124 0.1716 Constraint 748 1100 5.8113 7.2641 14.5282 0.1715 Constraint 722 892 5.7022 7.1277 14.2555 0.1714 Constraint 421 597 5.7098 7.1372 14.2744 0.1713 Constraint 375 800 4.3399 5.4249 10.8498 0.1711 Constraint 955 1251 6.0448 7.5560 15.1120 0.1710 Constraint 1541 1670 4.3514 5.4393 10.8786 0.1710 Constraint 1587 1692 5.3323 6.6654 13.3308 0.1710 Constraint 1548 1739 4.2410 5.3012 10.6024 0.1710 Constraint 1526 1777 6.1475 7.6843 15.3687 0.1710 Constraint 1519 1777 6.3099 7.8874 15.7748 0.1710 Constraint 1511 1788 4.3280 5.4100 10.8201 0.1710 Constraint 1511 1777 5.3380 6.6725 13.3449 0.1710 Constraint 1488 1788 5.8350 7.2938 14.5876 0.1710 Constraint 1479 1657 5.8198 7.2747 14.5495 0.1710 Constraint 1471 1683 5.6759 7.0949 14.1898 0.1710 Constraint 1455 1662 5.1679 6.4599 12.9197 0.1710 Constraint 1447 1683 5.9359 7.4199 14.8398 0.1710 Constraint 1447 1662 5.9576 7.4470 14.8941 0.1710 Constraint 1438 1683 5.9011 7.3764 14.7529 0.1710 Constraint 1438 1662 5.2963 6.6204 13.2407 0.1710 Constraint 1438 1657 5.1452 6.4315 12.8630 0.1710 Constraint 1427 1683 4.8463 6.0579 12.1158 0.1710 Constraint 1416 1683 5.5701 6.9626 13.9252 0.1710 Constraint 1408 1714 5.8780 7.3476 14.6951 0.1710 Constraint 1408 1683 3.5187 4.3983 8.7967 0.1710 Constraint 1399 1683 4.1050 5.1313 10.2626 0.1710 Constraint 1366 1703 3.5430 4.4287 8.8574 0.1710 Constraint 1366 1596 4.3612 5.4515 10.9031 0.1710 Constraint 1351 1556 5.4499 6.8124 13.6248 0.1710 Constraint 1351 1533 5.0411 6.3013 12.6027 0.1710 Constraint 1343 1720 4.5822 5.7277 11.4554 0.1710 Constraint 1334 1748 4.8455 6.0569 12.1137 0.1710 Constraint 1334 1739 6.2034 7.7543 15.5085 0.1710 Constraint 1325 1714 4.7504 5.9380 11.8759 0.1710 Constraint 1317 1748 4.5722 5.7152 11.4305 0.1710 Constraint 1309 1670 5.8994 7.3743 14.7486 0.1710 Constraint 1293 1611 6.2840 7.8550 15.7100 0.1710 Constraint 1284 1764 6.0989 7.6236 15.2473 0.1710 Constraint 1276 1494 5.1335 6.4169 12.8339 0.1710 Constraint 1228 1692 4.8432 6.0540 12.1080 0.1710 Constraint 1193 1714 6.1647 7.7058 15.4117 0.1710 Constraint 1149 1703 5.7802 7.2252 14.4504 0.1710 Constraint 1133 1683 6.2698 7.8372 15.6745 0.1710 Constraint 1117 1519 4.7218 5.9023 11.8046 0.1710 Constraint 1100 1511 5.7545 7.1931 14.3863 0.1710 Constraint 1092 1471 5.6768 7.0959 14.1919 0.1710 Constraint 1008 1466 5.4423 6.8029 13.6057 0.1710 Constraint 921 1603 5.7225 7.1532 14.3063 0.1710 Constraint 892 1466 5.4109 6.7636 13.5272 0.1710 Constraint 608 1764 5.9161 7.3951 14.7902 0.1710 Constraint 493 673 5.9585 7.4481 14.8963 0.1710 Constraint 375 783 3.4652 4.3315 8.6629 0.1710 Constraint 325 1382 5.6130 7.0162 14.0324 0.1710 Constraint 299 1125 6.2431 7.8039 15.6077 0.1710 Constraint 285 1149 3.6776 4.5970 9.1941 0.1710 Constraint 263 1178 5.8495 7.3119 14.6238 0.1710 Constraint 263 1149 4.6531 5.8164 11.6328 0.1710 Constraint 256 1149 4.9706 6.2133 12.4266 0.1710 Constraint 233 1391 5.4002 6.7502 13.5005 0.1710 Constraint 227 1382 3.6919 4.6149 9.2297 0.1710 Constraint 227 1374 3.6863 4.6079 9.2158 0.1710 Constraint 227 1358 6.0040 7.5050 15.0101 0.1710 Constraint 208 1358 6.0136 7.5170 15.0339 0.1710 Constraint 180 1391 4.6923 5.8654 11.7308 0.1710 Constraint 180 1374 4.8699 6.0874 12.1748 0.1710 Constraint 104 368 5.1399 6.4249 12.8498 0.1710 Constraint 97 435 4.4534 5.5667 11.1334 0.1710 Constraint 97 368 3.8301 4.7877 9.5754 0.1710 Constraint 77 521 3.9873 4.9842 9.9683 0.1710 Constraint 77 368 5.1373 6.4217 12.8433 0.1710 Constraint 66 521 6.2502 7.8128 15.6256 0.1710 Constraint 59 521 5.7976 7.2470 14.4941 0.1710 Constraint 59 487 5.3680 6.7100 13.4200 0.1710 Constraint 657 937 5.8384 7.2980 14.5961 0.1708 Constraint 403 748 4.4286 5.5358 11.0716 0.1707 Constraint 808 1046 5.5081 6.8851 13.7702 0.1706 Constraint 808 1030 4.2412 5.3015 10.6030 0.1706 Constraint 1228 1309 5.1327 6.4159 12.8317 0.1706 Constraint 121 222 4.8217 6.0271 12.0543 0.1705 Constraint 892 1284 4.8703 6.0878 12.1757 0.1704 Constraint 937 1382 6.2328 7.7910 15.5820 0.1704 Constraint 1109 1416 4.8936 6.1170 12.2340 0.1704 Constraint 403 510 5.5651 6.9563 13.9127 0.1702 Constraint 908 980 5.4794 6.8493 13.6986 0.1702 Constraint 665 848 4.5367 5.6709 11.3418 0.1702 Constraint 1358 1556 5.3671 6.7089 13.4178 0.1701 Constraint 154 829 4.8243 6.0304 12.0607 0.1701 Constraint 249 722 3.8239 4.7799 9.5597 0.1700 Constraint 306 521 3.7156 4.6445 9.2890 0.1700 Constraint 263 589 5.9159 7.3949 14.7898 0.1699 Constraint 241 325 5.3149 6.6436 13.2872 0.1699 Constraint 128 222 5.4114 6.7642 13.5285 0.1699 Constraint 1178 1260 5.3137 6.6421 13.2842 0.1699 Constraint 384 616 5.1681 6.4601 12.9202 0.1699 Constraint 435 848 4.7787 5.9733 11.9467 0.1698 Constraint 968 1587 5.2154 6.5192 13.0385 0.1698 Constraint 997 1548 4.6037 5.7546 11.5092 0.1698 Constraint 608 997 5.7582 7.1977 14.3954 0.1698 Constraint 355 769 4.6199 5.7749 11.5497 0.1697 Constraint 112 501 4.9736 6.2169 12.4339 0.1697 Constraint 713 1054 5.4238 6.7798 13.5595 0.1697 Constraint 333 698 5.5926 6.9908 13.9815 0.1696 Constraint 306 1109 5.8459 7.3074 14.6148 0.1696 Constraint 128 1133 4.9204 6.1505 12.3010 0.1695 Constraint 164 818 4.5608 5.7010 11.4021 0.1694 Constraint 698 1351 4.9570 6.1963 12.3925 0.1694 Constraint 1059 1334 4.9316 6.1645 12.3289 0.1694 Constraint 222 829 5.1618 6.4523 12.9046 0.1693 Constraint 299 681 4.8635 6.0794 12.1588 0.1692 Constraint 66 384 4.8029 6.0036 12.0073 0.1691 Constraint 233 698 3.7043 4.6304 9.2607 0.1691 Constraint 33 216 4.8228 6.0285 12.0570 0.1691 Constraint 104 466 5.9724 7.4655 14.9309 0.1691 Constraint 1239 1479 4.8879 6.1099 12.2197 0.1690 Constraint 899 1260 5.8413 7.3016 14.6032 0.1690 Constraint 164 829 4.4728 5.5910 11.1819 0.1689 Constraint 128 564 5.5332 6.9165 13.8330 0.1689 Constraint 443 579 5.0138 6.2673 12.5346 0.1688 Constraint 665 1408 5.1458 6.4323 12.8645 0.1688 Constraint 1284 1683 5.6097 7.0121 14.0242 0.1687 Constraint 347 1054 5.6534 7.0667 14.1334 0.1686 Constraint 1109 1479 6.0917 7.6146 15.2292 0.1685 Constraint 778 859 5.1522 6.4403 12.8805 0.1683 Constraint 479 1054 3.8875 4.8593 9.7186 0.1682 Constraint 299 706 3.8572 4.8214 9.6429 0.1682 Constraint 299 650 6.2033 7.7541 15.5082 0.1682 Constraint 222 429 4.8380 6.0475 12.0950 0.1681 Constraint 713 1382 4.6764 5.8455 11.6910 0.1681 Constraint 196 299 5.4784 6.8480 13.6961 0.1680 Constraint 908 1167 5.6117 7.0146 14.0292 0.1680 Constraint 189 937 5.0829 6.3536 12.7072 0.1678 Constraint 921 1149 5.2102 6.5128 13.0255 0.1678 Constraint 299 769 5.5157 6.8946 13.7892 0.1676 Constraint 1427 1649 5.6966 7.1207 14.2414 0.1675 Constraint 274 597 5.6737 7.0921 14.1843 0.1675 Constraint 808 1447 4.2064 5.2580 10.5160 0.1675 Constraint 930 1117 5.7111 7.1389 14.2778 0.1674 Constraint 1260 1366 4.2129 5.2661 10.5322 0.1673 Constraint 363 937 5.0396 6.2995 12.5991 0.1672 Constraint 589 722 5.7427 7.1784 14.3567 0.1671 Constraint 1471 1731 4.9048 6.1310 12.2620 0.1670 Constraint 876 1008 5.6262 7.0328 14.0655 0.1670 Constraint 112 355 5.4778 6.8472 13.6944 0.1670 Constraint 848 1471 5.5042 6.8802 13.7605 0.1669 Constraint 363 479 5.5393 6.9241 13.8482 0.1669 Constraint 557 818 5.8798 7.3498 14.6995 0.1667 Constraint 800 1178 5.8069 7.2587 14.5173 0.1665 Constraint 783 1657 4.8233 6.0292 12.0584 0.1665 Constraint 196 808 5.2986 6.6232 13.2464 0.1663 Constraint 639 1149 5.3493 6.6866 13.3732 0.1663 Constraint 314 1193 6.1469 7.6836 15.3673 0.1663 Constraint 154 800 5.0726 6.3407 12.6814 0.1663 Constraint 557 623 5.2174 6.5217 13.0435 0.1663 Constraint 1022 1301 6.0136 7.5170 15.0341 0.1662 Constraint 988 1251 6.3794 7.9743 15.9486 0.1662 Constraint 457 623 4.5900 5.7375 11.4751 0.1662 Constraint 384 1054 5.2218 6.5273 13.0546 0.1662 Constraint 384 1030 4.1156 5.1445 10.2890 0.1662 Constraint 363 1035 4.2394 5.2992 10.5984 0.1662 Constraint 299 623 5.0686 6.3358 12.6715 0.1661 Constraint 778 1022 4.5549 5.6936 11.3872 0.1660 Constraint 1391 1603 4.6232 5.7791 11.5581 0.1659 Constraint 501 868 5.0031 6.2538 12.5077 0.1657 Constraint 306 713 5.7375 7.1719 14.3438 0.1655 Constraint 457 868 4.8663 6.0829 12.1658 0.1655 Constraint 530 859 4.4147 5.5184 11.0367 0.1655 Constraint 1008 1541 4.8256 6.0320 12.0640 0.1653 Constraint 421 913 5.7216 7.1520 14.3040 0.1652 Constraint 314 443 4.9032 6.1290 12.2581 0.1650 Constraint 3 884 4.4648 5.5810 11.1619 0.1650 Constraint 1541 1620 5.1598 6.4498 12.8996 0.1650 Constraint 980 1178 4.3955 5.4944 10.9888 0.1650 Constraint 39 196 6.1974 7.7467 15.4935 0.1650 Constraint 630 1084 5.4869 6.8586 13.7172 0.1650 Constraint 937 1471 5.1132 6.3915 12.7831 0.1649 Constraint 639 1022 4.4790 5.5987 11.1974 0.1649 Constraint 681 800 4.0584 5.0730 10.1461 0.1648 Constraint 731 997 5.0596 6.3245 12.6491 0.1647 Constraint 1008 1777 5.8731 7.3414 14.6828 0.1646 Constraint 818 899 4.6456 5.8070 11.6140 0.1646 Constraint 800 1541 5.3765 6.7206 13.4413 0.1644 Constraint 1246 1471 4.9129 6.1411 12.2822 0.1643 Constraint 579 792 4.9911 6.2388 12.4776 0.1643 Constraint 731 1416 5.0481 6.3101 12.6202 0.1643 Constraint 33 639 5.3527 6.6908 13.3816 0.1642 Constraint 930 1008 4.8774 6.0967 12.1934 0.1641 Constraint 154 1556 3.7069 4.6336 9.2673 0.1641 Constraint 121 818 5.1877 6.4846 12.9693 0.1641 Constraint 908 1284 4.6311 5.7888 11.5777 0.1640 Constraint 892 980 4.9593 6.1991 12.3983 0.1639 Constraint 249 412 4.5526 5.6907 11.3814 0.1639 Constraint 1325 1603 6.0279 7.5349 15.0698 0.1638 Constraint 968 1068 5.5778 6.9722 13.9445 0.1638 Constraint 778 1239 5.2587 6.5734 13.1468 0.1637 Constraint 11 136 4.0984 5.1230 10.2459 0.1635 Constraint 299 963 5.0082 6.2602 12.5204 0.1634 Constraint 294 1133 5.0748 6.3435 12.6870 0.1634 Constraint 180 1228 4.3601 5.4501 10.9003 0.1634 Constraint 579 1325 2.8762 3.5953 7.1906 0.1633 Constraint 530 818 5.0116 6.2645 12.5290 0.1633 Constraint 665 859 5.5189 6.8986 13.7972 0.1631 Constraint 1427 1764 4.9116 6.1395 12.2790 0.1627 Constraint 510 818 5.4084 6.7606 13.5211 0.1626 Constraint 306 557 3.8549 4.8186 9.6372 0.1626 Constraint 756 997 5.1765 6.4707 12.9414 0.1622 Constraint 665 1228 5.9348 7.4185 14.8369 0.1622 Constraint 579 1317 5.4716 6.8395 13.6789 0.1622 Constraint 363 769 6.0186 7.5232 15.0464 0.1622 Constraint 589 963 5.8693 7.3366 14.6732 0.1620 Constraint 1084 1251 6.0417 7.5522 15.1043 0.1619 Constraint 189 1213 3.9758 4.9698 9.9396 0.1619 Constraint 128 392 5.4563 6.8204 13.6408 0.1618 Constraint 868 1596 5.4400 6.8000 13.5999 0.1618 Constraint 836 1620 4.6451 5.8064 11.6128 0.1618 Constraint 164 285 4.6726 5.8408 11.6816 0.1618 Constraint 778 892 4.4512 5.5640 11.1280 0.1617 Constraint 1084 1511 4.3832 5.4790 10.9580 0.1616 Constraint 1471 1587 5.3928 6.7410 13.4820 0.1616 Constraint 955 1246 5.5740 6.9675 13.9350 0.1615 Constraint 630 1149 5.5555 6.9444 13.8888 0.1615 Constraint 121 457 6.1955 7.7444 15.4889 0.1612 Constraint 1193 1548 4.1162 5.1452 10.2904 0.1609 Constraint 47 189 5.1784 6.4729 12.9459 0.1608 Constraint 739 1471 4.8651 6.0813 12.1627 0.1606 Constraint 944 1133 5.5805 6.9756 13.9512 0.1603 Constraint 91 164 4.6548 5.8185 11.6370 0.1603 Constraint 97 1526 5.6205 7.0257 14.0513 0.1603 Constraint 1519 1731 5.5946 6.9932 13.9865 0.1602 Constraint 1158 1438 5.6853 7.1067 14.2134 0.1602 Constraint 538 980 5.0976 6.3720 12.7441 0.1602 Constraint 1178 1533 5.4094 6.7617 13.5235 0.1601 Constraint 314 800 4.7707 5.9633 11.9267 0.1601 Constraint 285 690 5.1812 6.4764 12.9529 0.1601 Constraint 572 876 5.9667 7.4584 14.9168 0.1600 Constraint 955 1438 4.9005 6.1256 12.2513 0.1599 Constraint 859 1284 6.0318 7.5397 15.0795 0.1599 Constraint 299 1427 5.6924 7.1155 14.2310 0.1599 Constraint 1158 1351 5.5067 6.8834 13.7668 0.1598 Constraint 1158 1526 4.7209 5.9012 11.8024 0.1598 Constraint 829 1382 5.3215 6.6519 13.3038 0.1598 Constraint 104 325 5.6124 7.0155 14.0310 0.1597 Constraint 1455 1526 5.0414 6.3018 12.6035 0.1596 Constraint 314 1109 4.5429 5.6787 11.3573 0.1594 Constraint 222 479 5.3317 6.6646 13.3292 0.1593 Constraint 538 1030 5.1647 6.4559 12.9119 0.1593 Constraint 1351 1756 3.9033 4.8792 9.7583 0.1592 Constraint 510 859 5.5167 6.8958 13.7917 0.1592 Constraint 690 1092 5.3767 6.7209 13.4418 0.1591 Constraint 769 980 6.1736 7.7170 15.4341 0.1591 Constraint 97 1471 5.1571 6.4464 12.8929 0.1591 Constraint 333 665 4.2250 5.2812 10.5624 0.1590 Constraint 630 930 5.5454 6.9317 13.8635 0.1590 Constraint 1117 1720 4.8385 6.0481 12.0962 0.1589 Constraint 778 1325 5.2060 6.5075 13.0149 0.1588 Constraint 479 597 4.0368 5.0460 10.0921 0.1586 Constraint 836 1014 5.4006 6.7508 13.5015 0.1586 Constraint 1276 1662 5.9102 7.3877 14.7755 0.1585 Constraint 778 1133 3.9639 4.9549 9.9099 0.1585 Constraint 769 1030 5.0909 6.3636 12.7273 0.1585 Constraint 1100 1251 5.8356 7.2945 14.5890 0.1585 Constraint 829 1317 3.7677 4.7096 9.4192 0.1585 Constraint 761 921 5.5286 6.9107 13.8215 0.1585 Constraint 510 1382 5.9518 7.4397 14.8795 0.1585 Constraint 136 859 4.8245 6.0306 12.0611 0.1583 Constraint 1022 1220 6.2344 7.7930 15.5860 0.1583 Constraint 997 1220 6.0133 7.5167 15.0333 0.1583 Constraint 673 1399 5.4142 6.7678 13.5356 0.1583 Constraint 579 1293 4.9980 6.2475 12.4951 0.1582 Constraint 818 1317 5.8032 7.2541 14.5081 0.1581 Constraint 1204 1325 4.8155 6.0194 12.0389 0.1578 Constraint 739 1035 4.0712 5.0890 10.1780 0.1577 Constraint 921 1268 3.7767 4.7209 9.4419 0.1577 Constraint 921 1117 4.1445 5.1806 10.3613 0.1576 Constraint 868 1657 3.8140 4.7675 9.5351 0.1572 Constraint 859 1657 6.0484 7.5605 15.1211 0.1572 Constraint 1125 1382 4.5214 5.6517 11.3034 0.1572 Constraint 325 908 6.2829 7.8536 15.7073 0.1572 Constraint 189 848 5.6565 7.0706 14.1412 0.1572 Constraint 836 1427 5.3455 6.6819 13.3639 0.1570 Constraint 769 1408 4.9306 6.1633 12.3266 0.1570 Constraint 722 868 5.0244 6.2805 12.5610 0.1570 Constraint 1141 1284 4.5363 5.6703 11.3406 0.1569 Constraint 216 479 4.0339 5.0424 10.0848 0.1569 Constraint 1059 1374 4.1294 5.1618 10.3236 0.1568 Constraint 384 769 3.9328 4.9160 9.8320 0.1568 Constraint 1046 1334 4.9639 6.2049 12.4099 0.1567 Constraint 59 944 5.4628 6.8285 13.6571 0.1566 Constraint 623 1471 4.8860 6.1075 12.2150 0.1566 Constraint 180 1447 5.0622 6.3277 12.6555 0.1566 Constraint 848 1351 5.5026 6.8782 13.7565 0.1566 Constraint 748 1014 5.6608 7.0761 14.1521 0.1565 Constraint 443 1526 5.5211 6.9014 13.8029 0.1565 Constraint 778 848 4.6800 5.8500 11.7000 0.1564 Constraint 1046 1634 5.8268 7.2835 14.5669 0.1564 Constraint 128 256 5.2217 6.5271 13.0543 0.1564 Constraint 930 1035 5.9809 7.4762 14.9523 0.1562 Constraint 91 189 4.7353 5.9191 11.8382 0.1561 Constraint 761 868 5.2688 6.5860 13.1720 0.1561 Constraint 1391 1720 5.2653 6.5816 13.1631 0.1561 Constraint 18 97 5.1997 6.4997 12.9993 0.1560 Constraint 1077 1416 5.1545 6.4431 12.8862 0.1560 Constraint 1239 1670 4.7863 5.9829 11.9658 0.1559 Constraint 1541 1692 4.6400 5.8000 11.6000 0.1559 Constraint 285 530 5.7760 7.2200 14.4399 0.1559 Constraint 608 1068 6.1614 7.7018 15.4036 0.1558 Constraint 722 913 4.8728 6.0910 12.1819 0.1558 Constraint 713 988 6.1603 7.7004 15.4008 0.1558 Constraint 1391 1703 4.6623 5.8278 11.6556 0.1558 Constraint 698 868 5.7864 7.2330 14.4661 0.1557 Constraint 859 1109 4.3121 5.3901 10.7803 0.1557 Constraint 829 1117 4.4891 5.6114 11.2228 0.1557 Constraint 306 778 4.2868 5.3586 10.7171 0.1557 Constraint 145 274 5.1919 6.4899 12.9798 0.1557 Constraint 673 1193 4.9302 6.1627 12.3254 0.1556 Constraint 384 1141 4.7975 5.9969 11.9937 0.1556 Constraint 783 1649 5.0825 6.3531 12.7061 0.1555 Constraint 579 1358 6.0842 7.6053 15.2105 0.1555 Constraint 557 1358 6.3120 7.8900 15.7800 0.1555 Constraint 128 448 4.1718 5.2148 10.4295 0.1555 Constraint 333 501 4.8802 6.1003 12.2006 0.1554 Constraint 955 1657 5.1823 6.4778 12.9556 0.1553 Constraint 713 1358 5.4898 6.8623 13.7245 0.1553 Constraint 274 572 5.7286 7.1607 14.3214 0.1553 Constraint 306 1117 4.1928 5.2410 10.4821 0.1552 Constraint 299 836 6.2510 7.8138 15.6276 0.1552 Constraint 294 876 5.4648 6.8310 13.6620 0.1552 Constraint 937 1620 6.3237 7.9046 15.8091 0.1551 Constraint 808 1284 4.6872 5.8590 11.7180 0.1549 Constraint 521 1438 5.3814 6.7267 13.4535 0.1549 Constraint 249 510 4.5502 5.6877 11.3755 0.1548 Constraint 808 1035 5.2994 6.6242 13.2484 0.1548 Constraint 639 913 4.5837 5.7297 11.4593 0.1546 Constraint 1533 1634 5.4931 6.8664 13.7327 0.1545 Constraint 196 263 4.8987 6.1234 12.2468 0.1545 Constraint 980 1125 5.7255 7.1569 14.3137 0.1544 Constraint 538 681 5.5876 6.9845 13.9690 0.1543 Constraint 1603 1756 4.9079 6.1349 12.2698 0.1542 Constraint 748 937 4.1941 5.2426 10.4852 0.1541 Constraint 510 868 5.0461 6.3076 12.6151 0.1539 Constraint 501 690 5.2747 6.5934 13.1868 0.1539 Constraint 930 1556 5.0005 6.2507 12.5013 0.1539 Constraint 384 549 5.4236 6.7795 13.5590 0.1539 Constraint 564 876 4.3289 5.4111 10.8222 0.1538 Constraint 1284 1374 5.9521 7.4401 14.8803 0.1538 Constraint 698 892 4.5986 5.7482 11.4964 0.1537 Constraint 713 963 4.8156 6.0195 12.0389 0.1536 Constraint 1260 1662 5.4594 6.8243 13.6486 0.1536 Constraint 487 713 5.2597 6.5747 13.1493 0.1535 Constraint 136 597 4.5240 5.6550 11.3100 0.1535 Constraint 154 285 5.0778 6.3472 12.6944 0.1534 Constraint 848 955 5.2162 6.5203 13.0405 0.1534 Constraint 589 800 5.5087 6.8859 13.7718 0.1533 Constraint 216 818 4.7389 5.9236 11.8472 0.1533 Constraint 285 589 4.7696 5.9620 11.9241 0.1533 Constraint 756 968 4.5610 5.7012 11.4024 0.1533 Constraint 1251 1366 5.2956 6.6195 13.2391 0.1533 Constraint 429 859 5.3282 6.6603 13.3206 0.1532 Constraint 294 756 4.4270 5.5338 11.0676 0.1531 Constraint 121 448 5.5778 6.9723 13.9445 0.1531 Constraint 690 1035 4.4927 5.6159 11.2318 0.1531 Constraint 665 1141 4.4104 5.5130 11.0260 0.1531 Constraint 121 421 3.8768 4.8460 9.6919 0.1529 Constraint 1408 1519 4.9226 6.1533 12.3066 0.1528 Constraint 579 868 4.6914 5.8643 11.7285 0.1528 Constraint 457 1556 5.9125 7.3907 14.7813 0.1527 Constraint 921 1284 5.1768 6.4710 12.9420 0.1527 Constraint 1246 1488 4.1292 5.1615 10.3230 0.1527 Constraint 82 579 5.7938 7.2423 14.4845 0.1526 Constraint 876 968 4.7666 5.9583 11.9165 0.1526 Constraint 222 306 5.9562 7.4452 14.8904 0.1525 Constraint 521 818 5.3265 6.6581 13.3161 0.1525 Constraint 363 530 4.9765 6.2206 12.4412 0.1524 Constraint 792 1251 5.7804 7.2255 14.4511 0.1523 Constraint 722 1309 5.5711 6.9638 13.9277 0.1523 Constraint 448 884 5.6365 7.0456 14.0913 0.1523 Constraint 769 1133 4.8677 6.0847 12.1693 0.1523 Constraint 783 1455 5.0762 6.3452 12.6904 0.1523 Constraint 783 1427 5.3466 6.6833 13.3666 0.1523 Constraint 274 739 4.1194 5.1493 10.2986 0.1523 Constraint 761 829 4.7277 5.9096 11.8193 0.1523 Constraint 510 657 5.5936 6.9920 13.9839 0.1523 Constraint 256 333 4.9825 6.2282 12.4563 0.1522 Constraint 997 1228 5.4536 6.8170 13.6339 0.1522 Constraint 249 783 5.1438 6.4298 12.8596 0.1521 Constraint 128 333 4.6856 5.8570 11.7139 0.1521 Constraint 848 1374 5.7466 7.1832 14.3664 0.1521 Constraint 630 908 5.2425 6.5532 13.1063 0.1520 Constraint 1391 1777 4.6811 5.8514 11.7029 0.1520 Constraint 521 1703 4.3892 5.4866 10.9731 0.1520 Constraint 538 630 4.2664 5.3330 10.6661 0.1520 Constraint 1100 1325 5.2493 6.5616 13.1233 0.1519 Constraint 608 868 4.7862 5.9828 11.9656 0.1518 Constraint 1325 1634 4.9284 6.1605 12.3210 0.1516 Constraint 657 1014 5.5366 6.9207 13.8414 0.1516 Constraint 698 1077 5.0740 6.3425 12.6849 0.1516 Constraint 154 263 4.8955 6.1194 12.2389 0.1515 Constraint 1228 1438 5.1746 6.4683 12.9365 0.1514 Constraint 706 980 5.2890 6.6112 13.2224 0.1514 Constraint 1077 1301 4.0677 5.0846 10.1692 0.1513 Constraint 128 913 5.1337 6.4171 12.8343 0.1512 Constraint 154 368 6.1084 7.6356 15.2711 0.1512 Constraint 121 384 4.4048 5.5059 11.0119 0.1512 Constraint 698 1438 4.3931 5.4913 10.9827 0.1512 Constraint 690 1438 5.1651 6.4564 12.9127 0.1512 Constraint 549 792 4.9398 6.1747 12.3494 0.1511 Constraint 836 1100 5.8754 7.3443 14.6886 0.1510 Constraint 665 818 5.2662 6.5827 13.1654 0.1510 Constraint 706 808 5.0740 6.3425 12.6850 0.1509 Constraint 731 968 5.4024 6.7530 13.5061 0.1508 Constraint 208 665 3.9508 4.9386 9.8771 0.1507 Constraint 216 908 4.6995 5.8744 11.7488 0.1506 Constraint 285 665 5.5656 6.9569 13.9139 0.1504 Constraint 597 913 4.7919 5.9899 11.9797 0.1504 Constraint 756 1022 3.9751 4.9688 9.9376 0.1503 Constraint 299 722 4.4932 5.6165 11.2329 0.1502 Constraint 829 1455 4.6885 5.8606 11.7212 0.1500 Constraint 1399 1634 5.3447 6.6809 13.3617 0.1500 Constraint 808 963 4.8250 6.0313 12.0626 0.1500 Constraint 1408 1587 4.6637 5.8296 11.6592 0.1500 Constraint 479 921 4.7077 5.8846 11.7693 0.1498 Constraint 241 1133 5.6775 7.0969 14.1938 0.1498 Constraint 164 1556 5.5470 6.9338 13.8676 0.1497 Constraint 665 1374 5.9406 7.4258 14.8515 0.1496 Constraint 859 1246 4.5139 5.6424 11.2848 0.1496 Constraint 222 657 6.2862 7.8578 15.7155 0.1494 Constraint 1391 1662 4.7535 5.9419 11.8837 0.1493 Constraint 263 673 3.9009 4.8762 9.7523 0.1493 Constraint 713 1408 5.2468 6.5585 13.1170 0.1493 Constraint 557 1149 4.7268 5.9085 11.8170 0.1493 Constraint 549 1149 5.6421 7.0526 14.1051 0.1493 Constraint 722 1634 4.9950 6.2438 12.4875 0.1492 Constraint 306 1575 6.1903 7.7379 15.4757 0.1492 Constraint 1284 1382 4.4610 5.5763 11.1526 0.1492 Constraint 616 937 5.6826 7.1033 14.2065 0.1491 Constraint 589 997 6.0196 7.5245 15.0490 0.1491 Constraint 706 1030 6.3517 7.9397 15.8793 0.1490 Constraint 756 1167 5.2043 6.5054 13.0108 0.1490 Constraint 1204 1603 6.1187 7.6484 15.2968 0.1489 Constraint 868 1399 4.3538 5.4422 10.8845 0.1489 Constraint 1008 1100 4.6835 5.8544 11.7089 0.1488 Constraint 564 1167 5.1274 6.4092 12.8184 0.1487 Constraint 112 412 5.5671 6.9589 13.9178 0.1487 Constraint 172 597 5.7545 7.1932 14.3863 0.1487 Constraint 1220 1649 4.9134 6.1418 12.2836 0.1486 Constraint 800 1239 5.2611 6.5763 13.1526 0.1486 Constraint 884 988 5.6355 7.0443 14.0887 0.1486 Constraint 1358 1503 4.5009 5.6261 11.2522 0.1484 Constraint 756 848 4.8349 6.0437 12.0874 0.1484 Constraint 963 1301 6.0488 7.5610 15.1221 0.1484 Constraint 963 1268 3.7609 4.7012 9.4024 0.1484 Constraint 930 1251 6.3994 7.9993 15.9985 0.1484 Constraint 908 1293 4.4727 5.5909 11.1818 0.1484 Constraint 908 1251 6.3795 7.9743 15.9487 0.1484 Constraint 630 778 5.1163 6.3953 12.7907 0.1484 Constraint 368 1178 3.0086 3.7608 7.5216 0.1484 Constraint 368 1167 4.9837 6.2296 12.4592 0.1484 Constraint 216 1438 5.5310 6.9137 13.8274 0.1484 Constraint 208 306 5.9466 7.4332 14.8664 0.1484 Constraint 11 154 5.5314 6.9143 13.8285 0.1484 Constraint 11 145 3.3189 4.1487 8.2973 0.1484 Constraint 3 1479 5.0739 6.3424 12.6847 0.1484 Constraint 3 145 4.8832 6.1041 12.2081 0.1484 Constraint 1228 1317 5.4054 6.7568 13.5135 0.1483 Constraint 1620 1731 4.5734 5.7167 11.4334 0.1482 Constraint 899 1141 5.1524 6.4404 12.8809 0.1481 Constraint 1149 1220 5.6989 7.1236 14.2472 0.1480 Constraint 706 955 5.0739 6.3424 12.6848 0.1480 Constraint 1133 1466 5.6570 7.0712 14.1424 0.1480 Constraint 722 1603 5.6854 7.1067 14.2134 0.1479 Constraint 1541 1756 5.4017 6.7521 13.5042 0.1477 Constraint 848 1077 4.7690 5.9613 11.9226 0.1477 Constraint 722 997 5.6707 7.0884 14.1768 0.1477 Constraint 1178 1519 5.5125 6.8906 13.7812 0.1476 Constraint 121 800 5.3924 6.7405 13.4810 0.1475 Constraint 579 690 4.4490 5.5613 11.1226 0.1474 Constraint 1533 1764 4.6395 5.7993 11.5986 0.1474 Constraint 77 963 5.6157 7.0196 14.0392 0.1474 Constraint 921 1178 5.0416 6.3020 12.6039 0.1474 Constraint 448 1556 3.2590 4.0737 8.1474 0.1474 Constraint 808 1117 5.2973 6.6216 13.2432 0.1474 Constraint 1427 1503 4.7518 5.9397 11.8794 0.1473 Constraint 673 1059 5.1991 6.4989 12.9978 0.1472 Constraint 233 1276 6.0534 7.5667 15.1334 0.1472 Constraint 233 564 5.2415 6.5519 13.1038 0.1472 Constraint 1416 1720 5.6176 7.0220 14.0441 0.1471 Constraint 112 227 5.0814 6.3517 12.7034 0.1471 Constraint 1109 1382 4.9846 6.2308 12.4616 0.1471 Constraint 1022 1141 4.5147 5.6434 11.2867 0.1471 Constraint 1022 1133 4.4210 5.5262 11.0524 0.1471 Constraint 421 748 4.8480 6.0600 12.1201 0.1470 Constraint 249 493 5.8681 7.3351 14.6702 0.1470 Constraint 274 1100 5.6467 7.0584 14.1167 0.1470 Constraint 510 829 5.5576 6.9470 13.8940 0.1468 Constraint 836 1178 5.1290 6.4112 12.8224 0.1468 Constraint 1239 1603 5.0978 6.3722 12.7445 0.1467 Constraint 1046 1309 4.4238 5.5298 11.0596 0.1467 Constraint 241 355 6.0618 7.5772 15.1544 0.1466 Constraint 521 1046 4.6399 5.7998 11.5996 0.1466 Constraint 1301 1662 5.8631 7.3289 14.6578 0.1466 Constraint 196 630 3.6462 4.5578 9.1156 0.1466 Constraint 189 630 3.9328 4.9160 9.8320 0.1466 Constraint 713 944 4.9034 6.1292 12.2584 0.1465 Constraint 564 980 5.6980 7.1225 14.2451 0.1465 Constraint 1178 1276 3.8595 4.8244 9.6487 0.1464 Constraint 530 884 5.2261 6.5326 13.0652 0.1463 Constraint 457 937 5.8448 7.3060 14.6120 0.1462 Constraint 731 1022 5.1069 6.3836 12.7672 0.1461 Constraint 1193 1276 4.8132 6.0166 12.0331 0.1460 Constraint 769 1035 4.8272 6.0340 12.0679 0.1460 Constraint 172 630 5.8619 7.3274 14.6548 0.1460 Constraint 572 1030 4.4844 5.6055 11.2110 0.1459 Constraint 466 538 5.8238 7.2798 14.5595 0.1458 Constraint 921 1125 4.9360 6.1700 12.3401 0.1458 Constraint 249 572 3.5060 4.3825 8.7650 0.1458 Constraint 355 589 5.4466 6.8083 13.6165 0.1457 Constraint 1149 1567 4.8756 6.0945 12.1891 0.1457 Constraint 104 363 5.5965 6.9957 13.9914 0.1456 Constraint 104 355 4.9495 6.1869 12.3738 0.1456 Constraint 1325 1670 4.4478 5.5597 11.1194 0.1456 Constraint 256 706 6.0778 7.5973 15.1946 0.1455 Constraint 1178 1526 4.8656 6.0820 12.1639 0.1454 Constraint 921 1193 4.4107 5.5134 11.0269 0.1454 Constraint 299 748 4.7736 5.9670 11.9340 0.1453 Constraint 597 944 4.7669 5.9587 11.9173 0.1452 Constraint 1246 1358 5.4235 6.7794 13.5588 0.1452 Constraint 1178 1251 4.0341 5.0426 10.0852 0.1452 Constraint 180 306 5.2476 6.5594 13.1189 0.1451 Constraint 572 783 5.0071 6.2589 12.5178 0.1451 Constraint 698 1239 4.6425 5.8032 11.6063 0.1450 Constraint 104 421 6.1438 7.6798 15.3596 0.1450 Constraint 493 639 6.0133 7.5166 15.0333 0.1450 Constraint 466 848 4.7681 5.9601 11.9203 0.1450 Constraint 403 681 5.8055 7.2569 14.5137 0.1450 Constraint 314 1133 5.2341 6.5426 13.0852 0.1450 Constraint 128 487 5.8408 7.3011 14.6021 0.1449 Constraint 955 1567 5.0231 6.2789 12.5579 0.1449 Constraint 608 908 5.6335 7.0419 14.0838 0.1448 Constraint 121 227 4.9145 6.1432 12.2863 0.1448 Constraint 487 836 5.4818 6.8523 13.7045 0.1448 Constraint 944 1427 4.7115 5.8894 11.7789 0.1448 Constraint 829 930 4.4012 5.5015 11.0029 0.1448 Constraint 145 294 5.2409 6.5512 13.1023 0.1446 Constraint 375 913 4.5668 5.7085 11.4170 0.1446 Constraint 333 673 5.1236 6.4045 12.8089 0.1446 Constraint 829 988 6.0016 7.5020 15.0040 0.1445 Constraint 363 466 4.8946 6.1183 12.2366 0.1444 Constraint 564 997 5.3221 6.6526 13.3052 0.1444 Constraint 1077 1494 4.9360 6.1700 12.3400 0.1443 Constraint 1260 1596 5.5506 6.9383 13.8765 0.1442 Constraint 299 572 5.7079 7.1348 14.2696 0.1442 Constraint 487 1466 6.0720 7.5900 15.1800 0.1442 Constraint 1030 1720 4.0872 5.1090 10.2180 0.1440 Constraint 908 1204 4.6731 5.8414 11.6828 0.1440 Constraint 657 1374 4.7430 5.9287 11.8574 0.1440 Constraint 1068 1246 5.8310 7.2888 14.5775 0.1440 Constraint 487 698 4.0392 5.0490 10.0980 0.1440 Constraint 980 1301 4.7730 5.9663 11.9325 0.1440 Constraint 429 597 4.3073 5.3841 10.7682 0.1439 Constraint 1030 1567 4.5062 5.6327 11.2654 0.1439 Constraint 384 665 5.2279 6.5349 13.0698 0.1439 Constraint 222 363 5.4351 6.7939 13.5878 0.1439 Constraint 1030 1251 5.8937 7.3671 14.7343 0.1439 Constraint 597 868 5.0666 6.3333 12.6666 0.1437 Constraint 429 739 5.0402 6.3002 12.6005 0.1437 Constraint 222 818 5.2081 6.5101 13.0203 0.1436 Constraint 333 487 5.5122 6.8902 13.7804 0.1436 Constraint 1438 1764 4.9221 6.1526 12.3053 0.1436 Constraint 681 988 5.0751 6.3439 12.6877 0.1434 Constraint 1603 1692 5.3609 6.7011 13.4023 0.1433 Constraint 988 1556 5.9900 7.4875 14.9750 0.1433 Constraint 421 487 5.6590 7.0737 14.1474 0.1432 Constraint 778 1117 5.7484 7.1855 14.3711 0.1432 Constraint 761 944 4.3787 5.4733 10.9467 0.1432 Constraint 443 937 6.2189 7.7736 15.5472 0.1430 Constraint 1587 1662 5.1042 6.3802 12.7604 0.1430 Constraint 968 1239 5.7608 7.2010 14.4021 0.1430 Constraint 1317 1670 5.0996 6.3746 12.7491 0.1430 Constraint 145 1008 4.3170 5.3962 10.7925 0.1430 Constraint 1030 1228 4.3149 5.3936 10.7873 0.1430 Constraint 222 913 5.3277 6.6596 13.3191 0.1429 Constraint 493 1447 4.6807 5.8509 11.7018 0.1429 Constraint 97 384 4.7350 5.9188 11.8375 0.1429 Constraint 493 623 5.3362 6.6703 13.3406 0.1428 Constraint 1251 1399 5.1925 6.4907 12.9813 0.1428 Constraint 1054 1556 4.9380 6.1725 12.3450 0.1428 Constraint 164 274 4.8267 6.0334 12.0668 0.1428 Constraint 739 1239 5.6343 7.0429 14.0858 0.1428 Constraint 39 208 4.1872 5.2340 10.4679 0.1426 Constraint 1022 1158 5.7561 7.1951 14.3901 0.1426 Constraint 597 937 4.4771 5.5963 11.1927 0.1426 Constraint 769 1374 5.5639 6.9549 13.9098 0.1424 Constraint 800 876 4.6565 5.8206 11.6413 0.1424 Constraint 564 1178 3.5468 4.4335 8.8670 0.1424 Constraint 493 908 6.1590 7.6987 15.3975 0.1424 Constraint 868 1620 5.2406 6.5507 13.1014 0.1423 Constraint 673 884 4.7483 5.9354 11.8708 0.1423 Constraint 884 1228 5.0784 6.3480 12.6959 0.1423 Constraint 1455 1611 4.6962 5.8702 11.7404 0.1422 Constraint 189 1494 5.6498 7.0622 14.1245 0.1422 Constraint 1054 1276 5.7540 7.1925 14.3851 0.1421 Constraint 66 172 6.1671 7.7089 15.4178 0.1421 Constraint 1251 1678 4.2353 5.2942 10.5883 0.1421 Constraint 1117 1301 5.3537 6.6921 13.3842 0.1419 Constraint 955 1358 4.9344 6.1680 12.3360 0.1419 Constraint 868 1366 4.4708 5.5885 11.1770 0.1418 Constraint 665 876 4.8467 6.0584 12.1168 0.1418 Constraint 493 1213 5.5879 6.9849 13.9698 0.1418 Constraint 1030 1358 4.5595 5.6994 11.3988 0.1417 Constraint 1133 1455 4.0924 5.1155 10.2310 0.1416 Constraint 1068 1309 4.8463 6.0579 12.1157 0.1416 Constraint 1035 1427 3.8946 4.8682 9.7364 0.1416 Constraint 980 1611 6.1067 7.6333 15.2667 0.1416 Constraint 921 1657 4.1848 5.2310 10.4621 0.1416 Constraint 836 1764 5.4089 6.7611 13.5223 0.1416 Constraint 829 1276 3.9592 4.9490 9.8979 0.1416 Constraint 756 1703 6.0504 7.5630 15.1261 0.1416 Constraint 756 1678 5.6146 7.0183 14.0366 0.1416 Constraint 722 1731 5.9694 7.4618 14.9236 0.1416 Constraint 665 1260 5.0880 6.3600 12.7199 0.1416 Constraint 665 1220 5.7510 7.1888 14.3776 0.1416 Constraint 630 1293 4.9179 6.1473 12.2947 0.1416 Constraint 630 1260 4.7798 5.9747 11.9495 0.1416 Constraint 572 1325 6.0277 7.5346 15.0692 0.1416 Constraint 557 1325 5.6475 7.0593 14.1187 0.1416 Constraint 549 1382 5.5121 6.8901 13.7802 0.1416 Constraint 549 1358 4.7816 5.9770 11.9540 0.1416 Constraint 549 1325 5.5620 6.9525 13.9051 0.1416 Constraint 530 630 4.8953 6.1191 12.2382 0.1416 Constraint 521 1358 5.9090 7.3863 14.7726 0.1416 Constraint 510 1416 5.8639 7.3298 14.6597 0.1416 Constraint 487 1416 4.6359 5.7948 11.5897 0.1416 Constraint 412 748 5.2977 6.6221 13.2443 0.1416 Constraint 227 1293 3.1178 3.8972 7.7945 0.1416 Constraint 800 1109 4.2022 5.2527 10.5055 0.1416 Constraint 657 1471 5.2410 6.5512 13.1024 0.1414 Constraint 1471 1788 5.2867 6.6084 13.2168 0.1414 Constraint 1008 1193 5.5003 6.8754 13.7508 0.1413 Constraint 681 769 5.0347 6.2933 12.5867 0.1413 Constraint 1399 1494 5.3619 6.7024 13.4047 0.1412 Constraint 164 937 5.7579 7.1974 14.3948 0.1410 Constraint 189 1567 5.1439 6.4299 12.8599 0.1409 Constraint 189 1556 3.8669 4.8336 9.6673 0.1409 Constraint 589 808 4.2161 5.2701 10.5401 0.1408 Constraint 997 1533 6.0255 7.5319 15.0638 0.1408 Constraint 1054 1149 4.1662 5.2078 10.4156 0.1408 Constraint 256 1125 5.0694 6.3367 12.6734 0.1408 Constraint 128 1268 5.5358 6.9198 13.8395 0.1408 Constraint 241 1046 4.5973 5.7466 11.4931 0.1408 Constraint 285 1109 4.4623 5.5778 11.1557 0.1408 Constraint 1167 1526 3.8234 4.7793 9.5586 0.1407 Constraint 808 1427 6.0314 7.5392 15.0784 0.1407 Constraint 608 836 4.4708 5.5885 11.1771 0.1407 Constraint 196 657 4.2410 5.3013 10.6025 0.1406 Constraint 384 479 5.6366 7.0458 14.0915 0.1406 Constraint 665 1193 4.2462 5.3078 10.6156 0.1405 Constraint 333 706 5.2978 6.6223 13.2446 0.1403 Constraint 859 955 3.7498 4.6873 9.3746 0.1403 Constraint 988 1239 5.1717 6.4646 12.9293 0.1401 Constraint 829 1228 6.1903 7.7378 15.4757 0.1401 Constraint 487 1399 5.2271 6.5338 13.0677 0.1401 Constraint 1366 1683 4.0566 5.0708 10.1415 0.1401 Constraint 698 1022 3.7491 4.6863 9.3727 0.1400 Constraint 913 1193 4.1410 5.1763 10.3526 0.1399 Constraint 884 980 5.3441 6.6801 13.3603 0.1399 Constraint 848 1109 4.6760 5.8450 11.6901 0.1399 Constraint 630 921 4.9530 6.1912 12.3824 0.1398 Constraint 1541 1720 5.2060 6.5075 13.0149 0.1398 Constraint 1382 1692 5.6532 7.0666 14.1331 0.1397 Constraint 756 1603 5.1614 6.4517 12.9034 0.1397 Constraint 1084 1343 5.4539 6.8174 13.6349 0.1397 Constraint 690 1657 5.5780 6.9725 13.9449 0.1395 Constraint 1022 1125 4.8821 6.1027 12.2054 0.1394 Constraint 1149 1416 5.4212 6.7764 13.5529 0.1393 Constraint 443 980 4.9963 6.2453 12.4907 0.1391 Constraint 1035 1178 5.1931 6.4913 12.9827 0.1391 Constraint 180 274 5.0251 6.2814 12.5628 0.1391 Constraint 808 1334 6.1351 7.6689 15.3378 0.1391 Constraint 698 1100 5.4296 6.7870 13.5740 0.1390 Constraint 623 921 4.9068 6.1335 12.2670 0.1389 Constraint 1125 1416 5.1226 6.4033 12.8065 0.1388 Constraint 97 189 5.5632 6.9540 13.9080 0.1388 Constraint 435 549 5.0702 6.3377 12.6754 0.1388 Constraint 1438 1756 5.2417 6.5522 13.1043 0.1387 Constraint 557 908 5.7928 7.2411 14.4821 0.1387 Constraint 355 921 5.9009 7.3761 14.7522 0.1387 Constraint 731 1068 5.4176 6.7720 13.5439 0.1387 Constraint 172 299 5.0849 6.3561 12.7122 0.1386 Constraint 97 222 4.4600 5.5749 11.1499 0.1386 Constraint 306 510 6.2574 7.8217 15.6434 0.1385 Constraint 1447 1620 4.9203 6.1504 12.3008 0.1385 Constraint 778 955 5.1164 6.3955 12.7909 0.1384 Constraint 347 829 5.6200 7.0250 14.0500 0.1384 Constraint 1117 1575 5.4429 6.8036 13.6072 0.1384 Constraint 479 665 4.4331 5.5414 11.0828 0.1384 Constraint 249 690 4.9198 6.1498 12.2996 0.1383 Constraint 908 1193 5.1651 6.4564 12.9127 0.1383 Constraint 630 748 4.8382 6.0478 12.0956 0.1382 Constraint 639 739 4.0718 5.0898 10.1795 0.1382 Constraint 572 1519 4.5883 5.7354 11.4708 0.1382 Constraint 1092 1416 4.0955 5.1194 10.2388 0.1382 Constraint 363 579 5.9167 7.3958 14.7917 0.1381 Constraint 77 145 5.5336 6.9170 13.8340 0.1381 Constraint 66 968 4.5705 5.7131 11.4261 0.1378 Constraint 955 1533 5.8491 7.3113 14.6226 0.1378 Constraint 1416 1611 4.4676 5.5845 11.1689 0.1377 Constraint 739 859 5.2488 6.5611 13.1221 0.1376 Constraint 836 1366 4.9766 6.2207 12.4415 0.1375 Constraint 997 1133 4.9252 6.1565 12.3129 0.1375 Constraint 800 1317 5.5811 6.9763 13.9527 0.1375 Constraint 306 690 4.2037 5.2547 10.5093 0.1375 Constraint 104 963 4.1676 5.2095 10.4190 0.1374 Constraint 778 1301 5.0175 6.2719 12.5439 0.1374 Constraint 429 557 4.4020 5.5025 11.0051 0.1373 Constraint 189 256 4.8439 6.0549 12.1098 0.1373 Constraint 429 997 5.6718 7.0898 14.1796 0.1373 Constraint 1438 1649 5.6572 7.0715 14.1431 0.1373 Constraint 1284 1438 4.5003 5.6254 11.2508 0.1373 Constraint 980 1399 3.1079 3.8849 7.7698 0.1373 Constraint 800 963 5.4201 6.7751 13.5501 0.1372 Constraint 792 1054 5.6929 7.1161 14.2322 0.1372 Constraint 859 1167 4.1470 5.1838 10.3676 0.1371 Constraint 466 690 6.2689 7.8362 15.6723 0.1371 Constraint 1014 1284 5.2291 6.5364 13.0728 0.1371 Constraint 172 314 5.4964 6.8705 13.7410 0.1371 Constraint 128 538 4.2553 5.3192 10.6384 0.1371 Constraint 136 363 5.3719 6.7149 13.4298 0.1369 Constraint 216 375 5.8055 7.2568 14.5136 0.1369 Constraint 1100 1466 4.4558 5.5698 11.1395 0.1369 Constraint 77 968 5.1336 6.4170 12.8340 0.1369 Constraint 748 1228 5.5811 6.9763 13.9526 0.1368 Constraint 739 963 5.4305 6.7881 13.5762 0.1368 Constraint 368 538 5.0555 6.3194 12.6387 0.1367 Constraint 510 650 4.4040 5.5050 11.0100 0.1366 Constraint 392 673 5.2945 6.6181 13.2363 0.1366 Constraint 384 908 4.4509 5.5636 11.1272 0.1366 Constraint 384 884 4.8465 6.0582 12.1164 0.1366 Constraint 1030 1503 5.1518 6.4397 12.8794 0.1365 Constraint 968 1204 4.9049 6.1312 12.2624 0.1364 Constraint 1427 1556 5.7590 7.1987 14.3975 0.1364 Constraint 800 1455 3.7269 4.6586 9.3172 0.1363 Constraint 1325 1479 5.0885 6.3606 12.7212 0.1363 Constraint 375 1068 5.2110 6.5137 13.0274 0.1363 Constraint 930 1030 4.3879 5.4849 10.9698 0.1363 Constraint 521 698 5.6661 7.0827 14.1654 0.1361 Constraint 722 1133 5.0806 6.3507 12.7014 0.1361 Constraint 1077 1503 5.1037 6.3796 12.7592 0.1360 Constraint 706 848 5.3050 6.6312 13.2624 0.1360 Constraint 1100 1416 5.2584 6.5730 13.1459 0.1360 Constraint 233 1293 5.8723 7.3404 14.6809 0.1360 Constraint 665 868 4.9186 6.1483 12.2966 0.1359 Constraint 1059 1149 4.7013 5.8766 11.7532 0.1359 Constraint 538 829 4.8392 6.0490 12.0979 0.1359 Constraint 448 1587 4.8034 6.0043 12.0086 0.1359 Constraint 448 1548 5.8368 7.2960 14.5920 0.1359 Constraint 448 1526 6.1462 7.6827 15.3654 0.1359 Constraint 443 1556 6.1699 7.7124 15.4248 0.1359 Constraint 421 1596 5.5344 6.9180 13.8359 0.1359 Constraint 421 1556 5.2676 6.5845 13.1690 0.1359 Constraint 808 1268 4.1549 5.1936 10.3872 0.1358 Constraint 392 579 5.5708 6.9635 13.9270 0.1358 Constraint 1117 1567 4.8082 6.0102 12.0204 0.1358 Constraint 955 1054 4.6471 5.8088 11.6177 0.1358 Constraint 1556 1720 4.8860 6.1075 12.2151 0.1357 Constraint 403 800 4.8477 6.0596 12.1193 0.1357 Constraint 104 241 5.0816 6.3520 12.7041 0.1357 Constraint 47 216 4.7955 5.9944 11.9889 0.1357 Constraint 997 1077 5.7605 7.2006 14.4012 0.1357 Constraint 1077 1276 4.4044 5.5055 11.0111 0.1355 Constraint 538 818 4.9084 6.1355 12.2709 0.1355 Constraint 980 1059 6.0354 7.5442 15.0885 0.1353 Constraint 285 557 5.5621 6.9527 13.9053 0.1353 Constraint 104 589 4.3504 5.4380 10.8760 0.1353 Constraint 713 1092 5.7564 7.1955 14.3909 0.1352 Constraint 713 1533 4.6597 5.8246 11.6493 0.1351 Constraint 466 818 5.1613 6.4516 12.9033 0.1351 Constraint 1228 1351 3.7278 4.6598 9.3196 0.1350 Constraint 1008 1149 4.9255 6.1569 12.3137 0.1350 Constraint 403 963 5.1674 6.4593 12.9186 0.1350 Constraint 639 921 5.5785 6.9731 13.9462 0.1350 Constraint 249 673 4.6998 5.8748 11.7495 0.1350 Constraint 1596 1720 5.6688 7.0860 14.1721 0.1349 Constraint 968 1251 5.3533 6.6916 13.3832 0.1349 Constraint 306 538 5.4391 6.7988 13.5976 0.1348 Constraint 443 848 5.3021 6.6276 13.2553 0.1348 Constraint 274 1077 5.1834 6.4792 12.9585 0.1348 Constraint 208 1077 5.4064 6.7580 13.5159 0.1348 Constraint 189 1077 5.6023 7.0029 14.0059 0.1348 Constraint 154 1022 5.6631 7.0788 14.1577 0.1348 Constraint 39 180 5.4548 6.8185 13.6370 0.1347 Constraint 1109 1596 5.2514 6.5643 13.1285 0.1345 Constraint 1317 1466 4.4202 5.5252 11.0504 0.1344 Constraint 963 1391 5.6039 7.0048 14.0097 0.1344 Constraint 848 963 4.6069 5.7586 11.5172 0.1343 Constraint 722 1466 5.8149 7.2686 14.5372 0.1343 Constraint 145 1447 5.1401 6.4251 12.8503 0.1343 Constraint 66 466 4.4643 5.5804 11.1607 0.1343 Constraint 39 466 5.2558 6.5697 13.1395 0.1343 Constraint 216 1268 4.5236 5.6545 11.3090 0.1343 Constraint 189 1239 5.9280 7.4100 14.8199 0.1343 Constraint 1246 1391 5.3421 6.6777 13.3553 0.1343 Constraint 681 756 4.4456 5.5570 11.1140 0.1343 Constraint 944 1084 5.6971 7.1214 14.2428 0.1342 Constraint 1519 1720 4.7375 5.9219 11.8437 0.1342 Constraint 39 256 5.1403 6.4253 12.8506 0.1341 Constraint 233 392 5.1239 6.4049 12.8098 0.1341 Constraint 121 412 4.2297 5.2871 10.5743 0.1341 Constraint 299 589 4.7932 5.9914 11.9829 0.1341 Constraint 1416 1764 5.3830 6.7288 13.4575 0.1340 Constraint 1408 1772 4.0951 5.1188 10.2377 0.1340 Constraint 493 848 5.5779 6.9723 13.9447 0.1340 Constraint 457 681 5.3933 6.7416 13.4831 0.1340 Constraint 1084 1334 4.9048 6.1310 12.2621 0.1340 Constraint 1447 1731 6.1569 7.6961 15.3922 0.1339 Constraint 227 549 5.5300 6.9125 13.8250 0.1337 Constraint 1167 1447 6.0382 7.5478 15.0956 0.1337 Constraint 501 589 5.4112 6.7640 13.5280 0.1334 Constraint 549 868 3.4830 4.3538 8.7076 0.1334 Constraint 1399 1587 5.6916 7.1145 14.2289 0.1334 Constraint 403 722 5.2283 6.5354 13.0709 0.1333 Constraint 1343 1471 4.2774 5.3468 10.6936 0.1333 Constraint 77 164 5.9512 7.4389 14.8779 0.1333 Constraint 77 421 5.4417 6.8022 13.6043 0.1332 Constraint 963 1447 5.5923 6.9903 13.9806 0.1332 Constraint 479 1030 5.4696 6.8370 13.6740 0.1332 Constraint 347 1084 5.6831 7.1039 14.2078 0.1332 Constraint 97 1133 5.2827 6.6034 13.2068 0.1331 Constraint 848 1084 5.3849 6.7311 13.4623 0.1331 Constraint 1054 1519 4.8617 6.0772 12.1544 0.1331 Constraint 1284 1720 5.1363 6.4204 12.8408 0.1330 Constraint 713 1634 4.9873 6.2341 12.4683 0.1330 Constraint 1260 1343 5.6038 7.0047 14.0095 0.1330 Constraint 510 997 6.2391 7.7988 15.5977 0.1327 Constraint 299 673 3.9674 4.9593 9.9186 0.1327 Constraint 294 1325 4.0618 5.0773 10.1545 0.1327 Constraint 294 1301 6.1549 7.6937 15.3874 0.1327 Constraint 294 1293 5.3199 6.6498 13.2996 0.1327 Constraint 263 1268 4.7295 5.9118 11.8237 0.1327 Constraint 256 1325 6.1293 7.6616 15.3231 0.1327 Constraint 233 1246 4.8640 6.0800 12.1599 0.1327 Constraint 808 1149 5.2456 6.5570 13.1141 0.1327 Constraint 128 1054 4.8637 6.0796 12.1592 0.1327 Constraint 1317 1720 4.5848 5.7310 11.4620 0.1326 Constraint 77 299 5.0126 6.2657 12.5315 0.1326 Constraint 921 997 4.9720 6.2150 12.4300 0.1325 Constraint 530 944 5.0159 6.2699 12.5399 0.1324 Constraint 1054 1455 5.2043 6.5053 13.0107 0.1324 Constraint 249 1399 3.5236 4.4045 8.8089 0.1323 Constraint 748 1471 5.3767 6.7208 13.4417 0.1322 Constraint 306 375 4.4477 5.5596 11.1193 0.1322 Constraint 673 800 4.2184 5.2730 10.5459 0.1321 Constraint 466 944 3.8731 4.8414 9.6827 0.1321 Constraint 363 792 5.2209 6.5262 13.0523 0.1321 Constraint 306 792 3.4703 4.3379 8.6759 0.1321 Constraint 1167 1503 4.8877 6.1096 12.2191 0.1321 Constraint 665 988 4.5952 5.7440 11.4880 0.1320 Constraint 1239 1351 5.7318 7.1648 14.3296 0.1318 Constraint 769 1438 4.6376 5.7970 11.5940 0.1318 Constraint 172 466 5.3198 6.6498 13.2995 0.1317 Constraint 657 1408 3.4650 4.3312 8.6624 0.1317 Constraint 1284 1358 4.3582 5.4477 10.8955 0.1317 Constraint 808 1301 4.7911 5.9889 11.9777 0.1316 Constraint 778 1268 4.9386 6.1732 12.3465 0.1316 Constraint 256 557 5.2168 6.5210 13.0421 0.1315 Constraint 222 1141 4.3070 5.3837 10.7674 0.1315 Constraint 698 783 5.8511 7.3139 14.6278 0.1315 Constraint 1391 1479 4.1510 5.1888 10.3776 0.1315 Constraint 792 892 5.3194 6.6493 13.2985 0.1314 Constraint 589 713 4.0760 5.0950 10.1901 0.1313 Constraint 713 1325 5.4952 6.8690 13.7380 0.1313 Constraint 1603 1720 5.2602 6.5753 13.1505 0.1312 Constraint 1125 1408 5.4987 6.8733 13.7467 0.1312 Constraint 97 421 4.3845 5.4806 10.9612 0.1312 Constraint 363 1471 5.2991 6.6239 13.2478 0.1312 Constraint 363 1438 5.5672 6.9590 13.9179 0.1312 Constraint 1220 1351 4.8834 6.1042 12.2085 0.1311 Constraint 892 1193 4.8262 6.0328 12.0655 0.1311 Constraint 848 1204 4.0469 5.0586 10.1171 0.1311 Constraint 650 1399 4.7905 5.9881 11.9762 0.1311 Constraint 233 913 5.1435 6.4294 12.8588 0.1311 Constraint 538 800 4.6264 5.7830 11.5660 0.1310 Constraint 572 800 5.6261 7.0327 14.0653 0.1310 Constraint 466 876 5.1512 6.4390 12.8781 0.1309 Constraint 403 665 5.7113 7.1391 14.2782 0.1309 Constraint 285 1193 4.2806 5.3507 10.7015 0.1309 Constraint 172 1301 6.3279 7.9099 15.8199 0.1309 Constraint 172 1268 5.6885 7.1106 14.2212 0.1309 Constraint 145 1366 2.8821 3.6027 7.2054 0.1309 Constraint 145 1343 5.0873 6.3591 12.7182 0.1309 Constraint 136 1334 4.8397 6.0496 12.0993 0.1309 Constraint 136 1325 5.1476 6.4344 12.8689 0.1309 Constraint 136 769 3.6680 4.5850 9.1700 0.1309 Constraint 128 800 6.1441 7.6801 15.3602 0.1309 Constraint 97 538 5.8888 7.3610 14.7221 0.1309 Constraint 91 572 4.2246 5.2807 10.5614 0.1309 Constraint 47 479 5.6659 7.0823 14.1647 0.1309 Constraint 1334 1471 5.3681 6.7101 13.4202 0.1309 Constraint 59 884 5.1305 6.4132 12.8263 0.1309 Constraint 59 876 4.6445 5.8056 11.6112 0.1309 Constraint 1022 1438 5.3460 6.6825 13.3649 0.1308 Constraint 189 294 5.8190 7.2737 14.5475 0.1308 Constraint 128 597 3.1487 3.9359 7.8719 0.1308 Constraint 1167 1519 4.7647 5.9559 11.9117 0.1308 Constraint 848 1603 6.2188 7.7734 15.5469 0.1308 Constraint 306 623 5.8545 7.3181 14.6362 0.1307 Constraint 18 104 6.0440 7.5550 15.1100 0.1306 Constraint 1408 1494 5.4177 6.7721 13.5442 0.1306 Constraint 263 868 5.3362 6.6703 13.3406 0.1306 Constraint 1022 1526 4.1109 5.1386 10.2773 0.1305 Constraint 384 608 4.0597 5.0746 10.1493 0.1305 Constraint 325 521 3.9570 4.9462 9.8925 0.1305 Constraint 306 769 5.3851 6.7314 13.4628 0.1305 Constraint 836 930 5.1033 6.3791 12.7583 0.1304 Constraint 1158 1519 6.0672 7.5840 15.1680 0.1304 Constraint 1141 1447 5.1931 6.4914 12.9827 0.1304 Constraint 493 1239 6.1740 7.7174 15.4349 0.1303 Constraint 429 848 5.5458 6.9323 13.8645 0.1303 Constraint 421 769 5.1372 6.4215 12.8431 0.1303 Constraint 1092 1447 5.2054 6.5067 13.0135 0.1302 Constraint 1035 1471 5.2215 6.5269 13.0538 0.1302 Constraint 913 1035 5.2875 6.6094 13.2189 0.1302 Constraint 876 1447 5.2457 6.5571 13.1142 0.1302 Constraint 639 1084 4.7580 5.9475 11.8950 0.1302 Constraint 818 1351 4.9222 6.1528 12.3056 0.1301 Constraint 538 1293 5.6300 7.0374 14.0749 0.1301 Constraint 222 538 3.8491 4.8113 9.6227 0.1301 Constraint 597 997 5.3587 6.6984 13.3967 0.1300 Constraint 501 937 5.5853 6.9816 13.9631 0.1300 Constraint 412 493 5.0596 6.3245 12.6490 0.1300 Constraint 836 1260 4.4669 5.5836 11.1673 0.1299 Constraint 1084 1575 5.3624 6.7030 13.4061 0.1299 Constraint 227 521 5.1475 6.4344 12.8688 0.1298 Constraint 930 1178 4.7674 5.9593 11.9185 0.1298 Constraint 623 698 4.2556 5.3195 10.6390 0.1298 Constraint 1141 1567 5.6706 7.0882 14.1764 0.1297 Constraint 1100 1408 4.2576 5.3220 10.6440 0.1297 Constraint 47 1054 4.3730 5.4663 10.9326 0.1297 Constraint 1575 1683 4.6919 5.8649 11.7297 0.1296 Constraint 739 808 5.7090 7.1362 14.2724 0.1296 Constraint 665 808 4.9572 6.1966 12.3931 0.1296 Constraint 363 521 6.2246 7.7807 15.5614 0.1296 Constraint 1158 1284 4.4575 5.5719 11.1438 0.1296 Constraint 1092 1358 5.4760 6.8450 13.6899 0.1296 Constraint 510 722 4.0294 5.0367 10.0735 0.1295 Constraint 848 1239 5.7844 7.2305 14.4609 0.1295 Constraint 1541 1764 4.8648 6.0810 12.1621 0.1295 Constraint 1239 1657 4.0209 5.0261 10.0523 0.1295 Constraint 608 713 4.2909 5.3636 10.7273 0.1294 Constraint 368 800 4.0919 5.1149 10.2298 0.1292 Constraint 1193 1284 4.8389 6.0486 12.0972 0.1292 Constraint 731 859 6.0585 7.5731 15.1462 0.1292 Constraint 650 997 4.3327 5.4159 10.8319 0.1292 Constraint 91 384 5.3952 6.7440 13.4880 0.1292 Constraint 59 963 4.8800 6.1000 12.2000 0.1292 Constraint 557 1748 4.5766 5.7207 11.4415 0.1291 Constraint 104 778 4.5022 5.6277 11.2554 0.1291 Constraint 1059 1382 4.6992 5.8740 11.7479 0.1290 Constraint 557 876 4.1708 5.2135 10.4269 0.1290 Constraint 493 681 4.9150 6.1438 12.2875 0.1290 Constraint 921 1008 4.2281 5.2851 10.5702 0.1289 Constraint 673 836 4.9914 6.2392 12.4784 0.1289 Constraint 836 1046 5.2730 6.5912 13.1824 0.1289 Constraint 913 1268 3.7612 4.7015 9.4030 0.1289 Constraint 892 1268 4.8568 6.0710 12.1419 0.1289 Constraint 808 1649 4.6906 5.8633 11.7265 0.1289 Constraint 756 1438 5.7311 7.1639 14.3278 0.1289 Constraint 748 1438 5.7138 7.1423 14.2846 0.1289 Constraint 748 1399 4.8776 6.0970 12.1939 0.1289 Constraint 963 1548 6.3240 7.9050 15.8101 0.1289 Constraint 1427 1788 4.9157 6.1447 12.2893 0.1287 Constraint 739 836 4.7622 5.9528 11.9056 0.1287 Constraint 623 1133 4.7860 5.9825 11.9649 0.1287 Constraint 557 1220 4.2109 5.2637 10.5273 0.1287 Constraint 521 1220 5.5792 6.9740 13.9479 0.1287 Constraint 479 630 4.7444 5.9305 11.8611 0.1287 Constraint 1358 1488 5.7670 7.2087 14.4174 0.1286 Constraint 128 294 5.3436 6.6795 13.3590 0.1285 Constraint 1325 1471 4.7952 5.9940 11.9881 0.1285 Constraint 306 731 6.1241 7.6552 15.3103 0.1284 Constraint 579 1125 4.6139 5.7673 11.5347 0.1284 Constraint 572 1125 6.1053 7.6316 15.2632 0.1284 Constraint 39 104 6.1363 7.6703 15.3406 0.1283 Constraint 673 937 5.0061 6.2576 12.5153 0.1283 Constraint 384 501 5.3692 6.7115 13.4230 0.1282 Constraint 713 1022 5.2791 6.5989 13.1979 0.1282 Constraint 1022 1503 6.2093 7.7616 15.5233 0.1282 Constraint 769 1046 6.1756 7.7195 15.4390 0.1282 Constraint 1059 1533 5.4252 6.7815 13.5629 0.1282 Constraint 955 1059 5.4194 6.7742 13.5485 0.1281 Constraint 1343 1416 5.0003 6.2504 12.5007 0.1281 Constraint 690 1649 6.1401 7.6751 15.3502 0.1280 Constraint 1117 1455 5.6193 7.0242 14.0483 0.1279 Constraint 1541 1634 5.2055 6.5069 13.0138 0.1279 Constraint 1611 1683 5.0355 6.2944 12.5888 0.1279 Constraint 97 443 3.4360 4.2950 8.5900 0.1278 Constraint 448 597 4.9748 6.2185 12.4369 0.1278 Constraint 778 884 5.2176 6.5220 13.0441 0.1278 Constraint 136 1167 6.1690 7.7112 15.4225 0.1278 Constraint 698 1046 5.4893 6.8617 13.7233 0.1278 Constraint 263 657 6.3600 7.9500 15.9001 0.1277 Constraint 756 1046 4.4577 5.5721 11.1443 0.1277 Constraint 479 608 4.3366 5.4208 10.8416 0.1277 Constraint 623 892 4.0947 5.1184 10.2368 0.1276 Constraint 899 1657 5.0195 6.2743 12.5487 0.1276 Constraint 761 955 5.4399 6.7999 13.5998 0.1276 Constraint 82 189 4.1752 5.2190 10.4380 0.1276 Constraint 256 368 6.0238 7.5297 15.0595 0.1275 Constraint 164 630 4.2971 5.3713 10.7426 0.1275 Constraint 818 963 5.2856 6.6069 13.2139 0.1275 Constraint 368 579 4.5152 5.6440 11.2880 0.1273 Constraint 128 1077 3.7358 4.6698 9.3395 0.1272 Constraint 33 104 5.5679 6.9598 13.9196 0.1272 Constraint 530 1374 4.8900 6.1124 12.2249 0.1270 Constraint 501 1054 3.9193 4.8992 9.7983 0.1270 Constraint 333 1092 6.3118 7.8897 15.7794 0.1270 Constraint 333 1084 3.8314 4.7892 9.5784 0.1270 Constraint 333 1059 6.2403 7.8004 15.6008 0.1270 Constraint 196 1141 4.7082 5.8852 11.7704 0.1270 Constraint 189 1533 5.6145 7.0181 14.0362 0.1270 Constraint 154 1587 4.8055 6.0069 12.0139 0.1270 Constraint 1008 1301 6.2109 7.7637 15.5273 0.1270 Constraint 97 299 5.2433 6.5541 13.1081 0.1270 Constraint 1008 1556 5.0622 6.3278 12.6556 0.1270 Constraint 189 479 5.2470 6.5588 13.1176 0.1269 Constraint 859 1213 5.6518 7.0648 14.1296 0.1269 Constraint 698 1193 5.7186 7.1482 14.2964 0.1268 Constraint 392 908 5.6400 7.0500 14.1000 0.1268 Constraint 493 1284 4.8600 6.0750 12.1499 0.1267 Constraint 493 1276 4.6138 5.7673 11.5346 0.1267 Constraint 493 1251 4.7068 5.8836 11.7671 0.1267 Constraint 412 673 5.2860 6.6075 13.2149 0.1267 Constraint 403 673 4.7955 5.9943 11.9887 0.1267 Constraint 630 1059 5.5260 6.9075 13.8149 0.1266 Constraint 403 690 3.9596 4.9495 9.8990 0.1264 Constraint 66 944 5.1966 6.4958 12.9916 0.1264 Constraint 673 1030 4.6293 5.7866 11.5732 0.1264 Constraint 639 1100 5.1225 6.4031 12.8061 0.1264 Constraint 988 1548 5.6435 7.0543 14.1087 0.1264 Constraint 988 1533 4.8221 6.0276 12.0551 0.1264 Constraint 748 1596 4.7778 5.9722 11.9445 0.1263 Constraint 1204 1764 4.3485 5.4356 10.8712 0.1261 Constraint 189 1178 5.9405 7.4257 14.8513 0.1261 Constraint 731 1399 5.6815 7.1019 14.2037 0.1260 Constraint 731 1382 3.0192 3.7740 7.5480 0.1260 Constraint 722 1382 5.4368 6.7960 13.5921 0.1260 Constraint 792 1035 3.7085 4.6356 9.2713 0.1259 Constraint 241 1158 4.2398 5.2998 10.5996 0.1258 Constraint 263 510 4.2074 5.2593 10.5185 0.1258 Constraint 921 1054 4.9230 6.1538 12.3076 0.1257 Constraint 968 1193 4.0113 5.0141 10.0281 0.1257 Constraint 274 1046 6.0176 7.5220 15.0440 0.1257 Constraint 263 1077 4.4045 5.5056 11.0113 0.1257 Constraint 233 1046 5.9393 7.4241 14.8482 0.1257 Constraint 216 1046 5.2565 6.5706 13.1413 0.1257 Constraint 1260 1455 4.7977 5.9971 11.9943 0.1256 Constraint 690 868 4.4229 5.5286 11.0573 0.1256 Constraint 731 876 5.0686 6.3358 12.6716 0.1255 Constraint 868 1204 4.7683 5.9604 11.9208 0.1255 Constraint 1008 1533 5.0647 6.3309 12.6617 0.1255 Constraint 756 1260 5.6512 7.0641 14.1281 0.1254 Constraint 1239 1309 3.8377 4.7972 9.5943 0.1253 Constraint 59 1204 4.9297 6.1621 12.3242 0.1253 Constraint 557 1399 4.7297 5.9121 11.8242 0.1252 Constraint 521 1427 5.4364 6.7955 13.5910 0.1252 Constraint 1109 1301 4.5306 5.6632 11.3264 0.1251 Constraint 510 921 4.7363 5.9203 11.8407 0.1249 Constraint 347 479 5.0186 6.2733 12.5466 0.1249 Constraint 180 294 5.3031 6.6289 13.2577 0.1249 Constraint 783 1466 5.6158 7.0197 14.0394 0.1249 Constraint 1391 1670 4.3084 5.3855 10.7709 0.1248 Constraint 778 1046 3.8647 4.8309 9.6617 0.1247 Constraint 698 1447 5.2058 6.5073 13.0146 0.1247 Constraint 1533 1720 5.5810 6.9762 13.9525 0.1247 Constraint 1382 1678 5.4200 6.7750 13.5501 0.1247 Constraint 216 549 5.2772 6.5965 13.1930 0.1246 Constraint 713 1351 5.5443 6.9304 13.8609 0.1246 Constraint 97 355 5.8412 7.3015 14.6030 0.1246 Constraint 1276 1382 5.8631 7.3288 14.6577 0.1245 Constraint 355 930 4.4970 5.6213 11.2425 0.1243 Constraint 306 1100 4.4950 5.6188 11.2375 0.1243 Constraint 299 1109 4.2378 5.2972 10.5944 0.1243 Constraint 233 1284 4.7796 5.9745 11.9491 0.1243 Constraint 222 1427 5.1076 6.3845 12.7691 0.1243 Constraint 208 1228 5.1816 6.4770 12.9539 0.1243 Constraint 128 1317 4.3930 5.4913 10.9826 0.1243 Constraint 128 937 5.2229 6.5286 13.0572 0.1243 Constraint 908 1556 5.6182 7.0227 14.0454 0.1243 Constraint 128 1239 5.6848 7.1061 14.2121 0.1242 Constraint 249 530 5.3452 6.6814 13.3629 0.1242 Constraint 1494 1567 4.8579 6.0724 12.1448 0.1242 Constraint 285 623 4.4458 5.5573 11.1146 0.1241 Constraint 913 1109 4.9182 6.1477 12.2954 0.1240 Constraint 375 930 4.9120 6.1400 12.2800 0.1240 Constraint 375 921 5.6796 7.0995 14.1991 0.1240 Constraint 347 876 4.8559 6.0699 12.1397 0.1240 Constraint 1014 1567 4.9083 6.1354 12.2708 0.1238 Constraint 899 1149 5.2209 6.5261 13.0521 0.1238 Constraint 572 1008 5.2388 6.5485 13.0970 0.1236 Constraint 968 1777 4.2910 5.3638 10.7276 0.1234 Constraint 944 1777 6.2825 7.8531 15.7062 0.1234 Constraint 756 1455 4.9260 6.1575 12.3149 0.1234 Constraint 739 1014 3.9755 4.9694 9.9388 0.1234 Constraint 216 876 4.6682 5.8353 11.6706 0.1234 Constraint 800 884 4.6887 5.8609 11.7219 0.1234 Constraint 66 196 4.2483 5.3104 10.6208 0.1233 Constraint 121 249 4.8053 6.0066 12.0131 0.1232 Constraint 154 808 5.0419 6.3023 12.6047 0.1232 Constraint 294 589 3.8594 4.8242 9.6484 0.1231 Constraint 368 756 5.2447 6.5559 13.1117 0.1231 Constraint 333 756 4.4782 5.5978 11.1956 0.1231 Constraint 937 1100 5.0973 6.3716 12.7433 0.1231 Constraint 836 1246 4.0801 5.1001 10.2002 0.1231 Constraint 829 1293 5.8014 7.2517 14.5034 0.1231 Constraint 859 968 4.3022 5.3777 10.7555 0.1230 Constraint 97 1479 5.8131 7.2663 14.5327 0.1230 Constraint 639 1109 5.1707 6.4634 12.9268 0.1229 Constraint 241 1447 5.4390 6.7987 13.5974 0.1229 Constraint 859 1251 6.0392 7.5490 15.0980 0.1228 Constraint 1325 1455 4.5170 5.6463 11.2925 0.1228 Constraint 1092 1366 4.0457 5.0571 10.1142 0.1228 Constraint 1084 1366 5.4582 6.8227 13.6455 0.1228 Constraint 479 572 4.7563 5.9454 11.8907 0.1228 Constraint 294 466 4.8643 6.0804 12.1608 0.1228 Constraint 172 306 5.0115 6.2644 12.5287 0.1228 Constraint 227 443 4.8693 6.0866 12.1732 0.1227 Constraint 314 769 4.8058 6.0073 12.0145 0.1226 Constraint 1068 1494 3.8191 4.7739 9.5477 0.1226 Constraint 955 1125 5.3342 6.6678 13.3355 0.1226 Constraint 549 1526 5.3457 6.6821 13.3643 0.1226 Constraint 501 681 5.1791 6.4739 12.9477 0.1226 Constraint 1077 1649 5.4032 6.7540 13.5080 0.1226 Constraint 1408 1611 4.2749 5.3436 10.6873 0.1225 Constraint 623 829 5.5158 6.8947 13.7894 0.1225 Constraint 299 538 4.2180 5.2725 10.5451 0.1225 Constraint 722 1167 5.5520 6.9400 13.8800 0.1224 Constraint 1035 1100 4.7761 5.9701 11.9401 0.1224 Constraint 597 968 5.0918 6.3647 12.7294 0.1223 Constraint 557 884 5.8268 7.2835 14.5670 0.1223 Constraint 783 848 5.4237 6.7796 13.5591 0.1223 Constraint 104 739 3.4358 4.2948 8.5896 0.1223 Constraint 829 1030 5.1432 6.4289 12.8579 0.1222 Constraint 681 1408 4.7238 5.9048 11.8095 0.1222 Constraint 913 1167 5.1568 6.4460 12.8921 0.1221 Constraint 172 608 4.8884 6.1105 12.2210 0.1219 Constraint 673 944 5.4002 6.7503 13.5006 0.1219 Constraint 792 1293 4.7806 5.9758 11.9515 0.1219 Constraint 829 1141 4.7983 5.9979 11.9958 0.1219 Constraint 1014 1158 6.1637 7.7046 15.4092 0.1218 Constraint 859 1117 6.1953 7.7441 15.4883 0.1218 Constraint 778 1678 5.8456 7.3070 14.6139 0.1218 Constraint 673 1008 4.7347 5.9184 11.8367 0.1218 Constraint 429 698 5.2388 6.5485 13.0969 0.1217 Constraint 988 1068 5.7800 7.2250 14.4501 0.1216 Constraint 930 1213 3.6135 4.5169 9.0338 0.1216 Constraint 769 1479 6.0947 7.6183 15.2366 0.1216 Constraint 299 1466 6.0812 7.6015 15.2029 0.1216 Constraint 429 579 5.9372 7.4215 14.8430 0.1215 Constraint 800 1133 5.0874 6.3593 12.7185 0.1215 Constraint 66 355 5.5049 6.8812 13.7623 0.1214 Constraint 968 1158 4.8793 6.0991 12.1983 0.1214 Constraint 1035 1541 5.5466 6.9333 13.8666 0.1214 Constraint 421 963 4.7388 5.9235 11.8470 0.1213 Constraint 384 1014 4.3751 5.4689 10.9377 0.1213 Constraint 363 1014 4.2217 5.2771 10.5542 0.1213 Constraint 355 673 5.1599 6.4498 12.8997 0.1213 Constraint 448 913 5.5319 6.9149 13.8298 0.1213 Constraint 97 306 5.4107 6.7634 13.5268 0.1213 Constraint 836 1556 5.7516 7.1895 14.3791 0.1213 Constraint 557 1125 5.9377 7.4222 14.8443 0.1213 Constraint 172 355 4.3774 5.4717 10.9435 0.1212 Constraint 347 1035 5.7946 7.2433 14.4866 0.1212 Constraint 39 944 5.2410 6.5512 13.1025 0.1212 Constraint 538 859 4.2745 5.3431 10.6862 0.1212 Constraint 1100 1720 5.5446 6.9307 13.8614 0.1212 Constraint 128 241 4.4934 5.6167 11.2334 0.1211 Constraint 818 1084 4.8216 6.0270 12.0540 0.1211 Constraint 1046 1494 3.7956 4.7446 9.4891 0.1210 Constraint 180 1526 4.8533 6.0666 12.1333 0.1210 Constraint 572 997 5.0108 6.2636 12.5271 0.1209 Constraint 690 761 4.3517 5.4396 10.8792 0.1209 Constraint 1391 1519 5.1247 6.4058 12.8116 0.1208 Constraint 713 868 4.9323 6.1653 12.3307 0.1207 Constraint 294 597 4.0056 5.0070 10.0140 0.1207 Constraint 196 818 6.2140 7.7675 15.5349 0.1206 Constraint 1556 1756 5.2568 6.5710 13.1421 0.1206 Constraint 836 1204 6.1300 7.6624 15.3249 0.1206 Constraint 1596 1788 4.4875 5.6094 11.2188 0.1206 Constraint 1158 1334 5.8078 7.2597 14.5195 0.1206 Constraint 921 1548 5.0085 6.2606 12.5212 0.1206 Constraint 256 808 6.2243 7.7804 15.5608 0.1206 Constraint 778 1284 5.1737 6.4672 12.9344 0.1205 Constraint 1141 1408 5.8101 7.2626 14.5253 0.1204 Constraint 1141 1764 4.6331 5.7914 11.5827 0.1204 Constraint 479 639 5.0157 6.2696 12.5392 0.1204 Constraint 263 630 5.8155 7.2693 14.5386 0.1204 Constraint 216 1178 3.4556 4.3195 8.6390 0.1204 Constraint 189 1068 5.3235 6.6544 13.3088 0.1204 Constraint 154 1054 4.2071 5.2589 10.5179 0.1204 Constraint 145 968 5.6145 7.0182 14.0363 0.1204 Constraint 848 1193 5.7869 7.2336 14.4671 0.1203 Constraint 818 1260 5.2458 6.5572 13.1145 0.1203 Constraint 457 713 4.2735 5.3419 10.6838 0.1203 Constraint 347 800 4.3899 5.4874 10.9748 0.1203 Constraint 274 963 5.0565 6.3207 12.6413 0.1203 Constraint 47 466 4.4099 5.5123 11.0247 0.1203 Constraint 39 443 4.1131 5.1414 10.2828 0.1203 Constraint 572 769 4.9277 6.1596 12.3193 0.1202 Constraint 1059 1351 4.8372 6.0464 12.0929 0.1202 Constraint 1193 1408 4.8652 6.0815 12.1631 0.1201 Constraint 783 1670 5.6432 7.0540 14.1080 0.1201 Constraint 690 1239 5.5780 6.9725 13.9451 0.1201 Constraint 908 1374 4.6379 5.7973 11.5947 0.1201 Constraint 968 1620 4.7641 5.9551 11.9102 0.1201 Constraint 1059 1366 4.4771 5.5963 11.1926 0.1201 Constraint 59 739 5.7778 7.2223 14.4446 0.1200 Constraint 59 731 3.9087 4.8859 9.7718 0.1200 Constraint 731 1662 5.5644 6.9555 13.9110 0.1200 Constraint 589 731 4.7247 5.9059 11.8118 0.1200 Constraint 363 616 5.1712 6.4640 12.9281 0.1200 Constraint 274 639 4.6953 5.8691 11.7382 0.1200 Constraint 121 487 3.5902 4.4878 8.9755 0.1200 Constraint 66 1100 5.7527 7.1909 14.3818 0.1200 Constraint 1109 1276 4.8703 6.0878 12.1757 0.1200 Constraint 25 91 4.7816 5.9770 11.9540 0.1199 Constraint 597 681 5.2387 6.5484 13.0969 0.1198 Constraint 769 1447 5.7113 7.1391 14.2783 0.1198 Constraint 783 1408 4.6655 5.8319 11.6638 0.1197 Constraint 876 1167 4.6820 5.8525 11.7050 0.1197 Constraint 963 1178 5.6592 7.0741 14.1481 0.1195 Constraint 180 1408 5.4279 6.7849 13.5698 0.1195 Constraint 1077 1309 4.6885 5.8606 11.7212 0.1195 Constraint 657 1438 5.5198 6.8997 13.7994 0.1195 Constraint 579 859 5.9123 7.3904 14.7808 0.1194 Constraint 66 443 5.0615 6.3269 12.6538 0.1194 Constraint 1030 1092 5.5660 6.9575 13.9150 0.1192 Constraint 739 1284 6.0359 7.5449 15.0899 0.1191 Constraint 479 690 3.5931 4.4913 8.9826 0.1191 Constraint 944 1358 5.0116 6.2644 12.5289 0.1190 Constraint 1084 1408 5.5423 6.9279 13.8558 0.1189 Constraint 538 908 4.6758 5.8447 11.6894 0.1189 Constraint 347 1059 5.3544 6.6930 13.3860 0.1188 Constraint 216 1533 5.1556 6.4445 12.8891 0.1188 Constraint 443 564 4.3959 5.4948 10.9897 0.1187 Constraint 808 1479 4.2631 5.3288 10.6576 0.1187 Constraint 121 263 4.8114 6.0143 12.0285 0.1186 Constraint 1455 1772 6.1223 7.6529 15.3058 0.1185 Constraint 375 549 4.7624 5.9530 11.9059 0.1185 Constraint 713 1343 5.5493 6.9366 13.8731 0.1185 Constraint 681 1374 4.5065 5.6332 11.2663 0.1185 Constraint 66 306 5.2372 6.5465 13.0930 0.1185 Constraint 722 836 5.0801 6.3501 12.7002 0.1184 Constraint 443 597 6.0443 7.5554 15.1108 0.1183 Constraint 180 1556 3.2782 4.0978 8.1956 0.1183 Constraint 180 1533 3.9696 4.9620 9.9240 0.1183 Constraint 623 783 5.3282 6.6603 13.3205 0.1182 Constraint 314 1117 3.6026 4.5033 9.0066 0.1181 Constraint 299 930 4.6102 5.7627 11.5255 0.1181 Constraint 256 1100 4.5087 5.6359 11.2718 0.1181 Constraint 208 538 4.0337 5.0421 10.0842 0.1181 Constraint 180 572 5.6817 7.1022 14.2043 0.1181 Constraint 196 1149 5.7016 7.1270 14.2540 0.1181 Constraint 713 1167 6.1431 7.6789 15.3579 0.1181 Constraint 285 538 4.6949 5.8686 11.7372 0.1180 Constraint 66 241 4.7452 5.9315 11.8630 0.1179 Constraint 665 997 5.5065 6.8832 13.7664 0.1178 Constraint 403 549 5.6584 7.0730 14.1460 0.1178 Constraint 1158 1293 5.0935 6.3669 12.7338 0.1178 Constraint 899 1268 4.5809 5.7261 11.4522 0.1178 Constraint 892 968 5.3572 6.6966 13.3931 0.1178 Constraint 208 435 5.7440 7.1800 14.3599 0.1178 Constraint 808 1317 4.9810 6.2263 12.4526 0.1177 Constraint 538 1117 5.9522 7.4403 14.8806 0.1177 Constraint 121 256 4.3367 5.4208 10.8417 0.1177 Constraint 104 274 6.1324 7.6655 15.3310 0.1177 Constraint 1471 1720 5.4845 6.8557 13.7114 0.1177 Constraint 944 1731 5.3460 6.6825 13.3650 0.1175 Constraint 549 713 3.8078 4.7598 9.5195 0.1175 Constraint 448 564 4.3082 5.3852 10.7704 0.1175 Constraint 121 392 6.1582 7.6978 15.3956 0.1175 Constraint 1634 1739 5.7454 7.1818 14.3636 0.1175 Constraint 1246 1683 5.6926 7.1157 14.2314 0.1175 Constraint 314 589 4.4492 5.5615 11.1231 0.1175 Constraint 792 1438 5.1324 6.4155 12.8310 0.1174 Constraint 1008 1268 5.5357 6.9196 13.8393 0.1174 Constraint 368 510 5.7344 7.1679 14.3359 0.1174 Constraint 1301 1447 6.0388 7.5485 15.0969 0.1173 Constraint 1587 1703 4.5624 5.7030 11.4060 0.1172 Constraint 783 884 5.2203 6.5254 13.0508 0.1172 Constraint 1204 1788 3.9136 4.8919 9.7839 0.1172 Constraint 1204 1756 3.8695 4.8369 9.6739 0.1172 Constraint 216 1022 5.6100 7.0125 14.0250 0.1172 Constraint 216 739 4.7595 5.9494 11.8988 0.1172 Constraint 145 657 3.9723 4.9654 9.9308 0.1172 Constraint 136 657 3.6349 4.5436 9.0872 0.1172 Constraint 510 944 5.3909 6.7386 13.4772 0.1171 Constraint 1301 1399 5.3826 6.7282 13.4564 0.1170 Constraint 77 274 5.4009 6.7512 13.5024 0.1170 Constraint 876 1301 4.9223 6.1529 12.3057 0.1169 Constraint 249 739 3.7847 4.7308 9.4617 0.1169 Constraint 241 739 4.5696 5.7120 11.4240 0.1169 Constraint 164 836 6.2025 7.7531 15.5063 0.1169 Constraint 66 913 5.9547 7.4433 14.8866 0.1168 Constraint 538 997 4.4843 5.6053 11.2107 0.1167 Constraint 392 739 5.1985 6.4981 12.9962 0.1164 Constraint 997 1251 3.7282 4.6603 9.3206 0.1164 Constraint 968 1284 3.9163 4.8954 9.7908 0.1164 Constraint 937 1309 4.4213 5.5267 11.0533 0.1164 Constraint 285 412 4.4879 5.6099 11.2199 0.1163 Constraint 1046 1239 5.9976 7.4970 14.9939 0.1163 Constraint 403 930 4.2669 5.3336 10.6672 0.1163 Constraint 921 1374 4.9560 6.1951 12.3901 0.1161 Constraint 722 1117 5.9699 7.4624 14.9248 0.1161 Constraint 783 913 4.3578 5.4473 10.8946 0.1161 Constraint 66 180 5.2278 6.5348 13.0695 0.1161 Constraint 639 1133 4.4458 5.5572 11.1144 0.1161 Constraint 616 698 5.8516 7.3145 14.6290 0.1161 Constraint 608 1133 4.9757 6.2196 12.4393 0.1161 Constraint 530 1228 5.3097 6.6372 13.2744 0.1161 Constraint 164 1488 5.6623 7.0779 14.1557 0.1161 Constraint 392 549 4.3586 5.4482 10.8964 0.1160 Constraint 368 549 4.8743 6.0929 12.1858 0.1160 Constraint 778 1092 5.6968 7.1210 14.2420 0.1160 Constraint 375 597 4.8547 6.0683 12.1367 0.1160 Constraint 937 1022 5.1413 6.4266 12.8532 0.1159 Constraint 180 1567 6.1163 7.6454 15.2908 0.1159 Constraint 589 1149 6.2299 7.7873 15.5746 0.1158 Constraint 59 937 4.8362 6.0453 12.0906 0.1158 Constraint 1325 1620 5.4306 6.7882 13.5765 0.1158 Constraint 739 1260 5.1663 6.4579 12.9157 0.1158 Constraint 836 1239 4.9054 6.1318 12.2636 0.1158 Constraint 690 1471 4.7756 5.9694 11.9389 0.1158 Constraint 665 1046 3.9329 4.9161 9.8322 0.1158 Constraint 136 608 5.3608 6.7010 13.4020 0.1158 Constraint 876 1268 3.7758 4.7197 9.4394 0.1157 Constraint 368 876 4.5365 5.6706 11.3412 0.1157 Constraint 263 1471 5.0748 6.3435 12.6871 0.1155 Constraint 104 306 5.3478 6.6847 13.3694 0.1155 Constraint 1035 1438 5.4561 6.8201 13.6402 0.1155 Constraint 241 1141 5.3768 6.7209 13.4419 0.1155 Constraint 650 1035 4.8138 6.0172 12.0344 0.1154 Constraint 164 249 5.0695 6.3368 12.6737 0.1154 Constraint 325 429 5.2942 6.6177 13.2355 0.1154 Constraint 412 1046 4.7319 5.9149 11.8297 0.1153 Constraint 572 1035 4.7995 5.9994 11.9987 0.1152 Constraint 589 698 5.4266 6.7832 13.5665 0.1152 Constraint 1046 1133 5.9510 7.4387 14.8774 0.1152 Constraint 579 1117 3.6059 4.5073 9.0146 0.1152 Constraint 579 1109 5.3770 6.7213 13.4426 0.1152 Constraint 1125 1479 5.9287 7.4109 14.8218 0.1151 Constraint 429 769 5.5478 6.9348 13.8696 0.1151 Constraint 421 630 4.9373 6.1716 12.3433 0.1151 Constraint 306 403 4.6396 5.7994 11.5989 0.1151 Constraint 121 657 5.0319 6.2899 12.5799 0.1151 Constraint 33 172 5.5418 6.9273 13.8546 0.1151 Constraint 59 930 5.4220 6.7776 13.5551 0.1151 Constraint 493 1438 4.7143 5.8929 11.7858 0.1149 Constraint 216 1567 4.9574 6.1968 12.3936 0.1149 Constraint 530 1556 5.7860 7.2325 14.4649 0.1148 Constraint 681 848 4.1205 5.1506 10.3011 0.1148 Constraint 392 731 5.0393 6.2991 12.5983 0.1148 Constraint 698 1035 4.1331 5.1663 10.3327 0.1148 Constraint 1158 1246 4.7448 5.9310 11.8619 0.1148 Constraint 493 944 5.7915 7.2393 14.4787 0.1147 Constraint 783 1438 5.5963 6.9954 13.9908 0.1147 Constraint 1276 1438 5.8141 7.2676 14.5352 0.1147 Constraint 1059 1511 5.5832 6.9790 13.9580 0.1147 Constraint 681 1427 4.5134 5.6417 11.2834 0.1147 Constraint 681 1391 5.9310 7.4138 14.8276 0.1147 Constraint 589 739 5.0574 6.3217 12.6435 0.1147 Constraint 227 778 4.6669 5.8336 11.6673 0.1147 Constraint 222 739 5.4975 6.8718 13.7436 0.1147 Constraint 121 479 6.2105 7.7632 15.5263 0.1147 Constraint 1014 1756 5.2645 6.5806 13.1612 0.1147 Constraint 1014 1748 5.6550 7.0687 14.1374 0.1147 Constraint 800 1100 4.9029 6.1287 12.2573 0.1146 Constraint 748 1092 6.0461 7.5576 15.1152 0.1146 Constraint 859 1239 5.2013 6.5016 13.0033 0.1145 Constraint 623 1479 5.8060 7.2575 14.5150 0.1145 Constraint 589 1447 5.7272 7.1589 14.3179 0.1145 Constraint 589 1438 5.2713 6.5892 13.1783 0.1145 Constraint 189 792 4.3696 5.4619 10.9239 0.1145 Constraint 829 1059 3.7060 4.6326 9.2651 0.1143 Constraint 988 1596 6.2712 7.8390 15.6780 0.1143 Constraint 216 403 5.6644 7.0805 14.1611 0.1143 Constraint 698 937 5.4279 6.7849 13.5697 0.1143 Constraint 731 921 4.6586 5.8232 11.6465 0.1143 Constraint 443 808 5.1566 6.4457 12.8915 0.1142 Constraint 589 836 4.1949 5.2436 10.4872 0.1142 Constraint 1077 1596 4.3370 5.4213 10.8426 0.1141 Constraint 1438 1772 4.6302 5.7878 11.5755 0.1140 Constraint 154 1035 5.9808 7.4759 14.9519 0.1140 Constraint 1408 1720 6.0191 7.5239 15.0478 0.1140 Constraint 800 1391 6.2573 7.8216 15.6432 0.1140 Constraint 549 1167 4.5327 5.6659 11.3318 0.1140 Constraint 429 829 4.7589 5.9486 11.8972 0.1139 Constraint 783 997 5.6134 7.0167 14.0334 0.1138 Constraint 681 1030 4.9319 6.1649 12.3297 0.1138 Constraint 608 963 4.9121 6.1402 12.2804 0.1137 Constraint 1149 1268 5.1693 6.4616 12.9233 0.1137 Constraint 97 608 5.9011 7.3764 14.7528 0.1137 Constraint 457 800 5.7082 7.1353 14.2705 0.1137 Constraint 1488 1567 5.0443 6.3054 12.6108 0.1136 Constraint 829 1541 5.0638 6.3298 12.6595 0.1136 Constraint 848 1399 5.7936 7.2421 14.4841 0.1135 Constraint 363 739 4.4953 5.6191 11.2383 0.1135 Constraint 572 829 4.5411 5.6763 11.3526 0.1135 Constraint 1149 1293 4.4506 5.5632 11.1264 0.1134 Constraint 968 1268 4.8768 6.0960 12.1920 0.1134 Constraint 1092 1511 5.5077 6.8847 13.7693 0.1134 Constraint 836 1284 6.0370 7.5463 15.0926 0.1133 Constraint 3 1035 4.2248 5.2810 10.5619 0.1133 Constraint 1251 1649 5.5779 6.9724 13.9448 0.1132 Constraint 937 1351 4.0936 5.1170 10.2341 0.1132 Constraint 937 1334 4.7414 5.9267 11.8534 0.1132 Constraint 530 1293 6.2881 7.8601 15.7203 0.1132 Constraint 154 1260 4.3237 5.4046 10.8093 0.1132 Constraint 208 630 4.4704 5.5880 11.1759 0.1132 Constraint 333 913 5.2095 6.5118 13.0237 0.1132 Constraint 457 913 5.7973 7.2467 14.4933 0.1130 Constraint 829 1022 5.0669 6.3336 12.6672 0.1130 Constraint 597 756 4.9896 6.2370 12.4739 0.1130 Constraint 748 1133 6.0018 7.5022 15.0045 0.1129 Constraint 848 1416 5.9342 7.4177 14.8354 0.1129 Constraint 1084 1416 5.6251 7.0314 14.0628 0.1128 Constraint 639 963 4.8896 6.1120 12.2239 0.1127 Constraint 1567 1692 4.6755 5.8443 11.6887 0.1127 Constraint 1471 1756 5.5463 6.9328 13.8656 0.1126 Constraint 189 913 5.1800 6.4750 12.9500 0.1125 Constraint 1022 1703 5.2062 6.5078 13.0156 0.1125 Constraint 1503 1731 5.9247 7.4059 14.8119 0.1124 Constraint 368 769 5.3248 6.6560 13.3119 0.1124 Constraint 1228 1494 4.0726 5.0908 10.1816 0.1123 Constraint 731 868 4.9340 6.1675 12.3351 0.1123 Constraint 564 1133 4.1292 5.1615 10.3231 0.1123 Constraint 564 1100 4.7788 5.9736 11.9471 0.1123 Constraint 564 848 5.3610 6.7013 13.4026 0.1123 Constraint 493 706 6.0489 7.5612 15.1223 0.1123 Constraint 172 1455 6.2467 7.8083 15.6167 0.1123 Constraint 77 876 5.8377 7.2971 14.5941 0.1123 Constraint 25 892 5.0775 6.3468 12.6937 0.1123 Constraint 25 876 5.8948 7.3685 14.7371 0.1123 Constraint 1059 1284 5.3502 6.6878 13.3755 0.1123 Constraint 233 368 4.9592 6.1991 12.3981 0.1123 Constraint 665 908 5.1100 6.3875 12.7750 0.1122 Constraint 263 1158 5.9584 7.4480 14.8961 0.1121 Constraint 145 930 5.3188 6.6486 13.2971 0.1121 Constraint 121 722 5.1388 6.4235 12.8469 0.1121 Constraint 97 722 5.0532 6.3165 12.6331 0.1121 Constraint 1246 1366 3.9932 4.9915 9.9830 0.1120 Constraint 1455 1620 3.6447 4.5558 9.1117 0.1120 Constraint 944 1178 3.5704 4.4630 8.9259 0.1120 Constraint 1466 1556 5.6655 7.0818 14.1637 0.1120 Constraint 1374 1488 5.8668 7.3335 14.6670 0.1120 Constraint 1366 1488 6.0181 7.5226 15.0453 0.1120 Constraint 681 1438 5.9922 7.4903 14.9806 0.1120 Constraint 368 448 5.7357 7.1696 14.3393 0.1120 Constraint 347 1008 4.5442 5.6803 11.3605 0.1120 Constraint 347 616 5.0558 6.3197 12.6394 0.1120 Constraint 333 443 6.1764 7.7205 15.4411 0.1120 Constraint 306 530 3.9956 4.9946 9.9891 0.1120 Constraint 154 673 6.0166 7.5208 15.0415 0.1120 Constraint 82 997 5.3604 6.7005 13.4009 0.1120 Constraint 82 963 5.0848 6.3560 12.7120 0.1120 Constraint 25 1008 5.9528 7.4410 14.8821 0.1120 Constraint 639 1008 5.0537 6.3172 12.6343 0.1120 Constraint 836 1678 4.0575 5.0719 10.1437 0.1120 Constraint 808 1678 4.6649 5.8312 11.6623 0.1120 Constraint 792 921 3.5827 4.4784 8.9568 0.1120 Constraint 731 988 4.7205 5.9006 11.8011 0.1120 Constraint 501 1239 4.5374 5.6717 11.3434 0.1120 Constraint 690 1317 4.3803 5.4754 10.9508 0.1119 Constraint 66 921 5.5762 6.9703 13.9405 0.1119 Constraint 256 549 5.2226 6.5282 13.0565 0.1119 Constraint 1213 1575 4.6463 5.8079 11.6157 0.1119 Constraint 333 608 5.6912 7.1140 14.2280 0.1119 Constraint 448 589 5.5815 6.9769 13.9538 0.1118 Constraint 963 1046 4.7439 5.9298 11.8597 0.1118 Constraint 1358 1526 4.3320 5.4150 10.8299 0.1118 Constraint 538 988 5.4366 6.7957 13.5915 0.1117 Constraint 884 1503 5.2411 6.5514 13.1028 0.1117 Constraint 597 1092 5.7654 7.2067 14.4135 0.1117 Constraint 639 836 4.6518 5.8148 11.6296 0.1117 Constraint 384 572 5.8076 7.2595 14.5190 0.1116 Constraint 859 1100 5.9379 7.4224 14.8448 0.1116 Constraint 673 980 5.3039 6.6299 13.2599 0.1116 Constraint 921 1046 5.5336 6.9170 13.8341 0.1116 Constraint 112 233 5.1153 6.3941 12.7882 0.1116 Constraint 1213 1438 5.0532 6.3165 12.6330 0.1115 Constraint 493 921 4.1936 5.2420 10.4841 0.1115 Constraint 233 673 4.2453 5.3066 10.6133 0.1115 Constraint 233 665 4.5027 5.6284 11.2567 0.1115 Constraint 18 1054 5.0154 6.2693 12.5385 0.1114 Constraint 1471 1548 4.6888 5.8610 11.7221 0.1113 Constraint 208 1239 5.9907 7.4884 14.9767 0.1112 Constraint 769 1059 4.9603 6.2004 12.4007 0.1112 Constraint 761 1059 3.5788 4.4735 8.9470 0.1112 Constraint 1358 1756 4.8363 6.0454 12.0909 0.1111 Constraint 1260 1466 4.3458 5.4323 10.8646 0.1111 Constraint 639 848 4.3725 5.4656 10.9313 0.1111 Constraint 325 1204 4.8297 6.0372 12.0743 0.1111 Constraint 91 538 6.3406 7.9257 15.8514 0.1111 Constraint 1268 1556 4.3642 5.4553 10.9106 0.1111 Constraint 868 1054 5.0435 6.3043 12.6086 0.1110 Constraint 412 800 5.3946 6.7432 13.4864 0.1110 Constraint 368 884 5.0176 6.2720 12.5439 0.1110 Constraint 1503 1596 5.5384 6.9229 13.8459 0.1109 Constraint 1471 1620 4.8230 6.0288 12.0575 0.1109 Constraint 487 1077 4.9263 6.1578 12.3157 0.1109 Constraint 597 1466 4.3596 5.4495 10.8989 0.1108 Constraint 208 294 5.1999 6.4998 12.9997 0.1108 Constraint 47 421 4.6823 5.8529 11.7058 0.1106 Constraint 1408 1731 6.0128 7.5161 15.0321 0.1106 Constraint 937 1193 3.4913 4.3642 8.7284 0.1106 Constraint 222 1158 6.1272 7.6590 15.3180 0.1106 Constraint 128 1046 5.3729 6.7161 13.4322 0.1106 Constraint 172 448 5.8490 7.3112 14.6224 0.1104 Constraint 1141 1634 5.2093 6.5116 13.0232 0.1103 Constraint 368 980 6.0484 7.5604 15.1209 0.1102 Constraint 930 1167 4.9583 6.1979 12.3957 0.1102 Constraint 274 549 4.7387 5.9234 11.8468 0.1102 Constraint 1109 1548 5.3947 6.7433 13.4867 0.1101 Constraint 739 1382 6.1771 7.7213 15.4427 0.1101 Constraint 363 435 4.0116 5.0145 10.0289 0.1101 Constraint 800 1059 5.1804 6.4754 12.9509 0.1100 Constraint 1092 1391 3.8141 4.7676 9.5351 0.1100 Constraint 1059 1391 4.4865 5.6082 11.2163 0.1100 Constraint 1213 1596 4.8377 6.0471 12.0942 0.1099 Constraint 1374 1731 4.9899 6.2374 12.4748 0.1099 Constraint 572 1133 5.0136 6.2670 12.5340 0.1099 Constraint 557 1251 5.7605 7.2006 14.4011 0.1099 Constraint 557 1228 4.3285 5.4106 10.8212 0.1099 Constraint 466 1068 5.6048 7.0060 14.0121 0.1099 Constraint 274 1366 4.8902 6.1128 12.2256 0.1099 Constraint 222 1276 5.3871 6.7339 13.4679 0.1099 Constraint 208 1427 5.8256 7.2820 14.5641 0.1099 Constraint 208 1276 5.9845 7.4806 14.9612 0.1099 Constraint 196 1466 4.2244 5.2805 10.5610 0.1099 Constraint 196 1427 4.7354 5.9193 11.8386 0.1099 Constraint 196 1334 5.7232 7.1539 14.3079 0.1099 Constraint 196 1276 4.5365 5.6706 11.3412 0.1099 Constraint 172 1519 5.7130 7.1413 14.2825 0.1099 Constraint 216 510 5.5094 6.8867 13.7734 0.1098 Constraint 913 1317 5.3491 6.6864 13.3727 0.1098 Constraint 1526 1720 5.5292 6.9115 13.8230 0.1098 Constraint 375 980 4.0330 5.0412 10.0824 0.1096 Constraint 355 980 5.1465 6.4331 12.8662 0.1096 Constraint 189 739 5.8423 7.3029 14.6058 0.1096 Constraint 189 706 5.0822 6.3527 12.7054 0.1096 Constraint 97 1541 4.4101 5.5126 11.0252 0.1096 Constraint 980 1567 4.8164 6.0205 12.0411 0.1095 Constraint 1325 1692 4.7105 5.8881 11.7763 0.1094 Constraint 1149 1358 6.2679 7.8349 15.6699 0.1094 Constraint 294 690 5.7613 7.2016 14.4032 0.1094 Constraint 1239 1325 5.3026 6.6283 13.2566 0.1094 Constraint 616 859 5.1657 6.4571 12.9142 0.1094 Constraint 761 1293 4.3307 5.4134 10.8268 0.1094 Constraint 1416 1587 5.4042 6.7552 13.5105 0.1093 Constraint 47 196 4.9325 6.1656 12.3313 0.1092 Constraint 1239 1494 4.1688 5.2109 10.4219 0.1092 Constraint 623 731 4.3063 5.3829 10.7659 0.1092 Constraint 501 657 4.5803 5.7254 11.4507 0.1092 Constraint 263 681 4.7882 5.9853 11.9706 0.1092 Constraint 180 1309 5.7956 7.2445 14.4890 0.1092 Constraint 294 608 4.3912 5.4890 10.9781 0.1092 Constraint 412 501 5.6529 7.0662 14.1323 0.1092 Constraint 392 608 5.6387 7.0484 14.0967 0.1092 Constraint 241 859 5.4159 6.7699 13.5397 0.1091 Constraint 104 196 5.0991 6.3738 12.7476 0.1091 Constraint 363 868 5.7487 7.1859 14.3718 0.1091 Constraint 722 1447 5.3339 6.6674 13.3348 0.1090 Constraint 1239 1416 5.2267 6.5334 13.0668 0.1090 Constraint 39 1014 5.1849 6.4811 12.9623 0.1089 Constraint 363 510 5.1464 6.4331 12.8661 0.1089 Constraint 1220 1309 4.6081 5.7601 11.5202 0.1089 Constraint 549 756 5.0861 6.3576 12.7153 0.1089 Constraint 1054 1511 5.7758 7.2197 14.4394 0.1089 Constraint 164 859 3.9013 4.8767 9.7534 0.1089 Constraint 412 538 5.4598 6.8248 13.6495 0.1087 Constraint 722 1596 5.7858 7.2322 14.4645 0.1087 Constraint 713 1596 5.6560 7.0700 14.1399 0.1087 Constraint 848 1260 5.9190 7.3987 14.7974 0.1086 Constraint 1683 1756 5.7180 7.1475 14.2951 0.1086 Constraint 1059 1251 6.3161 7.8951 15.7903 0.1086 Constraint 579 1703 6.3891 7.9864 15.9728 0.1086 Constraint 557 1756 6.2243 7.7804 15.5609 0.1086 Constraint 557 1731 4.9929 6.2412 12.4823 0.1086 Constraint 549 1703 4.0730 5.0912 10.1824 0.1086 Constraint 549 1678 5.0996 6.3746 12.7491 0.1086 Constraint 530 1731 5.4359 6.7948 13.5897 0.1086 Constraint 521 1731 5.0186 6.2733 12.5466 0.1086 Constraint 521 1720 6.0872 7.6090 15.2180 0.1086 Constraint 466 1228 5.9909 7.4886 14.9771 0.1086 Constraint 1276 1399 4.8391 6.0489 12.0977 0.1085 Constraint 1193 1301 5.6164 7.0206 14.0411 0.1084 Constraint 673 808 5.1822 6.4777 12.9555 0.1084 Constraint 616 892 4.6914 5.8642 11.7285 0.1084 Constraint 1575 1692 5.0581 6.3226 12.6453 0.1083 Constraint 172 285 5.2527 6.5659 13.1317 0.1083 Constraint 443 997 5.1333 6.4166 12.8333 0.1083 Constraint 172 363 4.9662 6.2078 12.4155 0.1082 Constraint 1100 1351 5.7762 7.2203 14.4406 0.1081 Constraint 1158 1731 4.8558 6.0697 12.1395 0.1081 Constraint 783 1141 5.0888 6.3610 12.7221 0.1080 Constraint 963 1596 5.1182 6.3978 12.7956 0.1080 Constraint 761 876 4.2647 5.3309 10.6618 0.1080 Constraint 59 128 5.6966 7.1208 14.2415 0.1080 Constraint 937 1447 5.4522 6.8153 13.6305 0.1079 Constraint 761 968 5.5866 6.9832 13.9664 0.1078 Constraint 836 997 4.4800 5.5999 11.1999 0.1078 Constraint 1059 1519 4.8675 6.0844 12.1687 0.1077 Constraint 448 639 5.6530 7.0663 14.1326 0.1076 Constraint 429 963 6.0076 7.5095 15.0189 0.1076 Constraint 630 1158 5.1210 6.4013 12.8026 0.1075 Constraint 128 623 4.4032 5.5040 11.0080 0.1075 Constraint 913 988 5.4132 6.7666 13.5331 0.1075 Constraint 836 1479 3.9350 4.9188 9.8375 0.1075 Constraint 698 944 4.6730 5.8412 11.6824 0.1075 Constraint 690 1100 4.0946 5.1182 10.2364 0.1075 Constraint 263 818 5.3321 6.6652 13.3304 0.1075 Constraint 1046 1301 5.1277 6.4096 12.8192 0.1075 Constraint 792 1284 4.8750 6.0938 12.1876 0.1075 Constraint 59 274 5.0301 6.2876 12.5751 0.1074 Constraint 521 930 6.0119 7.5149 15.0298 0.1074 Constraint 294 748 6.0985 7.6231 15.2463 0.1074 Constraint 530 1204 5.4687 6.8358 13.6717 0.1074 Constraint 868 1014 5.7678 7.2098 14.4196 0.1073 Constraint 657 1317 5.6015 7.0019 14.0038 0.1073 Constraint 572 1054 5.2616 6.5770 13.1540 0.1073 Constraint 913 1158 3.8443 4.8054 9.6107 0.1072 Constraint 908 1158 6.2841 7.8551 15.7102 0.1072 Constraint 25 104 6.1545 7.6931 15.3863 0.1072 Constraint 836 1575 5.7506 7.1883 14.3766 0.1072 Constraint 818 1575 5.3234 6.6543 13.3086 0.1072 Constraint 154 1503 4.0264 5.0330 10.0659 0.1071 Constraint 145 1471 5.0050 6.2563 12.5126 0.1071 Constraint 128 1471 4.3669 5.4586 10.9173 0.1071 Constraint 731 1447 5.3487 6.6859 13.3717 0.1071 Constraint 808 1141 4.2685 5.3357 10.6713 0.1070 Constraint 145 665 4.7768 5.9710 11.9420 0.1070 Constraint 82 589 3.9490 4.9363 9.8725 0.1070 Constraint 1046 1141 4.7964 5.9955 11.9909 0.1069 Constraint 564 868 5.8650 7.3312 14.6624 0.1069 Constraint 112 196 4.8120 6.0150 12.0300 0.1069 Constraint 1193 1325 4.8543 6.0679 12.1358 0.1067 Constraint 249 435 3.9698 4.9623 9.9245 0.1067 Constraint 1325 1466 5.7810 7.2263 14.4525 0.1066 Constraint 249 1117 5.1893 6.4866 12.9732 0.1066 Constraint 403 538 4.3914 5.4893 10.9786 0.1066 Constraint 1246 1374 4.3834 5.4792 10.9584 0.1066 Constraint 421 549 4.8020 6.0025 12.0049 0.1066 Constraint 1167 1548 5.5262 6.9077 13.8155 0.1066 Constraint 1301 1416 4.7614 5.9518 11.9036 0.1065 Constraint 1100 1334 5.1198 6.3998 12.7996 0.1064 Constraint 77 306 5.6559 7.0699 14.1398 0.1064 Constraint 884 1596 6.1175 7.6469 15.2938 0.1063 Constraint 1068 1325 4.7076 5.8845 11.7690 0.1063 Constraint 1046 1358 3.9206 4.9007 9.8014 0.1063 Constraint 1022 1382 4.6892 5.8615 11.7231 0.1063 Constraint 1351 1471 4.8049 6.0061 12.0121 0.1063 Constraint 227 314 4.4050 5.5063 11.0125 0.1063 Constraint 1068 1351 5.0172 6.2715 12.5430 0.1063 Constraint 1494 1756 4.8748 6.0935 12.1870 0.1062 Constraint 1228 1382 5.9555 7.4444 14.8887 0.1062 Constraint 1228 1358 5.7263 7.1579 14.3158 0.1062 Constraint 1193 1447 4.9991 6.2488 12.4976 0.1062 Constraint 1193 1416 4.0344 5.0430 10.0861 0.1062 Constraint 1193 1382 4.8505 6.0631 12.1262 0.1062 Constraint 1008 1178 4.1230 5.1538 10.3076 0.1062 Constraint 930 1678 5.3088 6.6361 13.2721 0.1062 Constraint 930 1657 4.6155 5.7694 11.5388 0.1062 Constraint 899 1678 5.7859 7.2323 14.4646 0.1062 Constraint 892 1213 5.3156 6.6445 13.2891 0.1062 Constraint 884 1284 3.7359 4.6698 9.3396 0.1062 Constraint 859 1276 3.4945 4.3681 8.7362 0.1062 Constraint 848 1293 5.5830 6.9788 13.9575 0.1062 Constraint 848 1284 5.5454 6.9317 13.8635 0.1062 Constraint 848 1276 3.0035 3.7544 7.5088 0.1062 Constraint 836 1731 5.1533 6.4416 12.8832 0.1062 Constraint 836 1276 6.1154 7.6443 15.2886 0.1062 Constraint 829 1251 3.7266 4.6583 9.3166 0.1062 Constraint 829 1204 4.1233 5.1541 10.3082 0.1062 Constraint 829 1158 5.9257 7.4072 14.8143 0.1062 Constraint 818 1276 6.1812 7.7264 15.4529 0.1062 Constraint 808 1246 5.4486 6.8108 13.6215 0.1062 Constraint 808 1220 4.5704 5.7130 11.4259 0.1062 Constraint 800 1343 5.3169 6.6462 13.2923 0.1062 Constraint 792 1678 6.0941 7.6176 15.2352 0.1062 Constraint 783 1683 5.5794 6.9743 13.9486 0.1062 Constraint 778 1220 5.1043 6.3803 12.7607 0.1062 Constraint 761 1678 5.6363 7.0454 14.0907 0.1062 Constraint 487 859 5.9411 7.4264 14.8529 0.1062 Constraint 435 1084 5.4452 6.8065 13.6131 0.1062 Constraint 412 1117 6.2078 7.7597 15.5195 0.1062 Constraint 412 1109 3.9956 4.9945 9.9891 0.1062 Constraint 412 769 5.7155 7.1443 14.2887 0.1062 Constraint 412 713 5.4370 6.7962 13.5925 0.1062 Constraint 227 1260 4.6280 5.7850 11.5699 0.1062 Constraint 208 1293 5.7958 7.2447 14.4894 0.1062 Constraint 128 249 5.6980 7.1226 14.2451 0.1062 Constraint 97 263 5.5034 6.8792 13.7584 0.1062 Constraint 47 208 5.8966 7.3708 14.7415 0.1062 Constraint 3 77 4.2252 5.2815 10.5630 0.1062 Constraint 1158 1548 5.2413 6.5517 13.1033 0.1062 Constraint 1334 1662 4.8272 6.0340 12.0681 0.1062 Constraint 792 1030 5.2117 6.5146 13.0293 0.1062 Constraint 792 1022 5.6403 7.0504 14.1007 0.1062 Constraint 698 1059 5.7068 7.1335 14.2669 0.1062 Constraint 968 1416 5.5408 6.9260 13.8520 0.1060 Constraint 1149 1519 5.8852 7.3565 14.7129 0.1059 Constraint 1022 1366 5.9207 7.4009 14.8017 0.1059 Constraint 698 968 4.5663 5.7078 11.4157 0.1059 Constraint 164 589 5.4451 6.8064 13.6129 0.1058 Constraint 1479 1587 3.5058 4.3822 8.7645 0.1058 Constraint 572 899 4.4047 5.5059 11.0118 0.1057 Constraint 778 899 5.6291 7.0363 14.0727 0.1057 Constraint 681 836 5.1024 6.3780 12.7559 0.1057 Constraint 681 829 3.9965 4.9957 9.9913 0.1057 Constraint 748 1541 6.0344 7.5430 15.0859 0.1057 Constraint 783 1167 4.8148 6.0184 12.0369 0.1057 Constraint 1519 1657 4.5442 5.6802 11.3604 0.1056 Constraint 1030 1133 5.8148 7.2685 14.5370 0.1056 Constraint 1213 1603 4.1071 5.1339 10.2677 0.1056 Constraint 944 1228 4.4652 5.5815 11.1630 0.1055 Constraint 375 690 5.1821 6.4776 12.9552 0.1055 Constraint 698 1416 5.0384 6.2980 12.5960 0.1055 Constraint 347 435 5.5005 6.8757 13.7513 0.1055 Constraint 403 913 4.0889 5.1111 10.2222 0.1054 Constraint 368 937 4.0387 5.0484 10.0967 0.1054 Constraint 1519 1620 5.0490 6.3113 12.6225 0.1053 Constraint 368 557 4.0898 5.1122 10.2244 0.1053 Constraint 421 510 5.7051 7.1314 14.2628 0.1053 Constraint 1084 1455 3.7335 4.6668 9.3337 0.1052 Constraint 639 899 5.0466 6.3082 12.6165 0.1052 Constraint 510 616 5.6756 7.0945 14.1890 0.1052 Constraint 690 963 5.4382 6.7978 13.5955 0.1052 Constraint 501 597 5.8234 7.2792 14.5585 0.1052 Constraint 448 690 4.5999 5.7499 11.4998 0.1052 Constraint 59 1077 5.2636 6.5795 13.1589 0.1051 Constraint 429 800 4.5873 5.7341 11.4681 0.1051 Constraint 681 1022 5.7909 7.2386 14.4772 0.1050 Constraint 589 792 5.5182 6.8977 13.7954 0.1050 Constraint 530 913 4.3337 5.4171 10.8342 0.1050 Constraint 1133 1416 5.2977 6.6222 13.2443 0.1050 Constraint 756 1416 5.7696 7.2120 14.4240 0.1049 Constraint 748 1416 5.0287 6.2858 12.5717 0.1049 Constraint 227 572 4.9254 6.1567 12.3134 0.1049 Constraint 713 1035 5.6021 7.0026 14.0053 0.1049 Constraint 227 306 4.0767 5.0958 10.1916 0.1049 Constraint 59 1587 6.3251 7.9064 15.8129 0.1048 Constraint 756 1117 4.5870 5.7337 11.4674 0.1047 Constraint 11 1022 5.4449 6.8061 13.6121 0.1046 Constraint 538 836 4.9835 6.2293 12.4586 0.1046 Constraint 448 557 4.9815 6.2269 12.4537 0.1046 Constraint 761 892 4.0709 5.0887 10.1774 0.1045 Constraint 77 294 4.4078 5.5098 11.0195 0.1045 Constraint 77 263 4.1524 5.1905 10.3809 0.1045 Constraint 47 233 4.7695 5.9618 11.9237 0.1045 Constraint 657 1054 5.5545 6.9431 13.8863 0.1045 Constraint 412 479 5.4360 6.7950 13.5900 0.1044 Constraint 579 1054 5.3840 6.7300 13.4600 0.1044 Constraint 1309 1678 4.0175 5.0219 10.0439 0.1044 Constraint 510 1030 5.9093 7.3867 14.7734 0.1044 Constraint 479 1035 4.6034 5.7543 11.5086 0.1044 Constraint 355 487 4.8807 6.1009 12.2018 0.1044 Constraint 189 1596 4.2560 5.3200 10.6401 0.1044 Constraint 859 1519 5.1273 6.4092 12.8183 0.1043 Constraint 1511 1720 4.7384 5.9230 11.8460 0.1043 Constraint 97 274 6.0850 7.6062 15.2125 0.1043 Constraint 968 1100 3.3030 4.1288 8.2576 0.1043 Constraint 299 501 5.5950 6.9938 13.9876 0.1042 Constraint 1109 1634 5.5282 6.9102 13.8204 0.1042 Constraint 196 876 5.4568 6.8210 13.6419 0.1040 Constraint 66 222 5.2814 6.6018 13.2036 0.1040 Constraint 713 1008 3.9865 4.9832 9.9663 0.1040 Constraint 706 859 6.1934 7.7418 15.4835 0.1039 Constraint 1008 1479 5.4149 6.7687 13.5374 0.1037 Constraint 549 899 5.5944 6.9930 13.9859 0.1037 Constraint 1077 1358 5.1136 6.3920 12.7841 0.1037 Constraint 363 968 5.1090 6.3862 12.7725 0.1037 Constraint 363 944 4.3127 5.3909 10.7818 0.1037 Constraint 930 1596 4.6605 5.8256 11.6512 0.1037 Constraint 899 988 5.6690 7.0862 14.1725 0.1035 Constraint 1246 1603 5.4381 6.7976 13.5951 0.1034 Constraint 706 1438 5.8272 7.2840 14.5679 0.1034 Constraint 572 1117 5.3041 6.6301 13.2602 0.1034 Constraint 189 1268 5.2381 6.5477 13.0953 0.1034 Constraint 848 1634 5.9530 7.4412 14.8824 0.1033 Constraint 196 1731 4.4497 5.5621 11.1241 0.1033 Constraint 189 384 5.6135 7.0169 14.0338 0.1033 Constraint 818 1204 5.9446 7.4307 14.8614 0.1033 Constraint 128 1030 5.0797 6.3496 12.6992 0.1032 Constraint 1455 1764 4.4515 5.5644 11.1288 0.1032 Constraint 1358 1662 6.0870 7.6087 15.2175 0.1031 Constraint 222 392 4.9760 6.2200 12.4400 0.1031 Constraint 1059 1228 4.1514 5.1892 10.3785 0.1030 Constraint 333 690 4.5351 5.6689 11.3377 0.1030 Constraint 783 1284 5.5653 6.9567 13.9133 0.1029 Constraint 800 1438 4.2669 5.3336 10.6671 0.1029 Constraint 913 1228 5.7367 7.1709 14.3417 0.1029 Constraint 792 1228 6.1591 7.6989 15.3978 0.1029 Constraint 657 1382 5.9409 7.4261 14.8522 0.1029 Constraint 384 1077 5.8523 7.3154 14.6307 0.1029 Constraint 913 1178 4.5652 5.7064 11.4129 0.1028 Constraint 572 908 5.3817 6.7271 13.4542 0.1027 Constraint 706 1533 5.3118 6.6398 13.2795 0.1027 Constraint 493 1382 5.9500 7.4375 14.8749 0.1027 Constraint 1408 1756 5.4747 6.8434 13.6867 0.1025 Constraint 884 1109 5.4753 6.8441 13.6882 0.1025 Constraint 944 1391 5.9994 7.4993 14.9985 0.1024 Constraint 673 783 5.3431 6.6789 13.3578 0.1023 Constraint 963 1035 4.5406 5.6758 11.3516 0.1022 Constraint 1158 1301 4.9961 6.2452 12.4904 0.1022 Constraint 1022 1567 5.5886 6.9858 13.9716 0.1021 Constraint 263 792 4.5708 5.7135 11.4271 0.1021 Constraint 1158 1479 3.4750 4.3438 8.6876 0.1021 Constraint 944 1657 3.9587 4.9484 9.8968 0.1020 Constraint 681 1014 6.2227 7.7784 15.5569 0.1020 Constraint 501 1293 5.3183 6.6479 13.2958 0.1020 Constraint 616 808 5.5239 6.9049 13.8097 0.1020 Constraint 549 1008 5.3035 6.6293 13.2586 0.1020 Constraint 104 443 4.9110 6.1388 12.2775 0.1020 Constraint 1541 1678 5.5531 6.9413 13.8826 0.1019 Constraint 510 1008 5.1400 6.4250 12.8500 0.1018 Constraint 429 913 5.2734 6.5918 13.1836 0.1018 Constraint 249 706 4.0067 5.0083 10.0166 0.1018 Constraint 241 706 4.9515 6.1894 12.3788 0.1018 Constraint 921 1220 5.6816 7.1020 14.2039 0.1017 Constraint 913 1117 5.3086 6.6358 13.2715 0.1017 Constraint 112 443 4.9261 6.1577 12.3153 0.1017 Constraint 384 944 5.6865 7.1081 14.2162 0.1017 Constraint 233 980 4.7963 5.9954 11.9907 0.1017 Constraint 180 355 4.1997 5.2496 10.4992 0.1016 Constraint 180 314 4.9591 6.1989 12.3978 0.1016 Constraint 222 521 5.4192 6.7740 13.5480 0.1016 Constraint 1511 1756 4.8419 6.0523 12.1046 0.1014 Constraint 18 136 5.4342 6.7927 13.5855 0.1014 Constraint 1526 1678 4.1015 5.1268 10.2536 0.1013 Constraint 1427 1548 5.4927 6.8659 13.7318 0.1013 Constraint 1014 1141 4.2602 5.3253 10.6506 0.1011 Constraint 722 988 5.0233 6.2791 12.5583 0.1011 Constraint 963 1427 4.6786 5.8483 11.6965 0.1011 Constraint 792 1059 4.8488 6.0610 12.1220 0.1010 Constraint 1133 1438 5.6046 7.0057 14.0114 0.1010 Constraint 333 597 5.3622 6.7028 13.4055 0.1009 Constraint 222 713 4.9578 6.1973 12.3946 0.1009 Constraint 521 937 6.1219 7.6523 15.3047 0.1009 Constraint 375 1046 6.0801 7.6001 15.2001 0.1009 Constraint 630 808 4.8843 6.1054 12.2108 0.1008 Constraint 1167 1358 4.9811 6.2264 12.4527 0.1008 Constraint 937 1068 5.4729 6.8411 13.6821 0.1008 Constraint 657 1109 5.4768 6.8459 13.6919 0.1008 Constraint 493 1670 6.0252 7.5315 15.0630 0.1008 Constraint 650 1059 5.2924 6.6155 13.2310 0.1007 Constraint 1246 1455 5.8474 7.3093 14.6185 0.1007 Constraint 392 792 5.3230 6.6537 13.3075 0.1006 Constraint 1077 1511 4.9586 6.1982 12.3965 0.1005 Constraint 761 1046 5.1590 6.4487 12.8974 0.1005 Constraint 1343 1447 5.8415 7.3019 14.6038 0.1005 Constraint 955 1149 5.4422 6.8028 13.6056 0.1005 Constraint 368 748 4.1245 5.1557 10.3114 0.1005 Constraint 1068 1141 4.8509 6.0637 12.1273 0.1004 Constraint 1620 1764 6.1132 7.6415 15.2830 0.1004 Constraint 1246 1416 5.7444 7.1806 14.3611 0.1003 Constraint 572 968 4.4897 5.6121 11.2242 0.1002 Constraint 363 597 5.9003 7.3753 14.7507 0.1002 Constraint 818 1466 6.0351 7.5439 15.0877 0.1002 Constraint 968 1533 3.7359 4.6699 9.3399 0.1001 Constraint 808 1100 5.5699 6.9624 13.9248 0.1001 Constraint 597 698 5.0000 6.2500 12.5000 0.1001 Constraint 368 944 4.0237 5.0297 10.0593 0.1000 Constraint 66 908 3.8105 4.7632 9.5263 0.1000 Constraint 988 1178 6.1695 7.7118 15.4237 0.0999 Constraint 899 1366 4.9956 6.2445 12.4890 0.0998 Constraint 1204 1634 5.8302 7.2877 14.5754 0.0998 Constraint 227 392 5.6875 7.1093 14.2187 0.0998 Constraint 263 597 5.5523 6.9404 13.8807 0.0997 Constraint 579 913 4.6220 5.7775 11.5550 0.0997 Constraint 564 899 4.6724 5.8404 11.6809 0.0997 Constraint 18 876 6.0339 7.5423 15.0847 0.0997 Constraint 429 608 4.5487 5.6859 11.3718 0.0997 Constraint 1092 1455 4.2978 5.3723 10.7446 0.0996 Constraint 421 1084 4.1383 5.1729 10.3457 0.0996 Constraint 412 1141 3.8260 4.7824 9.5649 0.0996 Constraint 930 1239 3.9531 4.9413 9.8827 0.0996 Constraint 722 1239 5.4910 6.8637 13.7274 0.0996 Constraint 665 800 4.4613 5.5766 11.1532 0.0996 Constraint 690 808 4.8644 6.0805 12.1610 0.0996 Constraint 623 1109 5.2128 6.5160 13.0319 0.0996 Constraint 274 650 6.3935 7.9918 15.9837 0.0996 Constraint 112 1246 6.3494 7.9367 15.8734 0.0996 Constraint 1046 1220 6.2778 7.8473 15.6946 0.0995 Constraint 937 1317 4.9420 6.1775 12.3551 0.0995 Constraint 908 1366 6.3668 7.9585 15.9171 0.0995 Constraint 818 1391 3.4103 4.2629 8.5258 0.0995 Constraint 800 1427 4.2785 5.3481 10.6962 0.0995 Constraint 769 1455 6.0215 7.5269 15.0537 0.0995 Constraint 713 1204 6.2507 7.8134 15.6267 0.0995 Constraint 579 1158 5.0784 6.3480 12.6960 0.0995 Constraint 579 1149 3.4287 4.2859 8.5717 0.0995 Constraint 557 1204 5.8358 7.2948 14.5896 0.0995 Constraint 521 1204 5.2891 6.6113 13.2227 0.0995 Constraint 521 1167 5.2091 6.5113 13.0227 0.0995 Constraint 466 698 4.5838 5.7297 11.4595 0.0995 Constraint 466 673 6.2674 7.8342 15.6684 0.0995 Constraint 466 665 4.4354 5.5443 11.0886 0.0995 Constraint 769 1100 5.8162 7.2702 14.5404 0.0995 Constraint 1657 1739 4.6426 5.8033 11.6066 0.0995 Constraint 722 963 4.0362 5.0452 10.0904 0.0994 Constraint 521 616 4.2724 5.3405 10.6810 0.0994 Constraint 39 1503 5.5726 6.9657 13.9314 0.0992 Constraint 630 800 4.8873 6.1092 12.2183 0.0992 Constraint 630 1178 6.2744 7.8431 15.6861 0.0992 Constraint 294 722 5.8540 7.3176 14.6351 0.0992 Constraint 792 1317 5.5443 6.9303 13.8607 0.0991 Constraint 1503 1788 4.5956 5.7445 11.4889 0.0991 Constraint 1022 1325 5.1935 6.4918 12.9836 0.0990 Constraint 1455 1777 5.4908 6.8636 13.7271 0.0989 Constraint 1447 1777 4.5793 5.7242 11.4484 0.0989 Constraint 1447 1772 4.6453 5.8066 11.6132 0.0989 Constraint 921 1213 3.1475 3.9344 7.8688 0.0989 Constraint 913 1246 4.5354 5.6693 11.3385 0.0989 Constraint 913 1220 6.1683 7.7103 15.4206 0.0989 Constraint 908 1213 5.8087 7.2609 14.5218 0.0989 Constraint 800 899 4.1360 5.1700 10.3400 0.0989 Constraint 778 1503 4.6500 5.8125 11.6250 0.0989 Constraint 731 913 6.3064 7.8830 15.7660 0.0989 Constraint 722 1427 5.8346 7.2932 14.5865 0.0989 Constraint 706 892 5.8831 7.3538 14.7077 0.0989 Constraint 690 1466 4.4954 5.6192 11.2385 0.0989 Constraint 665 1471 4.9300 6.1625 12.3251 0.0989 Constraint 665 1438 6.3947 7.9933 15.9867 0.0989 Constraint 623 1503 5.4839 6.8549 13.7098 0.0989 Constraint 589 1471 5.6908 7.1135 14.2269 0.0989 Constraint 589 1408 6.1128 7.6410 15.2820 0.0989 Constraint 572 1178 5.0495 6.3119 12.6238 0.0989 Constraint 557 921 4.2930 5.3663 10.7325 0.0989 Constraint 487 1427 5.7446 7.1807 14.3615 0.0989 Constraint 466 1438 5.1790 6.4737 12.9475 0.0989 Constraint 457 579 4.0124 5.0156 10.0311 0.0989 Constraint 355 616 5.4347 6.7933 13.5867 0.0989 Constraint 347 859 4.8415 6.0519 12.1038 0.0989 Constraint 347 579 4.7667 5.9583 11.9167 0.0989 Constraint 306 963 6.1107 7.6384 15.2768 0.0989 Constraint 196 792 5.8324 7.2905 14.5810 0.0989 Constraint 196 589 6.3327 7.9159 15.8317 0.0989 Constraint 189 1466 5.6614 7.0768 14.1535 0.0989 Constraint 164 616 6.2032 7.7540 15.5080 0.0989 Constraint 154 884 6.1319 7.6649 15.3299 0.0989 Constraint 154 876 5.1815 6.4768 12.9537 0.0989 Constraint 128 899 5.3048 6.6310 13.2620 0.0989 Constraint 128 884 5.1358 6.4197 12.8394 0.0989 Constraint 91 876 6.1561 7.6952 15.3904 0.0989 Constraint 91 848 4.9894 6.2367 12.4734 0.0989 Constraint 91 818 5.7273 7.1592 14.3183 0.0989 Constraint 77 457 5.4032 6.7541 13.5081 0.0989 Constraint 66 848 5.1645 6.4556 12.9111 0.0989 Constraint 66 457 5.0877 6.3596 12.7192 0.0989 Constraint 59 848 5.2778 6.5973 13.1946 0.0989 Constraint 39 884 5.0707 6.3384 12.6767 0.0989 Constraint 33 884 5.5625 6.9532 13.9063 0.0989 Constraint 18 589 3.7527 4.6909 9.3818 0.0989 Constraint 3 1488 5.4809 6.8512 13.7023 0.0989 Constraint 3 1471 4.2220 5.2775 10.5550 0.0989 Constraint 3 1447 4.2364 5.2955 10.5909 0.0989 Constraint 3 1030 3.4224 4.2780 8.5560 0.0989 Constraint 104 299 5.2301 6.5376 13.0753 0.0989 Constraint 208 597 4.8776 6.0970 12.1941 0.0988 Constraint 66 435 5.0557 6.3196 12.6392 0.0988 Constraint 47 435 4.6011 5.7514 11.5028 0.0988 Constraint 145 375 4.9243 6.1554 12.3108 0.0988 Constraint 538 783 5.6267 7.0333 14.0667 0.0988 Constraint 1427 1756 4.2584 5.3229 10.6459 0.0987 Constraint 249 549 5.4700 6.8375 13.6750 0.0987 Constraint 368 792 6.2214 7.7768 15.5535 0.0987 Constraint 97 227 5.3216 6.6520 13.3039 0.0986 Constraint 443 1720 4.5682 5.7103 11.4206 0.0985 Constraint 412 1748 6.2414 7.8018 15.6036 0.0985 Constraint 997 1059 5.6319 7.0398 14.0797 0.0984 Constraint 930 1054 5.5453 6.9316 13.8633 0.0983 Constraint 1382 1479 5.0536 6.3170 12.6340 0.0983 Constraint 501 836 3.9517 4.9396 9.8792 0.0983 Constraint 59 908 3.9059 4.8824 9.7649 0.0982 Constraint 589 748 4.9135 6.1419 12.2838 0.0982 Constraint 1634 1772 4.4543 5.5679 11.1358 0.0982 Constraint 154 1167 5.6945 7.1182 14.2364 0.0981 Constraint 829 1556 5.0073 6.2592 12.5184 0.0981 Constraint 706 1035 4.5084 5.6355 11.2710 0.0979 Constraint 1301 1567 4.7682 5.9603 11.9206 0.0979 Constraint 538 792 5.0941 6.3677 12.7353 0.0979 Constraint 429 572 4.9915 6.2393 12.4787 0.0979 Constraint 294 538 5.6172 7.0215 14.0431 0.0979 Constraint 164 347 5.7480 7.1851 14.3701 0.0979 Constraint 154 299 4.9597 6.1996 12.3991 0.0979 Constraint 47 274 4.8021 6.0026 12.0052 0.0979 Constraint 769 937 4.1218 5.1523 10.3046 0.0979 Constraint 848 1054 4.3552 5.4439 10.8879 0.0978 Constraint 1479 1634 5.4567 6.8209 13.6418 0.0978 Constraint 818 1343 5.9970 7.4963 14.9926 0.0978 Constraint 868 988 6.0897 7.6121 15.2243 0.0977 Constraint 623 808 4.5065 5.6332 11.2664 0.0976 Constraint 1133 1301 4.4819 5.6023 11.2046 0.0976 Constraint 501 579 4.6817 5.8521 11.7042 0.0976 Constraint 650 1260 5.3898 6.7373 13.4745 0.0976 Constraint 66 899 5.4255 6.7819 13.5637 0.0975 Constraint 256 968 4.5793 5.7241 11.4483 0.0975 Constraint 375 589 5.0215 6.2769 12.5538 0.0974 Constraint 1416 1756 5.3796 6.7245 13.4490 0.0973 Constraint 549 980 4.9639 6.2049 12.4098 0.0973 Constraint 249 557 4.7051 5.8814 11.7628 0.0972 Constraint 294 564 5.8305 7.2881 14.5762 0.0972 Constraint 722 930 5.5514 6.9392 13.8784 0.0972 Constraint 713 930 4.3326 5.4157 10.8315 0.0972 Constraint 731 1046 5.5685 6.9607 13.9213 0.0971 Constraint 1488 1587 3.9449 4.9312 9.8623 0.0971 Constraint 1133 1382 4.7411 5.9263 11.8527 0.0971 Constraint 980 1391 3.7763 4.7204 9.4409 0.0970 Constraint 1427 1731 4.6833 5.8542 11.7083 0.0970 Constraint 1167 1611 4.1757 5.2197 10.4394 0.0970 Constraint 421 1533 5.4907 6.8633 13.7266 0.0969 Constraint 997 1260 6.2644 7.8305 15.6610 0.0969 Constraint 112 384 4.2707 5.3384 10.6768 0.0969 Constraint 748 963 4.5247 5.6559 11.3117 0.0967 Constraint 756 1268 5.7110 7.1387 14.2774 0.0967 Constraint 748 1309 5.1744 6.4680 12.9361 0.0967 Constraint 739 1325 5.8088 7.2610 14.5219 0.0967 Constraint 1141 1479 5.6243 7.0304 14.0608 0.0967 Constraint 1030 1488 5.1922 6.4902 12.9804 0.0966 Constraint 616 783 3.9000 4.8750 9.7500 0.0965 Constraint 510 908 5.8035 7.2544 14.5089 0.0964 Constraint 980 1533 4.7596 5.9495 11.8989 0.0964 Constraint 1141 1541 5.6814 7.1017 14.2034 0.0964 Constraint 937 1014 4.8496 6.0620 12.1239 0.0963 Constraint 1046 1276 5.9673 7.4591 14.9182 0.0963 Constraint 848 1046 5.5104 6.8880 13.7761 0.0963 Constraint 521 623 3.2575 4.0719 8.1438 0.0963 Constraint 739 1334 5.6695 7.0869 14.1737 0.0962 Constraint 739 1309 3.2171 4.0213 8.0427 0.0962 Constraint 722 1334 5.9860 7.4825 14.9649 0.0962 Constraint 1193 1343 5.5395 6.9244 13.8488 0.0962 Constraint 363 557 5.6978 7.1223 14.2446 0.0962 Constraint 216 1503 5.8095 7.2619 14.5237 0.0961 Constraint 800 1092 5.0438 6.3048 12.6095 0.0961 Constraint 216 937 6.0489 7.5611 15.1222 0.0961 Constraint 1399 1479 5.6415 7.0518 14.1037 0.0960 Constraint 808 1488 6.1529 7.6911 15.3823 0.0960 Constraint 493 1416 5.0513 6.3141 12.6283 0.0958 Constraint 579 1526 4.8206 6.0257 12.0514 0.0958 Constraint 306 665 3.4666 4.3332 8.6665 0.0958 Constraint 249 792 3.8752 4.8440 9.6881 0.0958 Constraint 955 1611 5.6319 7.0398 14.0797 0.0957 Constraint 848 1220 5.6095 7.0119 14.0238 0.0957 Constraint 1519 1692 5.1559 6.4449 12.8899 0.0955 Constraint 1519 1683 5.0600 6.3250 12.6500 0.0955 Constraint 1503 1634 5.1196 6.3995 12.7990 0.0955 Constraint 1471 1649 4.0088 5.0110 10.0219 0.0955 Constraint 1382 1756 5.6361 7.0451 14.0902 0.0955 Constraint 1213 1788 4.8215 6.0269 12.0538 0.0955 Constraint 930 1246 6.3737 7.9671 15.9342 0.0955 Constraint 739 937 3.8966 4.8707 9.7415 0.0955 Constraint 731 848 4.3327 5.4159 10.8318 0.0955 Constraint 657 997 3.8817 4.8521 9.7043 0.0955 Constraint 623 1526 6.2088 7.7610 15.5220 0.0955 Constraint 623 1141 4.7349 5.9186 11.8373 0.0955 Constraint 616 1133 5.2468 6.5585 13.1171 0.0955 Constraint 589 1109 4.5254 5.6568 11.3136 0.0955 Constraint 572 1167 4.9430 6.1787 12.3575 0.0955 Constraint 557 1213 4.6512 5.8140 11.6279 0.0955 Constraint 530 1251 4.6150 5.7688 11.5375 0.0955 Constraint 521 1251 4.4406 5.5508 11.1016 0.0955 Constraint 521 1022 6.0846 7.6058 15.2116 0.0955 Constraint 510 1204 5.3969 6.7461 13.4922 0.0955 Constraint 510 1193 5.0698 6.3372 12.6745 0.0955 Constraint 510 1167 4.8680 6.0850 12.1701 0.0955 Constraint 493 630 4.3096 5.3871 10.7741 0.0955 Constraint 487 639 5.0651 6.3314 12.6628 0.0955 Constraint 487 630 5.8900 7.3625 14.7250 0.0955 Constraint 466 1309 5.1959 6.4949 12.9899 0.0955 Constraint 466 1276 5.5645 6.9557 13.9113 0.0955 Constraint 466 1100 5.2083 6.5104 13.0208 0.0955 Constraint 466 630 4.6143 5.7678 11.5356 0.0955 Constraint 457 848 5.8752 7.3440 14.6880 0.0955 Constraint 448 1343 6.3017 7.8771 15.7542 0.0955 Constraint 448 1193 6.3418 7.9272 15.8545 0.0955 Constraint 448 848 4.4527 5.5659 11.1317 0.0955 Constraint 448 630 5.2131 6.5163 13.0327 0.0955 Constraint 443 1343 5.7149 7.1436 14.2872 0.0955 Constraint 443 1334 5.5806 6.9757 13.9514 0.0955 Constraint 443 1309 4.3215 5.4019 10.8038 0.0955 Constraint 443 1133 5.6582 7.0728 14.1456 0.0955 Constraint 443 630 3.5347 4.4184 8.8368 0.0955 Constraint 412 1334 5.4003 6.7504 13.5008 0.0955 Constraint 412 1158 5.1907 6.4884 12.9768 0.0955 Constraint 412 1125 5.3860 6.7325 13.4651 0.0955 Constraint 412 876 3.8276 4.7846 9.5691 0.0955 Constraint 412 665 4.2226 5.2782 10.5564 0.0955 Constraint 392 1193 5.0800 6.3500 12.7000 0.0955 Constraint 375 899 5.6177 7.0222 14.0443 0.0955 Constraint 375 876 3.8278 4.7847 9.5695 0.0955 Constraint 363 1117 5.0898 6.3622 12.7244 0.0955 Constraint 355 899 4.5070 5.6338 11.2676 0.0955 Constraint 347 1193 4.1219 5.1524 10.3048 0.0955 Constraint 333 1193 6.3993 7.9991 15.9982 0.0955 Constraint 325 1268 6.2122 7.7653 15.5305 0.0955 Constraint 325 1167 4.9661 6.2077 12.4153 0.0955 Constraint 325 1068 6.2226 7.7782 15.5564 0.0955 Constraint 325 937 5.6872 7.1090 14.2180 0.0955 Constraint 325 930 3.8783 4.8479 9.6958 0.0955 Constraint 314 1343 6.0061 7.5076 15.0151 0.0955 Constraint 306 1228 6.2489 7.8111 15.6223 0.0955 Constraint 306 1092 6.3565 7.9456 15.8913 0.0955 Constraint 299 1228 4.3373 5.4217 10.8433 0.0955 Constraint 299 1220 6.1807 7.7259 15.4518 0.0955 Constraint 299 1204 3.8729 4.8411 9.6823 0.0955 Constraint 299 1193 4.2477 5.3096 10.6193 0.0955 Constraint 299 1100 6.1901 7.7376 15.4753 0.0955 Constraint 299 1077 5.8766 7.3458 14.6916 0.0955 Constraint 294 1343 5.1833 6.4792 12.9583 0.0955 Constraint 294 1309 6.3674 7.9592 15.9184 0.0955 Constraint 294 1109 5.4604 6.8255 13.6509 0.0955 Constraint 294 1100 6.2763 7.8453 15.6907 0.0955 Constraint 294 681 5.5965 6.9956 13.9912 0.0955 Constraint 285 1399 6.0331 7.5413 15.0827 0.0955 Constraint 285 1374 4.2326 5.2907 10.5815 0.0955 Constraint 285 1366 4.2228 5.2785 10.5570 0.0955 Constraint 285 1343 4.0003 5.0003 10.0006 0.0955 Constraint 285 1251 6.0107 7.5134 15.0267 0.0955 Constraint 285 1220 4.2228 5.2785 10.5570 0.0955 Constraint 285 1167 5.0159 6.2699 12.5398 0.0955 Constraint 285 1117 4.9150 6.1438 12.2876 0.0955 Constraint 263 1220 4.7113 5.8891 11.7782 0.0955 Constraint 263 1193 5.6622 7.0777 14.1555 0.0955 Constraint 263 1125 4.2089 5.2612 10.5223 0.0955 Constraint 263 1109 3.9983 4.9979 9.9958 0.0955 Constraint 263 963 6.0657 7.5821 15.1642 0.0955 Constraint 256 1399 3.9981 4.9977 9.9953 0.0955 Constraint 256 1343 4.9197 6.1497 12.2993 0.0955 Constraint 256 1317 4.7031 5.8788 11.7577 0.0955 Constraint 256 1284 4.9628 6.2035 12.4070 0.0955 Constraint 256 1251 3.9990 4.9987 9.9974 0.0955 Constraint 256 1109 4.6900 5.8625 11.7251 0.0955 Constraint 249 1427 6.0315 7.5393 15.0787 0.0955 Constraint 249 1391 4.7017 5.8772 11.7544 0.0955 Constraint 249 1374 5.7752 7.2190 14.4380 0.0955 Constraint 249 1366 3.9087 4.8859 9.7718 0.0955 Constraint 249 1276 6.1049 7.6311 15.2622 0.0955 Constraint 249 1251 3.0815 3.8519 7.7038 0.0955 Constraint 249 1220 3.9087 4.8859 9.7718 0.0955 Constraint 241 1220 3.8963 4.8704 9.7408 0.0955 Constraint 241 1022 4.9785 6.2232 12.4464 0.0955 Constraint 233 1178 6.0569 7.5712 15.1423 0.0955 Constraint 233 1149 4.6889 5.8611 11.7223 0.0955 Constraint 233 1125 3.8963 4.8704 9.7408 0.0955 Constraint 227 1466 5.2681 6.5851 13.1701 0.0955 Constraint 227 1438 4.0457 5.0571 10.1142 0.0955 Constraint 227 1427 3.1950 3.9938 7.9875 0.0955 Constraint 227 1399 3.7244 4.6555 9.3111 0.0955 Constraint 227 1309 5.4772 6.8465 13.6930 0.0955 Constraint 227 1276 3.2394 4.0493 8.0986 0.0955 Constraint 227 1251 3.7677 4.7096 9.4193 0.0955 Constraint 222 1046 5.6001 7.0001 14.0001 0.0955 Constraint 216 1158 3.7940 4.7425 9.4851 0.0955 Constraint 208 1438 5.6234 7.0292 14.0584 0.0955 Constraint 208 1309 3.4389 4.2987 8.5974 0.0955 Constraint 208 1260 4.6946 5.8682 11.7364 0.0955 Constraint 208 1251 5.0076 6.2595 12.5191 0.0955 Constraint 208 1054 4.6946 5.8682 11.7364 0.0955 Constraint 208 1046 4.9953 6.2441 12.4883 0.0955 Constraint 196 1488 6.0344 7.5430 15.0861 0.0955 Constraint 196 1455 5.5156 6.8945 13.7890 0.0955 Constraint 180 769 4.4257 5.5322 11.0644 0.0955 Constraint 180 739 6.0809 7.6012 15.2024 0.0955 Constraint 172 1494 3.9678 4.9598 9.9196 0.0955 Constraint 172 1488 2.9785 3.7232 7.4463 0.0955 Constraint 172 1466 3.7290 4.6613 9.3225 0.0955 Constraint 172 1366 5.6797 7.0996 14.1991 0.0955 Constraint 172 1334 2.9613 3.7016 7.4032 0.0955 Constraint 172 1309 3.4354 4.2942 8.5884 0.0955 Constraint 172 1228 4.8019 6.0023 12.0047 0.0955 Constraint 172 1008 5.7082 7.1352 14.2704 0.0955 Constraint 172 589 3.2316 4.0395 8.0790 0.0955 Constraint 164 1239 5.7105 7.1381 14.2763 0.0955 Constraint 154 1068 5.4876 6.8595 13.7190 0.0955 Constraint 154 792 4.9665 6.2082 12.4163 0.0955 Constraint 154 769 4.1708 5.2135 10.4270 0.0955 Constraint 145 1334 5.4435 6.8043 13.6087 0.0955 Constraint 145 1268 3.1122 3.8902 7.7804 0.0955 Constraint 145 1246 4.8820 6.1025 12.2050 0.0955 Constraint 145 1239 5.4396 6.7995 13.5989 0.0955 Constraint 145 1046 5.6935 7.1169 14.2337 0.0955 Constraint 145 1030 5.6003 7.0003 14.0007 0.0955 Constraint 145 997 5.2239 6.5299 13.0598 0.0955 Constraint 145 937 3.8792 4.8490 9.6981 0.0955 Constraint 145 778 4.6541 5.8176 11.6353 0.0955 Constraint 145 769 3.5247 4.4058 8.8117 0.0955 Constraint 136 1374 4.8793 6.0991 12.1982 0.0955 Constraint 136 1317 5.3507 6.6884 13.3767 0.0955 Constraint 136 1268 4.9014 6.1268 12.2536 0.0955 Constraint 136 1260 5.7210 7.1513 14.3026 0.0955 Constraint 136 1239 4.3900 5.4874 10.9749 0.0955 Constraint 128 748 5.4632 6.8290 13.6580 0.0955 Constraint 128 713 5.1744 6.4680 12.9359 0.0955 Constraint 121 1068 5.7159 7.1448 14.2897 0.0955 Constraint 121 1046 4.3943 5.4929 10.9858 0.0955 Constraint 121 792 5.4949 6.8686 13.7372 0.0955 Constraint 121 778 5.7966 7.2458 14.4915 0.0955 Constraint 121 769 4.9916 6.2395 12.4790 0.0955 Constraint 112 778 5.0257 6.2822 12.5644 0.0955 Constraint 112 665 5.0309 6.2886 12.5772 0.0955 Constraint 112 572 3.7976 4.7470 9.4940 0.0955 Constraint 112 549 5.9183 7.3979 14.7958 0.0955 Constraint 112 538 6.3850 7.9813 15.9625 0.0955 Constraint 104 808 6.0246 7.5307 15.0614 0.0955 Constraint 104 756 4.2125 5.2656 10.5312 0.0955 Constraint 104 731 6.0253 7.5316 15.0632 0.0955 Constraint 104 722 5.6607 7.0758 14.1516 0.0955 Constraint 97 848 5.7664 7.2080 14.4159 0.0955 Constraint 97 800 5.0474 6.3092 12.6185 0.0955 Constraint 82 639 4.1718 5.2147 10.4294 0.0955 Constraint 66 876 5.1827 6.4784 12.9568 0.0955 Constraint 59 136 6.1257 7.6572 15.3143 0.0955 Constraint 47 876 3.7346 4.6682 9.3364 0.0955 Constraint 47 510 3.7901 4.7376 9.4752 0.0955 Constraint 39 510 4.1331 5.1664 10.3328 0.0955 Constraint 549 1133 5.7458 7.1822 14.3645 0.0955 Constraint 616 997 5.1008 6.3760 12.7519 0.0954 Constraint 128 375 5.8759 7.3448 14.6897 0.0954 Constraint 1141 1416 3.9581 4.9477 9.8953 0.0954 Constraint 1059 1541 5.1802 6.4753 12.9506 0.0954 Constraint 241 1714 5.5742 6.9678 13.9356 0.0954 Constraint 1427 1720 5.9237 7.4047 14.8093 0.0953 Constraint 1251 1382 5.4811 6.8514 13.7027 0.0953 Constraint 1178 1541 4.7131 5.8914 11.7827 0.0952 Constraint 748 1167 5.6097 7.0121 14.0242 0.0952 Constraint 530 1084 4.3447 5.4309 10.8618 0.0952 Constraint 457 608 5.1269 6.4086 12.8172 0.0952 Constraint 968 1511 4.5608 5.7010 11.4020 0.0952 Constraint 363 673 4.9428 6.1785 12.3570 0.0951 Constraint 128 1503 5.3381 6.6726 13.3452 0.0951 Constraint 1567 1662 3.9433 4.9291 9.8582 0.0951 Constraint 1471 1634 6.0719 7.5898 15.1797 0.0951 Constraint 1382 1488 4.3555 5.4444 10.8888 0.0951 Constraint 1239 1714 4.4755 5.5944 11.1888 0.0951 Constraint 1213 1714 4.4990 5.6237 11.2474 0.0951 Constraint 1149 1714 6.2205 7.7756 15.5513 0.0951 Constraint 1149 1678 6.3009 7.8761 15.7523 0.0951 Constraint 1141 1714 6.1307 7.6634 15.3267 0.0951 Constraint 1068 1466 6.2018 7.7523 15.5046 0.0951 Constraint 1046 1526 4.4029 5.5037 11.0073 0.0951 Constraint 988 1503 5.3117 6.6396 13.2793 0.0951 Constraint 884 1494 4.4928 5.6160 11.2320 0.0951 Constraint 876 1276 4.6274 5.7843 11.5686 0.0951 Constraint 876 1133 4.8473 6.0591 12.1182 0.0951 Constraint 818 1366 5.3193 6.6491 13.2982 0.0951 Constraint 792 1351 5.9343 7.4178 14.8357 0.0951 Constraint 761 1662 4.2769 5.3462 10.6923 0.0951 Constraint 690 1399 5.8394 7.2993 14.5986 0.0951 Constraint 681 1399 4.3780 5.4725 10.9450 0.0951 Constraint 657 1466 6.2163 7.7704 15.5408 0.0951 Constraint 650 1466 5.5726 6.9657 13.9315 0.0951 Constraint 597 1494 5.4500 6.8125 13.6251 0.0951 Constraint 597 1488 5.5805 6.9756 13.9512 0.0951 Constraint 589 1777 6.0177 7.5222 15.0444 0.0951 Constraint 579 722 5.6082 7.0102 14.0205 0.0951 Constraint 572 1494 6.2022 7.7528 15.5056 0.0951 Constraint 572 1488 5.1492 6.4365 12.8730 0.0951 Constraint 549 1519 4.2078 5.2597 10.5194 0.0951 Constraint 538 1519 6.1608 7.7009 15.4019 0.0951 Constraint 375 968 6.1909 7.7386 15.4773 0.0951 Constraint 347 980 4.2354 5.2942 10.5884 0.0951 Constraint 347 913 5.8283 7.2854 14.5708 0.0951 Constraint 347 868 5.8058 7.2573 14.5146 0.0951 Constraint 333 616 5.4605 6.8256 13.6512 0.0951 Constraint 325 557 5.8339 7.2924 14.5847 0.0951 Constraint 325 549 6.1710 7.7138 15.4275 0.0951 Constraint 314 1035 4.8999 6.1249 12.2498 0.0951 Constraint 314 792 6.3815 7.9768 15.9537 0.0951 Constraint 306 549 5.7890 7.2363 14.4725 0.0951 Constraint 306 493 5.9580 7.4475 14.8951 0.0951 Constraint 294 1059 3.8239 4.7799 9.5598 0.0951 Constraint 294 1054 5.8731 7.3414 14.6828 0.0951 Constraint 294 1035 3.9645 4.9556 9.9112 0.0951 Constraint 285 792 5.4424 6.8030 13.6061 0.0951 Constraint 216 608 5.0019 6.2523 12.5046 0.0951 Constraint 196 1670 6.2592 7.8241 15.6481 0.0951 Constraint 196 829 4.7973 5.9966 11.9932 0.0951 Constraint 189 1670 3.9125 4.8906 9.7813 0.0951 Constraint 189 608 3.7820 4.7275 9.4550 0.0951 Constraint 180 435 5.6810 7.1013 14.2026 0.0951 Constraint 164 1678 5.5062 6.8827 13.7655 0.0951 Constraint 164 1670 4.8791 6.0988 12.1977 0.0951 Constraint 154 1683 4.4977 5.6221 11.2442 0.0951 Constraint 154 1678 6.1659 7.7074 15.4148 0.0951 Constraint 154 1670 5.3235 6.6543 13.3087 0.0951 Constraint 136 1683 5.9576 7.4471 14.8941 0.0951 Constraint 136 1678 5.7816 7.2270 14.4540 0.0951 Constraint 136 1526 6.2667 7.8334 15.6669 0.0951 Constraint 136 1494 6.2707 7.8384 15.6767 0.0951 Constraint 136 892 5.3465 6.6832 13.3663 0.0951 Constraint 136 884 4.6583 5.8229 11.6457 0.0951 Constraint 128 1526 3.8792 4.8491 9.6981 0.0951 Constraint 112 892 5.8934 7.3667 14.7334 0.0951 Constraint 104 1533 5.4934 6.8668 13.7335 0.0951 Constraint 104 1526 5.0707 6.3384 12.6768 0.0951 Constraint 104 892 4.8709 6.0886 12.1773 0.0951 Constraint 104 884 5.6173 7.0217 14.0433 0.0951 Constraint 97 1548 6.1586 7.6982 15.3964 0.0951 Constraint 97 1533 6.0803 7.6003 15.2007 0.0951 Constraint 82 1548 4.2290 5.2863 10.5726 0.0951 Constraint 82 1541 5.8252 7.2815 14.5630 0.0951 Constraint 82 1533 5.5678 6.9598 13.9196 0.0951 Constraint 39 112 5.8025 7.2531 14.5062 0.0951 Constraint 25 1178 5.8899 7.3623 14.7246 0.0951 Constraint 1276 1416 4.7535 5.9419 11.8837 0.0951 Constraint 1587 1788 5.6886 7.1107 14.2214 0.0951 Constraint 145 233 6.2999 7.8749 15.7497 0.0950 Constraint 1220 1325 5.7626 7.2032 14.4064 0.0950 Constraint 39 164 5.7744 7.2180 14.4360 0.0950 Constraint 25 222 6.1620 7.7026 15.4051 0.0949 Constraint 104 412 5.3018 6.6272 13.2544 0.0949 Constraint 39 154 4.3708 5.4635 10.9270 0.0949 Constraint 589 1084 4.2540 5.3175 10.6349 0.0948 Constraint 77 572 5.9095 7.3869 14.7738 0.0948 Constraint 11 1054 5.9697 7.4621 14.9243 0.0948 Constraint 1466 1777 5.9881 7.4852 14.9703 0.0948 Constraint 47 1030 4.4794 5.5992 11.1985 0.0948 Constraint 756 1158 6.0063 7.5079 15.0159 0.0947 Constraint 722 1158 4.8906 6.1133 12.2265 0.0947 Constraint 1358 1603 5.5314 6.9142 13.8285 0.0947 Constraint 1068 1366 5.6429 7.0537 14.1073 0.0946 Constraint 722 1022 4.2902 5.3627 10.7254 0.0946 Constraint 572 848 5.0302 6.2878 12.5756 0.0946 Constraint 706 968 5.1893 6.4867 12.9733 0.0945 Constraint 630 944 5.6935 7.1169 14.2338 0.0945 Constraint 980 1334 5.0456 6.3070 12.6140 0.0945 Constraint 1309 1399 5.5663 6.9579 13.9157 0.0943 Constraint 294 665 5.7299 7.1624 14.3249 0.0942 Constraint 1092 1251 6.1418 7.6773 15.3546 0.0942 Constraint 1014 1220 4.4314 5.5393 11.0786 0.0942 Constraint 899 1022 5.6041 7.0051 14.0102 0.0942 Constraint 1391 1494 5.6092 7.0115 14.0231 0.0941 Constraint 1519 1649 4.7388 5.9235 11.8470 0.0941 Constraint 997 1239 5.3835 6.7294 13.4588 0.0940 Constraint 392 572 5.1424 6.4280 12.8560 0.0940 Constraint 1178 1611 4.0287 5.0359 10.0718 0.0940 Constraint 1046 1149 5.6881 7.1101 14.2202 0.0940 Constraint 1167 1382 4.5979 5.7474 11.4949 0.0940 Constraint 731 1059 5.0310 6.2887 12.5774 0.0940 Constraint 1084 1309 4.6370 5.7963 11.5925 0.0939 Constraint 899 1014 5.9634 7.4543 14.9086 0.0939 Constraint 1284 1391 5.6159 7.0199 14.0398 0.0939 Constraint 347 608 5.3365 6.6706 13.3413 0.0938 Constraint 294 792 4.6663 5.8329 11.6659 0.0938 Constraint 549 1391 4.6156 5.7695 11.5389 0.0938 Constraint 435 713 5.0928 6.3661 12.7321 0.0938 Constraint 154 937 5.5138 6.8922 13.7845 0.0937 Constraint 3 698 4.1534 5.1917 10.3834 0.0937 Constraint 639 1293 5.7414 7.1767 14.3535 0.0937 Constraint 597 1268 5.0976 6.3720 12.7440 0.0937 Constraint 597 1260 5.5305 6.9131 13.8262 0.0937 Constraint 597 1239 5.5549 6.9436 13.8872 0.0937 Constraint 579 1030 5.1074 6.3842 12.7684 0.0935 Constraint 564 1008 4.9639 6.2048 12.4097 0.0935 Constraint 66 208 3.8545 4.8182 9.6363 0.0935 Constraint 616 1447 6.0698 7.5873 15.1745 0.0932 Constraint 18 1511 5.5446 6.9307 13.8614 0.0932 Constraint 208 1533 6.2472 7.8089 15.6179 0.0932 Constraint 1117 1382 5.1368 6.4210 12.8420 0.0931 Constraint 33 1213 4.9134 6.1417 12.2834 0.0930 Constraint 937 1466 4.6186 5.7733 11.5466 0.0930 Constraint 241 538 4.5912 5.7390 11.4781 0.0929 Constraint 421 884 5.4544 6.8180 13.6359 0.0929 Constraint 564 1408 5.6552 7.0691 14.1381 0.0928 Constraint 216 1141 5.3194 6.6493 13.2986 0.0928 Constraint 589 892 5.3802 6.7253 13.4505 0.0928 Constraint 1548 1720 5.3787 6.7234 13.4468 0.0927 Constraint 868 1293 5.2416 6.5520 13.1041 0.0927 Constraint 557 913 5.0046 6.2557 12.5114 0.0927 Constraint 164 1471 4.6235 5.7793 11.5587 0.0927 Constraint 222 937 4.4141 5.5176 11.0351 0.0927 Constraint 650 1008 5.4115 6.7644 13.5288 0.0926 Constraint 623 1059 4.4866 5.6082 11.2164 0.0926 Constraint 769 1084 4.8672 6.0841 12.1681 0.0926 Constraint 104 859 4.5928 5.7410 11.4820 0.0925 Constraint 1239 1427 4.8745 6.0931 12.1862 0.0925 Constraint 1030 1533 5.2688 6.5860 13.1719 0.0925 Constraint 955 1548 5.7752 7.2190 14.4379 0.0925 Constraint 457 1084 6.1408 7.6760 15.3521 0.0925 Constraint 443 944 5.6361 7.0452 14.0903 0.0925 Constraint 314 1228 5.1630 6.4538 12.9076 0.0925 Constraint 1059 1343 4.2812 5.3515 10.7029 0.0925 Constraint 47 222 4.5242 5.6553 11.3106 0.0925 Constraint 128 233 5.3874 6.7342 13.4684 0.0924 Constraint 963 1167 5.7912 7.2390 14.4779 0.0924 Constraint 657 800 4.7353 5.9192 11.8384 0.0923 Constraint 91 274 5.5362 6.9203 13.8406 0.0923 Constraint 66 299 3.9406 4.9258 9.8516 0.0923 Constraint 154 479 5.6289 7.0361 14.0722 0.0923 Constraint 616 1022 4.9446 6.1808 12.3616 0.0923 Constraint 421 623 4.8351 6.0438 12.0877 0.0923 Constraint 1334 1657 4.0504 5.0630 10.1261 0.0923 Constraint 1246 1438 4.7497 5.9371 11.8743 0.0923 Constraint 630 968 4.4658 5.5823 11.1646 0.0922 Constraint 572 859 4.2756 5.3445 10.6890 0.0921 Constraint 457 1077 6.1550 7.6938 15.3876 0.0921 Constraint 136 294 4.3888 5.4860 10.9720 0.0920 Constraint 1251 1683 6.2637 7.8296 15.6592 0.0920 Constraint 1035 1117 5.2553 6.5691 13.1381 0.0920 Constraint 1649 1748 3.6492 4.5615 9.1229 0.0920 Constraint 1494 1788 4.9778 6.2223 12.4446 0.0919 Constraint 1030 1519 4.8282 6.0353 12.0705 0.0918 Constraint 1008 1519 5.6782 7.0978 14.1955 0.0918 Constraint 443 608 4.5364 5.6705 11.3411 0.0918 Constraint 249 1739 5.1198 6.3998 12.7995 0.0918 Constraint 222 1731 5.4743 6.8428 13.6857 0.0918 Constraint 1046 1228 5.2983 6.6229 13.2459 0.0918 Constraint 731 1030 5.7881 7.2352 14.4703 0.0917 Constraint 180 285 5.1189 6.3986 12.7971 0.0917 Constraint 448 937 5.6562 7.0702 14.1405 0.0917 Constraint 739 1059 5.0083 6.2604 12.5208 0.0917 Constraint 997 1204 4.7187 5.8983 11.7967 0.0916 Constraint 392 623 5.5372 6.9215 13.8430 0.0915 Constraint 368 713 4.8938 6.1173 12.2346 0.0915 Constraint 97 980 4.8425 6.0532 12.1064 0.0915 Constraint 1268 1587 5.4892 6.8616 13.7231 0.0915 Constraint 1260 1556 4.1828 5.2286 10.4571 0.0915 Constraint 1046 1366 6.3073 7.8841 15.7682 0.0915 Constraint 868 1374 3.6434 4.5543 9.1086 0.0915 Constraint 681 968 5.2028 6.5035 13.0070 0.0915 Constraint 800 1268 5.0299 6.2873 12.5747 0.0914 Constraint 521 868 4.6693 5.8367 11.6733 0.0914 Constraint 510 937 6.0361 7.5451 15.0903 0.0914 Constraint 479 1239 5.7753 7.2191 14.4382 0.0914 Constraint 421 1141 6.0217 7.5271 15.0541 0.0914 Constraint 412 1133 4.9799 6.2249 12.4498 0.0914 Constraint 375 1133 5.7402 7.1753 14.3505 0.0914 Constraint 1109 1575 3.6498 4.5622 9.1245 0.0913 Constraint 77 944 4.7474 5.9343 11.8686 0.0912 Constraint 884 1133 5.2264 6.5330 13.0661 0.0912 Constraint 285 597 5.0776 6.3470 12.6940 0.0912 Constraint 538 848 5.0544 6.3181 12.6361 0.0911 Constraint 1100 1620 5.2043 6.5053 13.0107 0.0911 Constraint 783 1334 6.0866 7.6083 15.2166 0.0911 Constraint 589 921 5.4721 6.8401 13.6802 0.0910 Constraint 443 988 5.7221 7.1526 14.3052 0.0910 Constraint 1213 1587 6.3660 7.9575 15.9150 0.0910 Constraint 510 1084 4.9078 6.1348 12.2695 0.0909 Constraint 510 1077 5.5654 6.9568 13.9135 0.0909 Constraint 466 921 5.4207 6.7758 13.5517 0.0909 Constraint 403 1077 5.5019 6.8774 13.7548 0.0909 Constraint 403 1068 4.4976 5.6220 11.2439 0.0909 Constraint 392 868 6.1242 7.6552 15.3104 0.0909 Constraint 657 1100 5.7273 7.1591 14.3183 0.0909 Constraint 930 1466 4.5714 5.7143 11.4285 0.0908 Constraint 1416 1657 4.8025 6.0031 12.0062 0.0908 Constraint 39 222 3.4031 4.2539 8.5078 0.0907 Constraint 963 1193 5.4377 6.7971 13.5942 0.0907 Constraint 930 1193 6.1968 7.7460 15.4920 0.0907 Constraint 608 1167 4.2226 5.2782 10.5564 0.0907 Constraint 285 657 5.1849 6.4811 12.9622 0.0907 Constraint 77 384 5.3167 6.6458 13.2917 0.0907 Constraint 1035 1479 4.0577 5.0721 10.1442 0.0906 Constraint 435 884 5.6635 7.0794 14.1589 0.0906 Constraint 1276 1703 6.1496 7.6869 15.3739 0.0906 Constraint 1276 1683 4.9500 6.1875 12.3749 0.0906 Constraint 731 1391 6.0197 7.5247 15.0494 0.0906 Constraint 706 1374 5.5726 6.9658 13.9316 0.0906 Constraint 698 1374 3.1070 3.8837 7.7675 0.0906 Constraint 530 1494 5.1752 6.4690 12.9380 0.0906 Constraint 530 1351 5.7534 7.1917 14.3834 0.0906 Constraint 510 1149 5.8163 7.2704 14.5407 0.0906 Constraint 510 1141 4.4273 5.5342 11.0683 0.0906 Constraint 501 1567 4.9206 6.1508 12.3016 0.0906 Constraint 501 1556 4.4331 5.5414 11.0828 0.0906 Constraint 501 1533 5.6615 7.0769 14.1537 0.0906 Constraint 196 549 5.8180 7.2725 14.5449 0.0906 Constraint 154 1228 6.2373 7.7966 15.5932 0.0906 Constraint 154 1141 5.4068 6.7585 13.5171 0.0906 Constraint 104 1260 5.6072 7.0090 14.0181 0.0906 Constraint 97 1228 4.7065 5.8831 11.7662 0.0906 Constraint 1399 1764 5.3448 6.6810 13.3619 0.0906 Constraint 690 921 5.9144 7.3930 14.7859 0.0906 Constraint 47 1213 4.9224 6.1530 12.3060 0.0906 Constraint 748 1556 5.7583 7.1979 14.3957 0.0906 Constraint 443 1054 6.0023 7.5028 15.0056 0.0906 Constraint 435 1046 5.3120 6.6400 13.2800 0.0906 Constraint 363 892 5.1131 6.3914 12.7827 0.0906 Constraint 1125 1284 4.9514 6.1893 12.3785 0.0904 Constraint 955 1603 4.8065 6.0082 12.0163 0.0904 Constraint 39 233 4.4408 5.5510 11.1021 0.0904 Constraint 1035 1533 4.9997 6.2496 12.4992 0.0903 Constraint 1382 1720 3.7678 4.7098 9.4195 0.0903 Constraint 1309 1603 6.0819 7.6023 15.2046 0.0903 Constraint 564 1141 5.0326 6.2907 12.5815 0.0903 Constraint 256 487 5.7484 7.1854 14.3709 0.0901 Constraint 59 1059 4.0373 5.0466 10.0932 0.0900 Constraint 47 1059 6.0661 7.5826 15.1652 0.0900 Constraint 47 1046 5.5003 6.8754 13.7508 0.0900 Constraint 33 1046 3.9096 4.8870 9.7740 0.0900 Constraint 908 1014 4.4472 5.5590 11.1179 0.0900 Constraint 1455 1634 4.5794 5.7242 11.4484 0.0899 Constraint 756 937 5.3820 6.7275 13.4551 0.0899 Constraint 1548 1731 4.3527 5.4408 10.8817 0.0899 Constraint 1077 1692 5.1231 6.4039 12.8079 0.0899 Constraint 274 375 5.6761 7.0951 14.1903 0.0898 Constraint 1284 1479 3.8261 4.7826 9.5653 0.0897 Constraint 921 1399 5.5643 6.9554 13.9108 0.0896 Constraint 748 884 5.3813 6.7266 13.4532 0.0896 Constraint 299 530 5.0871 6.3589 12.7177 0.0895 Constraint 104 1109 4.0601 5.0752 10.1504 0.0894 Constraint 1548 1657 4.2496 5.3120 10.6240 0.0894 Constraint 1059 1193 5.1192 6.3990 12.7981 0.0893 Constraint 1054 1178 5.1100 6.3875 12.7749 0.0893 Constraint 1133 1567 5.0653 6.3316 12.6633 0.0893 Constraint 673 968 3.7503 4.6879 9.3758 0.0892 Constraint 33 222 5.0020 6.2525 12.5050 0.0892 Constraint 955 1494 5.3455 6.6818 13.3637 0.0892 Constraint 479 868 5.4438 6.8047 13.6094 0.0892 Constraint 189 876 4.9006 6.1258 12.2516 0.0892 Constraint 233 706 5.7163 7.1454 14.2909 0.0891 Constraint 848 1366 5.6576 7.0720 14.1440 0.0891 Constraint 1351 1466 5.7257 7.1571 14.3142 0.0891 Constraint 1008 1204 5.2199 6.5248 13.0497 0.0891 Constraint 241 1567 5.5024 6.8780 13.7560 0.0890 Constraint 1399 1692 5.6037 7.0047 14.0094 0.0890 Constraint 955 1158 5.0609 6.3261 12.6522 0.0890 Constraint 761 884 4.8673 6.0841 12.1681 0.0890 Constraint 164 457 5.7671 7.2089 14.4179 0.0890 Constraint 66 285 5.2268 6.5335 13.0671 0.0889 Constraint 18 222 4.4037 5.5046 11.0092 0.0889 Constraint 82 892 3.5533 4.4417 8.8834 0.0889 Constraint 808 1533 3.9352 4.9191 9.8381 0.0889 Constraint 800 1533 5.5619 6.9523 13.9046 0.0889 Constraint 216 285 5.9484 7.4355 14.8711 0.0888 Constraint 1035 1246 4.6868 5.8585 11.7170 0.0888 Constraint 623 884 6.2674 7.8343 15.6685 0.0888 Constraint 47 1008 5.7563 7.1954 14.3907 0.0888 Constraint 164 421 6.1481 7.6851 15.3702 0.0887 Constraint 616 1408 6.1062 7.6328 15.2656 0.0887 Constraint 1092 1334 5.3125 6.6406 13.2813 0.0886 Constraint 487 690 5.1264 6.4080 12.8161 0.0886 Constraint 180 325 4.6568 5.8210 11.6420 0.0886 Constraint 77 189 4.6188 5.7735 11.5470 0.0886 Constraint 384 597 5.7134 7.1418 14.2836 0.0886 Constraint 564 836 4.6855 5.8569 11.7138 0.0886 Constraint 1334 1548 5.6513 7.0641 14.1283 0.0886 Constraint 739 1438 5.4436 6.8045 13.6090 0.0885 Constraint 1374 1670 5.0172 6.2715 12.5429 0.0885 Constraint 256 435 4.9847 6.2309 12.4618 0.0884 Constraint 368 690 4.5358 5.6698 11.3396 0.0882 Constraint 403 521 4.4158 5.5198 11.0396 0.0882 Constraint 673 955 5.2624 6.5780 13.1561 0.0882 Constraint 616 1084 4.0574 5.0718 10.1436 0.0881 Constraint 876 1204 5.3578 6.6973 13.3946 0.0881 Constraint 1030 1438 5.6064 7.0081 14.0161 0.0880 Constraint 792 1046 4.6207 5.7758 11.5516 0.0879 Constraint 783 968 4.1759 5.2198 10.4397 0.0879 Constraint 980 1204 5.3800 6.7251 13.4501 0.0879 Constraint 493 980 6.0165 7.5206 15.0412 0.0878 Constraint 164 808 4.2068 5.2585 10.5170 0.0878 Constraint 1228 1596 5.9281 7.4102 14.8203 0.0877 Constraint 665 836 4.7864 5.9830 11.9661 0.0877 Constraint 650 876 4.6014 5.7518 11.5035 0.0877 Constraint 1260 1334 4.1985 5.2481 10.4962 0.0877 Constraint 1100 1391 5.1461 6.4327 12.8653 0.0877 Constraint 859 1374 5.0978 6.3723 12.7446 0.0877 Constraint 549 968 5.7054 7.1318 14.2636 0.0877 Constraint 435 608 4.7861 5.9827 11.9653 0.0877 Constraint 375 769 5.9164 7.3955 14.7910 0.0877 Constraint 66 233 5.1135 6.3919 12.7837 0.0877 Constraint 47 294 6.1953 7.7441 15.4882 0.0877 Constraint 673 1109 4.6047 5.7559 11.5118 0.0875 Constraint 899 1399 4.5817 5.7271 11.4542 0.0874 Constraint 868 1503 5.6948 7.1185 14.2371 0.0874 Constraint 778 1149 5.0435 6.3044 12.6087 0.0874 Constraint 1575 1756 5.3625 6.7031 13.4061 0.0872 Constraint 630 829 4.6650 5.8312 11.6624 0.0871 Constraint 368 564 4.7962 5.9952 11.9904 0.0871 Constraint 818 1603 5.9855 7.4819 14.9637 0.0870 Constraint 421 650 4.7581 5.9477 11.8954 0.0870 Constraint 836 1059 4.3729 5.4661 10.9321 0.0870 Constraint 1239 1611 5.9799 7.4749 14.9498 0.0869 Constraint 549 921 5.9062 7.3827 14.7654 0.0869 Constraint 435 859 5.8338 7.2923 14.5846 0.0869 Constraint 222 963 4.8507 6.0634 12.1267 0.0869 Constraint 1125 1447 5.4984 6.8730 13.7460 0.0869 Constraint 1022 1692 5.1451 6.4314 12.8627 0.0869 Constraint 597 706 5.9699 7.4624 14.9248 0.0869 Constraint 493 1649 4.3790 5.4738 10.9475 0.0869 Constraint 443 1193 5.7310 7.1637 14.3275 0.0869 Constraint 421 859 5.5063 6.8828 13.7657 0.0869 Constraint 189 1399 5.0136 6.2670 12.5341 0.0869 Constraint 164 1408 5.8779 7.3474 14.6948 0.0869 Constraint 112 739 5.0708 6.3385 12.6770 0.0869 Constraint 104 748 3.9603 4.9503 9.9007 0.0869 Constraint 97 739 5.4475 6.8094 13.6188 0.0869 Constraint 91 1503 6.2937 7.8672 15.7343 0.0869 Constraint 91 739 5.9200 7.4000 14.8000 0.0869 Constraint 77 800 4.7100 5.8875 11.7749 0.0869 Constraint 77 731 6.0735 7.5918 15.1837 0.0869 Constraint 47 731 5.2984 6.6230 13.2460 0.0869 Constraint 33 739 5.1232 6.4041 12.8081 0.0869 Constraint 25 748 3.9827 4.9784 9.9567 0.0869 Constraint 25 739 2.8221 3.5276 7.0552 0.0869 Constraint 18 739 5.5215 6.9018 13.8037 0.0869 Constraint 11 739 6.1513 7.6891 15.3782 0.0869 Constraint 3 739 3.1475 3.9344 7.8688 0.0869 Constraint 3 731 4.3652 5.4565 10.9130 0.0869 Constraint 1059 1657 4.6865 5.8581 11.7163 0.0868 Constraint 713 1268 4.8937 6.1171 12.2342 0.0868 Constraint 333 748 5.2709 6.5886 13.1771 0.0867 Constraint 829 1092 4.8204 6.0255 12.0510 0.0866 Constraint 630 1125 4.9764 6.2205 12.4409 0.0866 Constraint 216 1014 5.1510 6.4387 12.8775 0.0866 Constraint 256 698 5.8347 7.2934 14.5868 0.0866 Constraint 579 698 4.7051 5.8814 11.7628 0.0866 Constraint 128 443 4.8085 6.0106 12.0213 0.0866 Constraint 808 1239 4.2974 5.3718 10.7435 0.0865 Constraint 355 1748 5.2728 6.5910 13.1820 0.0865 Constraint 355 1100 4.9054 6.1318 12.2635 0.0865 Constraint 325 1748 6.0939 7.6174 15.2348 0.0865 Constraint 256 731 5.4725 6.8406 13.6811 0.0865 Constraint 579 876 3.6554 4.5693 9.1385 0.0865 Constraint 521 1408 4.9697 6.2121 12.4243 0.0864 Constraint 363 1030 5.7635 7.2044 14.4088 0.0864 Constraint 47 955 5.3301 6.6627 13.3253 0.0864 Constraint 589 884 5.4218 6.7772 13.5545 0.0864 Constraint 136 256 5.7541 7.1926 14.3852 0.0864 Constraint 1092 1382 4.7932 5.9915 11.9830 0.0864 Constraint 1068 1756 4.6994 5.8742 11.7484 0.0864 Constraint 792 1084 4.4580 5.5725 11.1449 0.0863 Constraint 538 748 5.0786 6.3482 12.6964 0.0863 Constraint 274 1438 4.7408 5.9260 11.8520 0.0863 Constraint 241 1438 5.0874 6.3592 12.7184 0.0863 Constraint 241 1399 5.7376 7.1720 14.3439 0.0863 Constraint 783 963 4.6792 5.8490 11.6981 0.0862 Constraint 510 681 4.6969 5.8712 11.7424 0.0862 Constraint 227 325 6.2462 7.8078 15.6155 0.0862 Constraint 848 1092 4.4972 5.6215 11.2430 0.0862 Constraint 136 306 5.1422 6.4277 12.8555 0.0862 Constraint 33 241 4.6973 5.8716 11.7432 0.0862 Constraint 256 466 4.0145 5.0181 10.0361 0.0860 Constraint 112 256 5.8781 7.3476 14.6952 0.0860 Constraint 623 800 4.7771 5.9714 11.9428 0.0860 Constraint 128 1351 5.0039 6.2549 12.5098 0.0859 Constraint 1251 1519 4.6973 5.8716 11.7432 0.0859 Constraint 1213 1325 4.9261 6.1576 12.3152 0.0859 Constraint 145 256 4.4779 5.5974 11.1948 0.0859 Constraint 285 521 4.4459 5.5574 11.1149 0.0859 Constraint 756 899 5.1324 6.4155 12.8310 0.0858 Constraint 673 1427 5.5277 6.9097 13.8194 0.0858 Constraint 196 1519 5.3742 6.7178 13.4355 0.0857 Constraint 435 597 4.9954 6.2443 12.4886 0.0857 Constraint 435 589 5.9028 7.3786 14.7571 0.0857 Constraint 988 1756 5.7025 7.1281 14.2563 0.0857 Constraint 713 1125 5.7443 7.1804 14.3608 0.0857 Constraint 1358 1683 5.2067 6.5083 13.0167 0.0857 Constraint 1141 1471 5.2634 6.5792 13.1584 0.0855 Constraint 104 189 4.4076 5.5095 11.0190 0.0854 Constraint 597 1084 5.3938 6.7422 13.4845 0.0854 Constraint 39 1059 5.4378 6.7972 13.5945 0.0854 Constraint 104 829 4.1587 5.1984 10.3968 0.0853 Constraint 650 963 4.5331 5.6664 11.3327 0.0852 Constraint 868 1703 5.8471 7.3089 14.6179 0.0852 Constraint 783 1703 5.7352 7.1690 14.3381 0.0852 Constraint 706 1141 5.8948 7.3685 14.7370 0.0852 Constraint 538 1014 5.4640 6.8300 13.6600 0.0852 Constraint 1416 1494 5.0274 6.2843 12.5686 0.0852 Constraint 368 479 5.2823 6.6028 13.2056 0.0852 Constraint 196 487 4.7299 5.9124 11.8248 0.0852 Constraint 510 783 5.3686 6.7108 13.4215 0.0851 Constraint 884 1343 5.0109 6.2637 12.5274 0.0850 Constraint 930 1092 5.9587 7.4484 14.8967 0.0849 Constraint 403 908 5.1640 6.4550 12.9100 0.0849 Constraint 325 665 6.2784 7.8480 15.6960 0.0849 Constraint 241 892 5.0533 6.3166 12.6332 0.0849 Constraint 77 466 4.4018 5.5022 11.0045 0.0849 Constraint 47 818 4.9673 6.2091 12.4181 0.0849 Constraint 47 457 4.3931 5.4914 10.9828 0.0849 Constraint 39 435 4.1408 5.1760 10.3521 0.0849 Constraint 479 1596 4.4430 5.5538 11.1076 0.0848 Constraint 375 493 5.8491 7.3113 14.6227 0.0848 Constraint 222 549 5.8196 7.2745 14.5489 0.0848 Constraint 1022 1213 6.1246 7.6557 15.3115 0.0847 Constraint 884 1351 4.9136 6.1420 12.2841 0.0847 Constraint 479 1301 5.4559 6.8199 13.6398 0.0847 Constraint 412 572 5.3689 6.7112 13.4223 0.0847 Constraint 1526 1611 5.5955 6.9944 13.9889 0.0847 Constraint 1109 1334 5.6568 7.0710 14.1420 0.0847 Constraint 908 1008 5.2462 6.5578 13.1156 0.0847 Constraint 180 249 5.6013 7.0017 14.0033 0.0846 Constraint 443 892 5.6324 7.0405 14.0811 0.0846 Constraint 443 884 5.0407 6.3009 12.6018 0.0846 Constraint 913 1391 4.5692 5.7115 11.4230 0.0845 Constraint 121 1239 4.6778 5.8472 11.6944 0.0845 Constraint 1068 1427 4.8569 6.0712 12.1423 0.0845 Constraint 1059 1416 5.1850 6.4812 12.9625 0.0845 Constraint 859 1548 6.0080 7.5100 15.0199 0.0845 Constraint 501 829 4.3602 5.4502 10.9004 0.0845 Constraint 403 769 2.9980 3.7475 7.4949 0.0845 Constraint 1596 1764 4.6299 5.7874 11.5749 0.0845 Constraint 1309 1703 6.1399 7.6748 15.3497 0.0845 Constraint 1366 1678 4.1256 5.1570 10.3141 0.0845 Constraint 222 466 5.2708 6.5885 13.1770 0.0845 Constraint 690 884 4.6445 5.8056 11.6113 0.0845 Constraint 375 944 5.6953 7.1191 14.2382 0.0845 Constraint 249 937 3.4949 4.3687 8.7374 0.0845 Constraint 227 937 5.7862 7.2327 14.4655 0.0845 Constraint 189 963 4.8412 6.0515 12.1029 0.0845 Constraint 1416 1649 5.2728 6.5910 13.1820 0.0845 Constraint 800 1471 5.2912 6.6140 13.2280 0.0844 Constraint 769 1054 6.3639 7.9549 15.9097 0.0844 Constraint 848 1228 5.4771 6.8464 13.6928 0.0843 Constraint 1117 1447 4.7950 5.9938 11.9876 0.0843 Constraint 501 963 5.1874 6.4842 12.9684 0.0841 Constraint 1276 1714 4.8531 6.0663 12.1327 0.0840 Constraint 1603 1714 4.0310 5.0388 10.0775 0.0839 Constraint 868 1100 5.5621 6.9526 13.9053 0.0839 Constraint 1014 1213 4.5579 5.6974 11.3947 0.0838 Constraint 443 665 5.1777 6.4722 12.9443 0.0838 Constraint 112 421 4.9978 6.2473 12.4946 0.0838 Constraint 66 421 3.6692 4.5866 9.1731 0.0838 Constraint 530 1008 5.6240 7.0300 14.0600 0.0837 Constraint 1611 1731 4.9410 6.1763 12.3526 0.0836 Constraint 1268 1519 4.8244 6.0305 12.0610 0.0836 Constraint 299 510 4.7361 5.9201 11.8402 0.0836 Constraint 39 285 5.0760 6.3449 12.6899 0.0836 Constraint 930 1068 5.6965 7.1207 14.2413 0.0836 Constraint 1343 1662 4.7846 5.9807 11.9615 0.0836 Constraint 1391 1526 5.5285 6.9106 13.8212 0.0835 Constraint 82 1213 6.0828 7.6036 15.2071 0.0835 Constraint 347 665 5.6471 7.0589 14.1178 0.0835 Constraint 479 1077 4.7769 5.9711 11.9421 0.0834 Constraint 256 884 5.9512 7.4390 14.8780 0.0834 Constraint 227 836 5.2183 6.5229 13.0457 0.0832 Constraint 112 363 5.3217 6.6521 13.3043 0.0832 Constraint 783 1399 4.2851 5.3564 10.7127 0.0832 Constraint 665 963 6.0253 7.5316 15.0631 0.0832 Constraint 128 778 5.0832 6.3540 12.7079 0.0831 Constraint 930 1587 5.0168 6.2710 12.5420 0.0831 Constraint 665 1351 5.0324 6.2905 12.5810 0.0831 Constraint 59 899 5.5820 6.9775 13.9550 0.0831 Constraint 47 899 4.5880 5.7350 11.4700 0.0831 Constraint 47 892 5.0949 6.3686 12.7373 0.0831 Constraint 39 892 3.9243 4.9053 9.8107 0.0831 Constraint 33 876 4.6495 5.8119 11.6238 0.0831 Constraint 673 876 3.7599 4.6999 9.3997 0.0831 Constraint 294 997 4.1476 5.1845 10.3690 0.0830 Constraint 443 572 5.2564 6.5705 13.1411 0.0830 Constraint 930 1158 5.5551 6.9439 13.8878 0.0830 Constraint 466 557 5.6507 7.0634 14.1268 0.0830 Constraint 1204 1587 5.8878 7.3597 14.7194 0.0830 Constraint 1117 1603 4.6466 5.8083 11.6165 0.0830 Constraint 650 1054 5.7994 7.2492 14.4984 0.0829 Constraint 608 1030 5.5881 6.9851 13.9702 0.0829 Constraint 164 955 4.7210 5.9013 11.8026 0.0829 Constraint 698 1533 4.5888 5.7360 11.4720 0.0829 Constraint 510 848 5.1449 6.4311 12.8622 0.0828 Constraint 1213 1611 5.4919 6.8649 13.7299 0.0827 Constraint 479 908 5.1601 6.4501 12.9002 0.0827 Constraint 1014 1117 6.1106 7.6383 15.2766 0.0827 Constraint 630 1239 6.1737 7.7171 15.4342 0.0827 Constraint 466 1178 3.6863 4.6079 9.2158 0.0827 Constraint 375 1479 5.3193 6.6491 13.2982 0.0827 Constraint 39 756 4.1710 5.2137 10.4274 0.0827 Constraint 435 868 5.5147 6.8934 13.7868 0.0826 Constraint 1077 1149 5.0465 6.3081 12.6162 0.0826 Constraint 479 778 6.2646 7.8307 15.6615 0.0826 Constraint 1141 1276 5.2467 6.5584 13.1168 0.0826 Constraint 623 1408 5.0084 6.2604 12.5209 0.0825 Constraint 233 1777 6.3139 7.8924 15.7849 0.0825 Constraint 1317 1541 5.1362 6.4202 12.8404 0.0825 Constraint 1317 1503 4.8202 6.0253 12.0506 0.0825 Constraint 501 608 4.5097 5.6372 11.2743 0.0825 Constraint 1309 1479 5.3322 6.6652 13.3304 0.0824 Constraint 829 1533 5.5092 6.8865 13.7730 0.0823 Constraint 997 1731 4.5056 5.6320 11.2639 0.0823 Constraint 836 1488 6.2989 7.8736 15.7473 0.0823 Constraint 783 1611 5.7491 7.1864 14.3728 0.0823 Constraint 783 1603 5.0489 6.3111 12.6222 0.0823 Constraint 783 1575 5.8648 7.3310 14.6619 0.0823 Constraint 769 1309 5.8359 7.2948 14.5897 0.0823 Constraint 769 1284 5.5376 6.9220 13.8440 0.0823 Constraint 739 1301 4.1574 5.1967 10.3935 0.0823 Constraint 681 1178 5.0589 6.3237 12.6474 0.0823 Constraint 681 1158 4.2960 5.3700 10.7400 0.0823 Constraint 616 1720 4.3844 5.4805 10.9609 0.0823 Constraint 597 1748 3.9328 4.9160 9.8320 0.0823 Constraint 564 1777 5.3575 6.6969 13.3938 0.0823 Constraint 538 1228 5.5085 6.8856 13.7712 0.0823 Constraint 384 913 5.1762 6.4703 12.9405 0.0823 Constraint 384 899 6.2754 7.8442 15.6885 0.0823 Constraint 325 1158 5.0276 6.2845 12.5690 0.0823 Constraint 530 848 3.3652 4.2065 8.4130 0.0823 Constraint 227 299 5.5410 6.9263 13.8526 0.0823 Constraint 1059 1603 4.7461 5.9326 11.8651 0.0823 Constraint 1284 1455 4.7842 5.9802 11.9604 0.0822 Constraint 884 1649 5.5044 6.8805 13.7610 0.0821 Constraint 487 876 5.2522 6.5653 13.1305 0.0820 Constraint 1158 1268 4.5982 5.7478 11.4956 0.0820 Constraint 937 1649 5.6806 7.1008 14.2016 0.0820 Constraint 25 1022 4.5840 5.7300 11.4599 0.0820 Constraint 11 1035 5.7114 7.1393 14.2786 0.0820 Constraint 623 1014 4.8569 6.0711 12.1422 0.0820 Constraint 884 1526 5.0821 6.3526 12.7051 0.0820 Constraint 466 706 5.1824 6.4780 12.9561 0.0817 Constraint 564 1399 6.2419 7.8024 15.6047 0.0817 Constraint 564 1366 4.4302 5.5378 11.0755 0.0817 Constraint 530 1399 3.7100 4.6374 9.2749 0.0817 Constraint 530 1366 5.7438 7.1797 14.3594 0.0817 Constraint 521 1399 4.2170 5.2713 10.5425 0.0817 Constraint 493 1399 4.7366 5.9207 11.8415 0.0817 Constraint 493 1374 6.1408 7.6761 15.3521 0.0817 Constraint 487 1471 6.1302 7.6628 15.3255 0.0817 Constraint 363 1084 5.5783 6.9729 13.9458 0.0817 Constraint 233 1494 4.8948 6.1185 12.2370 0.0817 Constraint 222 1149 6.3590 7.9487 15.8974 0.0817 Constraint 222 1117 5.8488 7.3110 14.6220 0.0817 Constraint 216 1556 6.3036 7.8795 15.7590 0.0817 Constraint 216 1494 5.2333 6.5416 13.0832 0.0817 Constraint 263 403 5.4707 6.8384 13.6769 0.0817 Constraint 241 1167 5.8178 7.2722 14.5444 0.0817 Constraint 698 1511 5.4146 6.7683 13.5365 0.0817 Constraint 91 355 5.4438 6.8047 13.6095 0.0815 Constraint 1391 1692 4.9143 6.1429 12.2858 0.0814 Constraint 294 493 4.5498 5.6873 11.3745 0.0814 Constraint 263 501 5.3392 6.6739 13.3479 0.0814 Constraint 1455 1692 5.2611 6.5763 13.1527 0.0813 Constraint 306 639 5.6271 7.0339 14.0678 0.0813 Constraint 299 639 5.9351 7.4189 14.8378 0.0813 Constraint 274 792 5.2689 6.5861 13.1722 0.0813 Constraint 128 608 6.1694 7.7118 15.4235 0.0813 Constraint 128 589 4.7775 5.9719 11.9438 0.0813 Constraint 66 136 5.1594 6.4493 12.8986 0.0813 Constraint 112 208 4.8473 6.0592 12.1184 0.0813 Constraint 921 1251 5.3511 6.6889 13.3777 0.0811 Constraint 1193 1541 4.0475 5.0594 10.1187 0.0810 Constraint 690 783 4.9374 6.1718 12.3436 0.0810 Constraint 673 913 4.4953 5.6191 11.2381 0.0809 Constraint 673 868 3.8356 4.7945 9.5890 0.0809 Constraint 66 145 6.0961 7.6202 15.2403 0.0809 Constraint 435 564 5.4568 6.8210 13.6419 0.0809 Constraint 1204 1649 5.4702 6.8378 13.6755 0.0809 Constraint 128 216 5.1436 6.4294 12.8589 0.0809 Constraint 955 1670 5.0217 6.2771 12.5542 0.0809 Constraint 1068 1301 6.1181 7.6476 15.2952 0.0808 Constraint 690 930 5.1059 6.3824 12.7648 0.0808 Constraint 650 980 4.8986 6.1232 12.2464 0.0808 Constraint 630 1014 6.0342 7.5427 15.0855 0.0808 Constraint 868 1325 5.1235 6.4044 12.8088 0.0807 Constraint 521 808 4.2741 5.3427 10.6853 0.0807 Constraint 180 256 5.4540 6.8175 13.6349 0.0807 Constraint 487 589 5.0205 6.2756 12.5512 0.0807 Constraint 128 783 5.8100 7.2625 14.5250 0.0807 Constraint 1251 1670 4.3182 5.3977 10.7955 0.0807 Constraint 196 597 5.0820 6.3525 12.7051 0.0807 Constraint 739 848 4.5912 5.7390 11.4781 0.0807 Constraint 722 1455 5.2482 6.5602 13.1204 0.0807 Constraint 443 859 5.8512 7.3140 14.6279 0.0806 Constraint 739 1046 5.6823 7.1029 14.2058 0.0806 Constraint 921 1293 4.6209 5.7761 11.5522 0.0806 Constraint 639 1059 5.3180 6.6475 13.2950 0.0806 Constraint 164 579 5.3798 6.7248 13.4496 0.0806 Constraint 1399 1670 4.7673 5.9591 11.9182 0.0805 Constraint 249 963 5.7579 7.1974 14.3947 0.0805 Constraint 227 1731 3.4210 4.2762 8.5525 0.0804 Constraint 1343 1503 5.1061 6.3826 12.7653 0.0803 Constraint 1556 1764 5.0147 6.2683 12.5367 0.0802 Constraint 722 1100 5.9614 7.4518 14.9036 0.0802 Constraint 59 1046 5.8201 7.2751 14.5501 0.0802 Constraint 196 1374 5.0210 6.2762 12.5525 0.0802 Constraint 1228 1301 4.2376 5.2970 10.5940 0.0801 Constraint 1204 1301 4.9725 6.2156 12.4312 0.0801 Constraint 713 913 4.6703 5.8379 11.6758 0.0800 Constraint 299 1030 5.0071 6.2589 12.5178 0.0800 Constraint 876 1030 5.6450 7.0562 14.1125 0.0799 Constraint 403 608 4.9110 6.1387 12.2775 0.0799 Constraint 263 731 4.9174 6.1468 12.2936 0.0799 Constraint 1133 1358 4.7758 5.9697 11.9395 0.0799 Constraint 616 1035 5.0842 6.3553 12.7106 0.0798 Constraint 836 1213 6.0202 7.5252 15.0504 0.0798 Constraint 630 1092 4.9677 6.2097 12.4193 0.0797 Constraint 944 1117 4.4091 5.5114 11.0227 0.0797 Constraint 836 1141 6.1713 7.7142 15.4283 0.0797 Constraint 681 761 4.6558 5.8198 11.6396 0.0797 Constraint 579 800 5.3864 6.7330 13.4659 0.0797 Constraint 347 944 5.2072 6.5090 13.0179 0.0797 Constraint 333 968 3.9900 4.9875 9.9751 0.0797 Constraint 189 650 4.6659 5.8324 11.6647 0.0797 Constraint 616 1109 5.9606 7.4508 14.9015 0.0796 Constraint 1158 1382 3.8658 4.8323 9.6646 0.0796 Constraint 630 980 4.6519 5.8149 11.6298 0.0796 Constraint 884 1141 5.1282 6.4103 12.8206 0.0795 Constraint 1084 1382 5.2746 6.5932 13.1865 0.0794 Constraint 968 1526 5.7335 7.1669 14.3338 0.0794 Constraint 1167 1343 6.0012 7.5015 15.0031 0.0793 Constraint 172 256 4.9225 6.1531 12.3063 0.0792 Constraint 164 963 4.9763 6.2204 12.4408 0.0791 Constraint 913 1471 4.9640 6.2049 12.4099 0.0791 Constraint 657 1035 5.2112 6.5140 13.0280 0.0791 Constraint 1077 1334 4.4197 5.5246 11.0493 0.0791 Constraint 521 1670 5.0267 6.2834 12.5668 0.0791 Constraint 968 1125 4.4333 5.5416 11.0833 0.0790 Constraint 136 549 5.1003 6.3754 12.7507 0.0790 Constraint 1246 1519 4.8392 6.0490 12.0981 0.0790 Constraint 713 1246 6.3545 7.9431 15.8863 0.0790 Constraint 681 1455 5.8123 7.2654 14.5308 0.0790 Constraint 681 1416 6.1850 7.7313 15.4626 0.0790 Constraint 706 921 6.0347 7.5434 15.0868 0.0789 Constraint 530 1455 5.8250 7.2813 14.5625 0.0788 Constraint 530 1447 4.4751 5.5938 11.1877 0.0788 Constraint 1503 1764 5.0334 6.2918 12.5835 0.0788 Constraint 657 1141 5.3471 6.6838 13.3676 0.0788 Constraint 579 1399 5.6416 7.0520 14.1040 0.0788 Constraint 493 1014 4.3520 5.4400 10.8801 0.0788 Constraint 487 1014 4.1543 5.1928 10.3856 0.0788 Constraint 66 980 5.3844 6.7305 13.4610 0.0788 Constraint 657 1503 4.6439 5.8049 11.6098 0.0787 Constraint 1268 1526 5.3487 6.6859 13.3717 0.0787 Constraint 968 1059 5.3178 6.6473 13.2945 0.0787 Constraint 722 1260 5.9344 7.4180 14.8359 0.0787 Constraint 412 980 4.7864 5.9829 11.9659 0.0787 Constraint 384 1109 4.7752 5.9690 11.9381 0.0787 Constraint 128 1479 5.4378 6.7973 13.5946 0.0787 Constraint 564 859 5.6584 7.0730 14.1461 0.0786 Constraint 650 884 5.4664 6.8329 13.6659 0.0786 Constraint 884 1014 5.3225 6.6531 13.3063 0.0786 Constraint 493 963 5.4357 6.7947 13.5893 0.0786 Constraint 306 1030 5.2667 6.5833 13.1667 0.0786 Constraint 756 1511 5.4618 6.8272 13.6544 0.0786 Constraint 731 1167 5.0594 6.3242 12.6484 0.0786 Constraint 756 1133 4.7220 5.9024 11.8049 0.0785 Constraint 466 1447 5.1498 6.4372 12.8745 0.0785 Constraint 263 1567 5.3060 6.6325 13.2650 0.0785 Constraint 892 1141 6.0342 7.5427 15.0854 0.0785 Constraint 403 557 4.5246 5.6557 11.3114 0.0785 Constraint 713 1133 5.8020 7.2524 14.5049 0.0784 Constraint 572 1046 4.9748 6.2185 12.4370 0.0784 Constraint 1399 1756 5.4440 6.8050 13.6100 0.0784 Constraint 1519 1662 4.6589 5.8236 11.6472 0.0783 Constraint 1438 1548 4.5883 5.7353 11.4707 0.0783 Constraint 1427 1692 4.5370 5.6712 11.3425 0.0783 Constraint 1293 1526 5.4428 6.8036 13.6071 0.0783 Constraint 1141 1251 4.2297 5.2871 10.5742 0.0783 Constraint 937 1178 5.7261 7.1576 14.3153 0.0783 Constraint 800 1022 3.7025 4.6281 9.2562 0.0783 Constraint 521 769 2.8169 3.5212 7.0424 0.0783 Constraint 510 713 5.1036 6.3796 12.7591 0.0783 Constraint 479 681 5.1653 6.4566 12.9132 0.0783 Constraint 333 589 4.8302 6.0377 12.0754 0.0783 Constraint 136 347 3.6129 4.5161 9.0323 0.0783 Constraint 18 249 4.8981 6.1226 12.2452 0.0783 Constraint 501 892 4.5280 5.6599 11.3199 0.0783 Constraint 285 501 4.3401 5.4251 10.8501 0.0783 Constraint 216 1479 4.7010 5.8762 11.7524 0.0783 Constraint 91 608 6.1916 7.7395 15.4790 0.0783 Constraint 876 1772 5.0838 6.3547 12.7094 0.0783 Constraint 222 1438 5.0781 6.3477 12.6953 0.0783 Constraint 121 1503 4.8461 6.0576 12.1151 0.0783 Constraint 66 1438 5.4024 6.7529 13.5059 0.0783 Constraint 713 1293 5.2383 6.5479 13.0958 0.0782 Constraint 256 722 5.7375 7.1719 14.3437 0.0782 Constraint 1494 1620 6.0918 7.6147 15.2295 0.0782 Constraint 1149 1343 5.0088 6.2609 12.5219 0.0781 Constraint 1251 1657 5.6511 7.0639 14.1278 0.0781 Constraint 1228 1657 3.0637 3.8296 7.6591 0.0781 Constraint 1228 1634 5.0934 6.3667 12.7335 0.0781 Constraint 650 1117 5.5989 6.9986 13.9973 0.0781 Constraint 639 1317 4.8510 6.0638 12.1276 0.0781 Constraint 589 1239 5.4055 6.7568 13.5137 0.0781 Constraint 756 1030 4.4223 5.5279 11.0557 0.0780 Constraint 1141 1438 5.9066 7.3833 14.7666 0.0779 Constraint 368 608 4.7742 5.9678 11.9355 0.0779 Constraint 429 616 5.0422 6.3028 12.6055 0.0779 Constraint 597 1603 5.1807 6.4759 12.9518 0.0779 Constraint 82 274 5.0743 6.3429 12.6858 0.0778 Constraint 597 1046 5.0639 6.3298 12.6597 0.0777 Constraint 589 1046 5.6118 7.0147 14.0295 0.0777 Constraint 363 630 5.2843 6.6054 13.2107 0.0777 Constraint 698 1526 5.6237 7.0296 14.0592 0.0777 Constraint 706 829 4.2255 5.2818 10.5636 0.0777 Constraint 403 597 5.2726 6.5908 13.1816 0.0776 Constraint 530 808 4.4698 5.5872 11.1744 0.0776 Constraint 154 963 5.1999 6.4999 12.9998 0.0776 Constraint 1293 1541 5.6127 7.0159 14.0318 0.0776 Constraint 1239 1455 5.0543 6.3179 12.6357 0.0774 Constraint 808 1526 5.4752 6.8440 13.6880 0.0774 Constraint 479 944 5.5958 6.9948 13.9896 0.0774 Constraint 623 1046 5.5235 6.9044 13.8088 0.0773 Constraint 435 778 5.8648 7.3310 14.6620 0.0773 Constraint 66 216 5.1903 6.4879 12.9757 0.0772 Constraint 1204 1334 5.1225 6.4031 12.8062 0.0772 Constraint 227 355 5.7378 7.1723 14.3446 0.0772 Constraint 1133 1325 3.9854 4.9818 9.9636 0.0771 Constraint 690 988 5.2885 6.6107 13.2213 0.0771 Constraint 333 657 5.7539 7.1924 14.3848 0.0771 Constraint 172 263 5.3865 6.7331 13.4662 0.0770 Constraint 222 325 4.8286 6.0358 12.0715 0.0770 Constraint 589 706 5.9709 7.4637 14.9273 0.0770 Constraint 1022 1251 5.5059 6.8824 13.7648 0.0769 Constraint 196 557 4.1631 5.2039 10.4078 0.0769 Constraint 104 836 5.6246 7.0307 14.0615 0.0769 Constraint 66 412 4.8237 6.0296 12.0592 0.0769 Constraint 39 421 4.6169 5.7711 11.5422 0.0769 Constraint 3 355 5.1161 6.3951 12.7902 0.0769 Constraint 913 1479 4.3357 5.4196 10.8392 0.0769 Constraint 121 1133 4.7343 5.9179 11.8358 0.0769 Constraint 1158 1325 5.3661 6.7076 13.4152 0.0769 Constraint 955 1092 5.2264 6.5331 13.0661 0.0768 Constraint 630 884 5.3008 6.6261 13.2521 0.0767 Constraint 549 1117 5.9857 7.4821 14.9642 0.0767 Constraint 256 530 4.4452 5.5565 11.1129 0.0767 Constraint 589 1035 5.4597 6.8246 13.6493 0.0766 Constraint 1149 1494 5.2758 6.5947 13.1894 0.0766 Constraint 249 731 4.4465 5.5582 11.1163 0.0766 Constraint 33 706 5.4152 6.7690 13.5379 0.0766 Constraint 3 1092 3.8674 4.8343 9.6685 0.0766 Constraint 1251 1567 4.9117 6.1396 12.2793 0.0766 Constraint 800 1204 4.3020 5.3775 10.7550 0.0766 Constraint 39 325 6.0424 7.5530 15.1061 0.0766 Constraint 1611 1720 5.2062 6.5077 13.0154 0.0766 Constraint 783 1325 4.5756 5.7195 11.4389 0.0766 Constraint 769 988 6.1327 7.6659 15.3318 0.0766 Constraint 722 1519 6.2050 7.7563 15.5126 0.0766 Constraint 623 1399 4.9193 6.1491 12.2983 0.0766 Constraint 616 1399 3.3942 4.2427 8.4854 0.0766 Constraint 616 1374 4.3334 5.4167 10.8334 0.0766 Constraint 616 1366 5.4970 6.8712 13.7425 0.0766 Constraint 256 848 6.3344 7.9180 15.8359 0.0766 Constraint 208 657 6.1361 7.6701 15.3402 0.0766 Constraint 1109 1366 5.2682 6.5853 13.1706 0.0765 Constraint 128 921 5.8357 7.2947 14.5893 0.0764 Constraint 435 557 5.8240 7.2799 14.5599 0.0763 Constraint 1503 1587 5.1651 6.4563 12.9126 0.0763 Constraint 1438 1739 4.9023 6.1279 12.2558 0.0763 Constraint 1178 1567 3.5537 4.4421 8.8843 0.0762 Constraint 164 256 5.6203 7.0254 14.0508 0.0762 Constraint 937 1455 4.6037 5.7546 11.5092 0.0761 Constraint 479 1046 5.2334 6.5418 13.0836 0.0761 Constraint 435 997 5.2345 6.5432 13.0864 0.0761 Constraint 690 1141 5.7608 7.2010 14.4020 0.0759 Constraint 783 1447 6.0257 7.5321 15.0642 0.0757 Constraint 314 623 5.0534 6.3167 12.6334 0.0757 Constraint 1092 1731 3.6004 4.5005 9.0011 0.0757 Constraint 97 325 5.8910 7.3638 14.7276 0.0756 Constraint 1416 1662 5.5053 6.8817 13.7633 0.0756 Constraint 1149 1309 4.2407 5.3008 10.6017 0.0756 Constraint 368 589 4.4566 5.5708 11.1416 0.0756 Constraint 333 538 5.3685 6.7106 13.4211 0.0756 Constraint 274 510 4.7346 5.9183 11.8365 0.0756 Constraint 25 216 4.8176 6.0220 12.0441 0.0756 Constraint 510 836 5.3548 6.6935 13.3871 0.0756 Constraint 783 1077 4.8123 6.0154 12.0308 0.0756 Constraint 1374 1611 4.0884 5.1105 10.2210 0.0755 Constraint 1268 1662 6.0616 7.5770 15.1541 0.0755 Constraint 91 263 5.1851 6.4814 12.9627 0.0755 Constraint 59 299 5.4512 6.8140 13.6281 0.0755 Constraint 630 1447 5.9211 7.4014 14.8027 0.0755 Constraint 836 1351 5.2268 6.5335 13.0670 0.0755 Constraint 665 1678 5.5280 6.9100 13.8199 0.0755 Constraint 616 1030 3.2498 4.0623 8.1245 0.0755 Constraint 572 937 5.1397 6.4246 12.8493 0.0755 Constraint 538 884 5.0929 6.3661 12.7322 0.0755 Constraint 510 884 5.0973 6.3716 12.7432 0.0755 Constraint 501 884 3.4913 4.3641 8.7282 0.0755 Constraint 448 1046 5.5657 6.9572 13.9144 0.0755 Constraint 739 1054 4.0879 5.1098 10.2196 0.0754 Constraint 1260 1519 3.3662 4.2078 8.4155 0.0753 Constraint 1158 1317 3.6664 4.5829 9.1659 0.0753 Constraint 368 778 4.6878 5.8597 11.7194 0.0753 Constraint 868 1092 5.6089 7.0111 14.0222 0.0752 Constraint 82 325 5.3056 6.6320 13.2639 0.0752 Constraint 1084 1611 6.1976 7.7470 15.4940 0.0750 Constraint 731 1158 5.1831 6.4789 12.9578 0.0750 Constraint 189 392 5.7978 7.2473 14.4946 0.0750 Constraint 731 1471 4.7928 5.9910 11.9819 0.0749 Constraint 47 384 5.2847 6.6059 13.2118 0.0749 Constraint 681 1035 4.6941 5.8676 11.7353 0.0749 Constraint 314 501 5.4355 6.7944 13.5887 0.0749 Constraint 227 665 5.5659 6.9574 13.9147 0.0749 Constraint 104 314 4.5879 5.7349 11.4698 0.0748 Constraint 121 1100 5.6088 7.0111 14.0221 0.0748 Constraint 91 1133 6.0198 7.5247 15.0494 0.0748 Constraint 333 713 5.0543 6.3178 12.6357 0.0747 Constraint 1054 1748 5.5685 6.9606 13.9212 0.0747 Constraint 249 375 6.2173 7.7716 15.5432 0.0747 Constraint 104 792 5.4292 6.7866 13.5731 0.0747 Constraint 1620 1748 4.4186 5.5232 11.0464 0.0747 Constraint 1611 1777 5.9401 7.4251 14.8503 0.0747 Constraint 1587 1777 5.7237 7.1546 14.3092 0.0747 Constraint 1479 1777 5.5850 6.9813 13.9626 0.0747 Constraint 1358 1692 5.4489 6.8112 13.6223 0.0747 Constraint 1251 1438 6.1597 7.6996 15.3992 0.0747 Constraint 1239 1548 6.2323 7.7903 15.5807 0.0747 Constraint 1167 1511 3.4417 4.3021 8.6041 0.0747 Constraint 1158 1649 6.0337 7.5422 15.0844 0.0747 Constraint 1149 1526 4.9279 6.1599 12.3198 0.0747 Constraint 1141 1526 5.6727 7.0909 14.1817 0.0747 Constraint 1141 1519 3.3854 4.2317 8.4634 0.0747 Constraint 1046 1125 6.0675 7.5844 15.1688 0.0747 Constraint 1030 1366 4.3189 5.3987 10.7973 0.0747 Constraint 955 1587 5.0612 6.3264 12.6529 0.0747 Constraint 921 1014 5.6815 7.1019 14.2038 0.0747 Constraint 521 1084 4.5742 5.7177 11.4355 0.0747 Constraint 510 1068 5.8327 7.2909 14.5818 0.0747 Constraint 501 930 5.7996 7.2495 14.4990 0.0747 Constraint 493 930 4.7534 5.9417 11.8835 0.0747 Constraint 216 1084 4.8264 6.0331 12.0661 0.0747 Constraint 180 1059 5.8096 7.2620 14.5240 0.0747 Constraint 501 980 5.3658 6.7073 13.4146 0.0746 Constraint 1358 1466 5.5233 6.9041 13.8082 0.0746 Constraint 1117 1427 5.5404 6.9255 13.8510 0.0746 Constraint 836 1416 4.9691 6.2114 12.4228 0.0745 Constraint 530 1193 5.3060 6.6326 13.2651 0.0745 Constraint 1541 1649 6.1096 7.6370 15.2741 0.0745 Constraint 256 800 5.9160 7.3950 14.7900 0.0745 Constraint 690 1133 5.9800 7.4750 14.9500 0.0744 Constraint 1178 1309 4.7424 5.9280 11.8561 0.0744 Constraint 868 1117 5.4432 6.8040 13.6079 0.0744 Constraint 639 800 5.9106 7.3882 14.7764 0.0743 Constraint 128 997 4.2878 5.3598 10.7196 0.0743 Constraint 112 1109 5.5465 6.9331 13.8662 0.0743 Constraint 66 1046 5.0077 6.2596 12.5192 0.0743 Constraint 466 1720 4.6152 5.7691 11.5381 0.0743 Constraint 1399 1731 4.7013 5.8766 11.7532 0.0743 Constraint 189 1447 5.9241 7.4051 14.8103 0.0743 Constraint 154 1455 5.7515 7.1894 14.3788 0.0743 Constraint 1167 1471 4.5712 5.7140 11.4280 0.0743 Constraint 769 921 4.7714 5.9642 11.9285 0.0743 Constraint 501 623 5.0202 6.2752 12.5504 0.0742 Constraint 325 530 4.5872 5.7340 11.4680 0.0742 Constraint 1228 1343 4.2769 5.3461 10.6923 0.0741 Constraint 66 1014 5.4652 6.8315 13.6629 0.0741 Constraint 1587 1764 5.5040 6.8800 13.7600 0.0741 Constraint 657 1059 5.2212 6.5264 13.0529 0.0740 Constraint 355 623 4.9793 6.2242 12.4483 0.0740 Constraint 1239 1567 5.6697 7.0871 14.1743 0.0740 Constraint 47 937 4.1716 5.2145 10.4290 0.0740 Constraint 808 1596 5.5924 6.9905 13.9810 0.0740 Constraint 792 1077 5.1162 6.3953 12.7906 0.0739 Constraint 1427 1611 5.8537 7.3171 14.6342 0.0738 Constraint 39 241 5.5844 6.9804 13.9609 0.0738 Constraint 1141 1427 4.1495 5.1868 10.3737 0.0737 Constraint 706 1526 5.0160 6.2700 12.5399 0.0737 Constraint 355 510 5.9598 7.4497 14.8995 0.0735 Constraint 241 597 5.2543 6.5679 13.1358 0.0735 Constraint 1035 1519 5.0725 6.3406 12.6812 0.0735 Constraint 145 249 4.7724 5.9655 11.9309 0.0735 Constraint 227 616 5.0328 6.2910 12.5821 0.0733 Constraint 579 778 5.7185 7.1481 14.2963 0.0732 Constraint 466 792 5.5187 6.8984 13.7968 0.0732 Constraint 333 466 4.3422 5.4278 10.8555 0.0731 Constraint 59 1084 5.6477 7.0597 14.1193 0.0731 Constraint 233 549 4.3041 5.3802 10.7603 0.0730 Constraint 333 739 3.8126 4.7658 9.5315 0.0730 Constraint 1054 1204 4.9258 6.1572 12.3145 0.0730 Constraint 963 1556 4.7554 5.9443 11.8885 0.0730 Constraint 722 1541 6.2986 7.8733 15.7466 0.0730 Constraint 884 968 5.9544 7.4430 14.8860 0.0730 Constraint 988 1416 5.5166 6.8957 13.7915 0.0729 Constraint 538 963 4.8318 6.0397 12.0794 0.0729 Constraint 33 145 6.1322 7.6653 15.3305 0.0728 Constraint 997 1213 5.7104 7.1379 14.2759 0.0728 Constraint 722 1471 4.7674 5.9593 11.9186 0.0728 Constraint 657 783 5.4732 6.8415 13.6830 0.0728 Constraint 868 963 5.2382 6.5477 13.0955 0.0728 Constraint 355 698 4.6446 5.8057 11.6114 0.0728 Constraint 778 1100 5.6110 7.0138 14.0276 0.0728 Constraint 466 1479 4.3460 5.4325 10.8650 0.0727 Constraint 1149 1408 5.6138 7.0173 14.0346 0.0727 Constraint 510 792 4.4465 5.5581 11.1162 0.0727 Constraint 1611 1678 4.6791 5.8488 11.6977 0.0726 Constraint 1220 1301 4.1709 5.2136 10.4272 0.0726 Constraint 1167 1374 5.4920 6.8649 13.7299 0.0725 Constraint 1455 1720 6.2785 7.8482 15.6964 0.0725 Constraint 429 538 3.9529 4.9412 9.8823 0.0725 Constraint 913 1054 5.2666 6.5832 13.1665 0.0724 Constraint 1022 1399 4.8934 6.1168 12.2336 0.0724 Constraint 241 1692 5.7685 7.2106 14.4213 0.0724 Constraint 1022 1334 6.0645 7.5807 15.1613 0.0724 Constraint 673 1092 5.5677 6.9597 13.9193 0.0724 Constraint 673 1054 4.7933 5.9916 11.9833 0.0724 Constraint 403 698 4.6989 5.8736 11.7473 0.0724 Constraint 549 800 4.4205 5.5256 11.0513 0.0723 Constraint 1117 1748 4.0651 5.0814 10.1627 0.0723 Constraint 597 1100 4.7639 5.9549 11.9097 0.0723 Constraint 314 1284 5.8322 7.2902 14.5804 0.0723 Constraint 1228 1427 5.1053 6.3816 12.7631 0.0722 Constraint 501 713 4.3395 5.4244 10.8489 0.0722 Constraint 333 1046 5.4805 6.8506 13.7012 0.0721 Constraint 314 1068 5.5816 6.9771 13.9541 0.0721 Constraint 299 937 6.2508 7.8135 15.6269 0.0721 Constraint 172 457 4.5155 5.6443 11.2887 0.0721 Constraint 39 980 4.8177 6.0221 12.0443 0.0721 Constraint 968 1054 5.2395 6.5494 13.0989 0.0721 Constraint 657 778 4.6725 5.8407 11.6813 0.0721 Constraint 384 722 5.5081 6.8852 13.7704 0.0721 Constraint 783 1239 5.3305 6.6632 13.3263 0.0721 Constraint 783 1228 6.3407 7.9258 15.8517 0.0721 Constraint 713 1284 4.9424 6.1781 12.3561 0.0721 Constraint 713 1228 5.7389 7.1736 14.3472 0.0721 Constraint 690 1293 5.8963 7.3704 14.7407 0.0721 Constraint 429 549 6.3178 7.8973 15.7945 0.0721 Constraint 154 1479 3.5001 4.3751 8.7503 0.0721 Constraint 82 899 4.6413 5.8016 11.6032 0.0721 Constraint 66 884 6.2521 7.8152 15.6303 0.0721 Constraint 66 868 3.8279 4.7849 9.5697 0.0721 Constraint 681 892 4.8501 6.0626 12.1252 0.0720 Constraint 227 435 5.7227 7.1534 14.3068 0.0720 Constraint 997 1193 5.4080 6.7600 13.5199 0.0719 Constraint 937 1109 5.0714 6.3392 12.6784 0.0718 Constraint 899 1125 5.2767 6.5959 13.1917 0.0718 Constraint 892 1117 5.2417 6.5521 13.1042 0.0718 Constraint 33 208 5.5884 6.9855 13.9711 0.0718 Constraint 1014 1533 5.5136 6.8920 13.7840 0.0718 Constraint 859 1030 4.8489 6.0611 12.1221 0.0718 Constraint 572 792 5.1434 6.4293 12.8585 0.0718 Constraint 530 1054 5.4195 6.7744 13.5488 0.0717 Constraint 1351 1455 4.8939 6.1174 12.2348 0.0717 Constraint 608 1046 5.4620 6.8275 13.6551 0.0716 Constraint 944 1149 5.6940 7.1174 14.2349 0.0716 Constraint 955 1519 4.2454 5.3068 10.6136 0.0715 Constraint 1149 1731 5.7811 7.2264 14.4528 0.0715 Constraint 530 1125 5.5848 6.9810 13.9619 0.0715 Constraint 493 955 3.5406 4.4258 8.8516 0.0715 Constraint 435 1077 5.2206 6.5257 13.0514 0.0715 Constraint 769 1077 5.7390 7.1738 14.3476 0.0714 Constraint 1167 1438 5.9304 7.4131 14.8261 0.0713 Constraint 650 988 6.0972 7.6215 15.2430 0.0713 Constraint 650 955 5.7601 7.2002 14.4003 0.0713 Constraint 639 955 5.8612 7.3265 14.6531 0.0713 Constraint 997 1720 5.2095 6.5119 13.0238 0.0713 Constraint 121 241 4.9333 6.1666 12.3332 0.0712 Constraint 722 1268 5.3817 6.7271 13.4542 0.0712 Constraint 1046 1777 5.3871 6.7338 13.4677 0.0712 Constraint 930 1014 4.9574 6.1967 12.3935 0.0712 Constraint 608 756 4.7345 5.9181 11.8362 0.0712 Constraint 368 1438 5.4319 6.7898 13.5797 0.0712 Constraint 333 1438 6.0603 7.5754 15.1508 0.0712 Constraint 66 1471 5.2881 6.6101 13.2202 0.0712 Constraint 1092 1692 4.1596 5.1995 10.3990 0.0711 Constraint 39 227 5.3796 6.7246 13.4491 0.0711 Constraint 579 1366 3.9290 4.9112 9.8224 0.0710 Constraint 1109 1358 4.6215 5.7769 11.5537 0.0710 Constraint 597 1030 5.6021 7.0026 14.0052 0.0709 Constraint 549 836 5.0181 6.2726 12.5452 0.0709 Constraint 1556 1788 5.9702 7.4628 14.9256 0.0708 Constraint 1494 1720 5.1250 6.4062 12.8124 0.0708 Constraint 1276 1351 4.4321 5.5402 11.0804 0.0708 Constraint 1158 1358 5.9231 7.4038 14.8077 0.0708 Constraint 1149 1276 4.6807 5.8509 11.7019 0.0708 Constraint 1125 1391 3.9463 4.9329 9.8657 0.0708 Constraint 1125 1358 4.8133 6.0166 12.0332 0.0708 Constraint 1092 1427 3.5310 4.4137 8.8275 0.0708 Constraint 1077 1603 4.9490 6.1863 12.3725 0.0708 Constraint 1035 1466 3.3916 4.2396 8.4791 0.0708 Constraint 1035 1391 3.9506 4.9382 9.8765 0.0708 Constraint 1008 1575 6.1802 7.7252 15.4504 0.0708 Constraint 980 1575 4.9671 6.2088 12.4177 0.0708 Constraint 968 1141 5.3069 6.6336 13.2672 0.0708 Constraint 963 1100 6.2687 7.8358 15.6717 0.0708 Constraint 955 1309 5.1736 6.4671 12.9341 0.0708 Constraint 944 1334 5.3098 6.6372 13.2744 0.0708 Constraint 944 1309 4.7058 5.8823 11.7645 0.0708 Constraint 930 1548 4.8677 6.0846 12.1692 0.0708 Constraint 930 1526 4.9437 6.1797 12.3594 0.0708 Constraint 921 1309 5.1440 6.4300 12.8599 0.0708 Constraint 899 1692 6.1154 7.6442 15.2885 0.0708 Constraint 899 1575 6.1530 7.6912 15.3824 0.0708 Constraint 884 1213 3.4180 4.2725 8.5450 0.0708 Constraint 884 1204 4.8778 6.0972 12.1945 0.0708 Constraint 884 1149 5.4566 6.8208 13.6416 0.0708 Constraint 876 1692 6.3268 7.9085 15.8169 0.0708 Constraint 868 1692 5.7645 7.2057 14.4113 0.0708 Constraint 859 1479 5.6330 7.0413 14.0825 0.0708 Constraint 859 1382 4.6752 5.8441 11.6881 0.0708 Constraint 859 1158 3.1040 3.8800 7.7599 0.0708 Constraint 848 1213 5.1221 6.4026 12.8052 0.0708 Constraint 829 1220 5.6060 7.0075 14.0150 0.0708 Constraint 818 1246 5.9548 7.4436 14.8871 0.0708 Constraint 808 1764 4.6641 5.8302 11.6603 0.0708 Constraint 800 1284 5.3241 6.6551 13.3102 0.0708 Constraint 800 1246 5.4864 6.8580 13.7161 0.0708 Constraint 783 1788 5.7741 7.2177 14.4353 0.0708 Constraint 783 1772 5.2754 6.5942 13.1885 0.0708 Constraint 783 1764 5.0305 6.2881 12.5761 0.0708 Constraint 783 1739 6.2427 7.8034 15.6069 0.0708 Constraint 783 937 5.5911 6.9889 13.9778 0.0708 Constraint 761 1739 6.3567 7.9459 15.8918 0.0708 Constraint 761 899 5.6223 7.0279 14.0557 0.0708 Constraint 756 1764 5.5230 6.9037 13.8074 0.0708 Constraint 756 1739 4.8274 6.0343 12.0685 0.0708 Constraint 748 1109 4.9505 6.1882 12.3764 0.0708 Constraint 731 1772 6.3011 7.8764 15.7528 0.0708 Constraint 665 1133 5.5112 6.8890 13.7781 0.0708 Constraint 665 1022 3.3453 4.1816 8.3632 0.0708 Constraint 557 859 5.2539 6.5674 13.1347 0.0708 Constraint 538 1239 5.0239 6.2799 12.5597 0.0708 Constraint 538 1167 5.9556 7.4446 14.8891 0.0708 Constraint 530 1141 6.3492 7.9365 15.8731 0.0708 Constraint 521 876 5.5359 6.9198 13.8396 0.0708 Constraint 510 1246 5.4942 6.8678 13.7356 0.0708 Constraint 510 1239 4.0829 5.1036 10.2071 0.0708 Constraint 510 1178 5.7048 7.1310 14.2619 0.0708 Constraint 501 1109 5.4897 6.8622 13.7243 0.0708 Constraint 493 876 5.5793 6.9741 13.9483 0.0708 Constraint 479 1293 3.8119 4.7649 9.5297 0.0708 Constraint 479 1246 4.1233 5.1541 10.3083 0.0708 Constraint 466 681 2.9895 3.7369 7.4738 0.0708 Constraint 466 657 3.8028 4.7535 9.5070 0.0708 Constraint 457 1325 6.0840 7.6050 15.2101 0.0708 Constraint 448 1358 6.2980 7.8725 15.7450 0.0708 Constraint 448 1325 2.4510 3.0638 6.1276 0.0708 Constraint 448 1317 5.7054 7.1317 14.2634 0.0708 Constraint 448 1301 5.1995 6.4994 12.9989 0.0708 Constraint 448 1293 4.9666 6.2083 12.4166 0.0708 Constraint 443 1325 6.0277 7.5346 15.0692 0.0708 Constraint 435 1117 5.9472 7.4340 14.8680 0.0708 Constraint 435 1109 3.4981 4.3726 8.7452 0.0708 Constraint 435 944 5.8415 7.3018 14.6037 0.0708 Constraint 435 748 5.4525 6.8157 13.6314 0.0708 Constraint 429 1358 6.3862 7.9828 15.9656 0.0708 Constraint 429 1325 5.7414 7.1767 14.3534 0.0708 Constraint 421 1382 5.4938 6.8672 13.7345 0.0708 Constraint 421 1358 4.7777 5.9721 11.9443 0.0708 Constraint 421 1351 6.0502 7.5627 15.1254 0.0708 Constraint 421 1325 5.6023 7.0029 14.0059 0.0708 Constraint 421 1092 5.8797 7.3496 14.6992 0.0708 Constraint 421 1059 5.0001 6.2501 12.5002 0.0708 Constraint 412 739 5.1427 6.4284 12.8568 0.0708 Constraint 403 778 4.5291 5.6613 11.3227 0.0708 Constraint 403 739 6.0062 7.5078 15.0155 0.0708 Constraint 392 930 5.0621 6.3276 12.6552 0.0708 Constraint 384 1167 6.0390 7.5488 15.0975 0.0708 Constraint 384 739 5.8874 7.3592 14.7184 0.0708 Constraint 368 908 2.2993 2.8741 5.7482 0.0708 Constraint 355 1167 6.1750 7.7188 15.4376 0.0708 Constraint 306 997 6.0671 7.5839 15.1678 0.0708 Constraint 306 783 6.2068 7.7586 15.5171 0.0708 Constraint 294 1239 5.4689 6.8361 13.6721 0.0708 Constraint 294 1228 4.1065 5.1332 10.2663 0.0708 Constraint 285 1260 4.9161 6.1451 12.2901 0.0708 Constraint 285 997 5.7526 7.1907 14.3815 0.0708 Constraint 285 778 4.1325 5.1657 10.3313 0.0708 Constraint 256 1260 3.8490 4.8113 9.6225 0.0708 Constraint 256 1213 5.7770 7.2213 14.4426 0.0708 Constraint 233 892 5.8282 7.2852 14.5704 0.0708 Constraint 227 1325 6.2140 7.7674 15.5349 0.0708 Constraint 59 208 5.7191 7.1489 14.2977 0.0708 Constraint 59 196 6.2672 7.8340 15.6681 0.0708 Constraint 39 448 6.2085 7.7607 15.5214 0.0708 Constraint 33 333 4.9103 6.1379 12.2758 0.0708 Constraint 1519 1764 4.8859 6.1074 12.2149 0.0707 Constraint 673 1455 6.1527 7.6909 15.3818 0.0706 Constraint 435 980 5.4682 6.8352 13.6704 0.0706 Constraint 1178 1471 4.3629 5.4536 10.9071 0.0706 Constraint 1526 1657 4.3629 5.4536 10.9072 0.0705 Constraint 921 1022 4.6175 5.7719 11.5437 0.0704 Constraint 876 1046 5.5977 6.9971 13.9942 0.0704 Constraint 493 899 5.5816 6.9770 13.9540 0.0703 Constraint 189 487 4.4427 5.5533 11.1066 0.0703 Constraint 216 457 4.9451 6.1814 12.3627 0.0702 Constraint 196 510 5.0290 6.2863 12.5725 0.0702 Constraint 164 510 5.3679 6.7099 13.4198 0.0702 Constraint 11 1046 4.2341 5.2926 10.5853 0.0702 Constraint 172 274 5.3896 6.7371 13.4741 0.0702 Constraint 921 1035 5.9558 7.4448 14.8895 0.0702 Constraint 1399 1519 6.0012 7.5015 15.0030 0.0701 Constraint 1030 1100 4.3282 5.4102 10.8204 0.0701 Constraint 333 557 5.5302 6.9128 13.8256 0.0701 Constraint 104 263 5.3807 6.7259 13.4518 0.0701 Constraint 412 589 4.6930 5.8662 11.7324 0.0701 Constraint 1603 1772 4.3841 5.4801 10.9602 0.0701 Constraint 1035 1488 5.3561 6.6951 13.3902 0.0700 Constraint 1008 1455 5.6515 7.0644 14.1288 0.0700 Constraint 848 988 5.1188 6.3985 12.7969 0.0700 Constraint 800 1351 5.7439 7.1799 14.3598 0.0700 Constraint 769 1471 4.9935 6.2419 12.4837 0.0700 Constraint 216 487 4.8388 6.0485 12.0970 0.0700 Constraint 1334 1603 5.2410 6.5512 13.1025 0.0700 Constraint 756 1488 4.7966 5.9957 11.9914 0.0700 Constraint 713 1213 5.1840 6.4800 12.9600 0.0700 Constraint 112 510 4.5001 5.6251 11.2503 0.0699 Constraint 355 521 5.1440 6.4301 12.8601 0.0698 Constraint 299 597 5.0047 6.2558 12.5117 0.0698 Constraint 241 731 4.6755 5.8443 11.6887 0.0698 Constraint 808 884 4.5812 5.7265 11.4530 0.0698 Constraint 884 1100 6.1543 7.6929 15.3858 0.0697 Constraint 1239 1575 5.3743 6.7179 13.4359 0.0697 Constraint 673 1284 5.8527 7.3158 14.6317 0.0697 Constraint 579 748 5.0553 6.3191 12.6382 0.0697 Constraint 1399 1657 6.2152 7.7690 15.5381 0.0696 Constraint 1334 1649 6.2030 7.7537 15.5074 0.0696 Constraint 1260 1714 6.3426 7.9283 15.8566 0.0696 Constraint 761 1301 5.9293 7.4116 14.8232 0.0696 Constraint 706 997 4.6050 5.7563 11.5126 0.0696 Constraint 189 403 4.1008 5.1260 10.2521 0.0696 Constraint 1239 1399 5.3813 6.7266 13.4532 0.0696 Constraint 722 1284 5.0319 6.2899 12.5797 0.0695 Constraint 859 1014 4.5660 5.7075 11.4150 0.0695 Constraint 136 421 4.5037 5.6297 11.2593 0.0695 Constraint 1054 1334 5.2351 6.5439 13.0878 0.0695 Constraint 706 1022 3.7819 4.7273 9.4547 0.0694 Constraint 448 681 6.2157 7.7696 15.5392 0.0694 Constraint 112 189 5.2190 6.5238 13.0476 0.0694 Constraint 154 249 5.7800 7.2250 14.4500 0.0694 Constraint 39 249 5.4290 6.7862 13.5725 0.0694 Constraint 1670 1748 5.5113 6.8892 13.7783 0.0694 Constraint 572 739 5.4419 6.8024 13.6048 0.0694 Constraint 731 1533 5.7476 7.1845 14.3690 0.0693 Constraint 756 876 3.8543 4.8179 9.6358 0.0693 Constraint 91 325 5.4787 6.8484 13.6968 0.0692 Constraint 136 384 4.5407 5.6759 11.3519 0.0692 Constraint 208 698 5.5921 6.9901 13.9802 0.0691 Constraint 121 1703 5.6368 7.0460 14.0919 0.0691 Constraint 112 1731 4.6129 5.7661 11.5322 0.0691 Constraint 97 1731 6.1080 7.6350 15.2700 0.0691 Constraint 91 1731 3.8715 4.8394 9.6788 0.0691 Constraint 91 1720 5.7549 7.1937 14.3873 0.0691 Constraint 91 1703 3.8504 4.8130 9.6260 0.0691 Constraint 1167 1391 5.1413 6.4266 12.8533 0.0691 Constraint 913 1204 5.8828 7.3535 14.7069 0.0691 Constraint 908 1125 6.0189 7.5236 15.0472 0.0691 Constraint 325 690 5.7711 7.2139 14.4277 0.0691 Constraint 868 997 4.2440 5.3050 10.6101 0.0690 Constraint 818 1030 4.4951 5.6188 11.2377 0.0690 Constraint 510 690 5.5993 6.9991 13.9983 0.0690 Constraint 412 1479 4.5585 5.6981 11.3963 0.0690 Constraint 412 1471 4.8706 6.0883 12.1766 0.0690 Constraint 392 1466 5.5789 6.9736 13.9472 0.0690 Constraint 104 630 4.4914 5.6142 11.2284 0.0690 Constraint 944 1479 5.9746 7.4683 14.9365 0.0690 Constraint 136 778 5.8977 7.3721 14.7442 0.0690 Constraint 608 937 4.7288 5.9110 11.8219 0.0690 Constraint 608 930 3.7102 4.6377 9.2755 0.0690 Constraint 997 1756 4.8464 6.0580 12.1160 0.0690 Constraint 997 1748 4.0259 5.0323 10.0646 0.0690 Constraint 673 1416 4.9859 6.2324 12.4649 0.0689 Constraint 748 1567 4.4048 5.5060 11.0119 0.0689 Constraint 538 731 5.2194 6.5242 13.0485 0.0689 Constraint 435 690 6.0010 7.5012 15.0025 0.0689 Constraint 368 521 5.5491 6.9363 13.8727 0.0689 Constraint 249 1714 4.1865 5.2332 10.4663 0.0689 Constraint 227 1739 4.8481 6.0601 12.1202 0.0689 Constraint 222 1714 3.9126 4.8908 9.7816 0.0689 Constraint 25 196 4.6868 5.8584 11.7169 0.0689 Constraint 698 997 5.2383 6.5479 13.0959 0.0688 Constraint 274 713 5.8980 7.3725 14.7450 0.0687 Constraint 1325 1596 4.4789 5.5987 11.1973 0.0687 Constraint 421 868 5.1028 6.3785 12.7571 0.0686 Constraint 673 1133 5.5545 6.9431 13.8862 0.0686 Constraint 1228 1374 5.9966 7.4958 14.9916 0.0686 Constraint 1204 1438 4.6177 5.7722 11.5444 0.0686 Constraint 876 1374 5.7256 7.1571 14.3141 0.0686 Constraint 836 988 4.8745 6.0931 12.1861 0.0686 Constraint 493 608 5.6527 7.0659 14.1318 0.0686 Constraint 384 639 5.4574 6.8218 13.6436 0.0686 Constraint 33 196 5.1925 6.4906 12.9811 0.0686 Constraint 761 859 5.6319 7.0398 14.0796 0.0685 Constraint 1204 1533 5.1994 6.4993 12.9985 0.0683 Constraint 564 988 4.3160 5.3950 10.7901 0.0683 Constraint 557 988 5.1822 6.4777 12.9555 0.0683 Constraint 1022 1228 4.7776 5.9720 11.9439 0.0683 Constraint 189 589 4.6222 5.7778 11.5556 0.0682 Constraint 1133 1587 5.2299 6.5373 13.0746 0.0681 Constraint 145 623 4.9388 6.1735 12.3471 0.0681 Constraint 829 1548 5.8998 7.3747 14.7495 0.0681 Constraint 241 913 4.5985 5.7481 11.4962 0.0681 Constraint 112 325 4.7060 5.8826 11.7651 0.0680 Constraint 876 963 5.4276 6.7845 13.5691 0.0680 Constraint 1284 1692 5.6946 7.1182 14.2365 0.0679 Constraint 1276 1692 6.1988 7.7485 15.4969 0.0679 Constraint 1251 1692 6.2251 7.7813 15.5627 0.0679 Constraint 800 1466 5.4972 6.8715 13.7430 0.0679 Constraint 739 1408 3.9861 4.9826 9.9653 0.0679 Constraint 572 1084 6.0795 7.5994 15.1988 0.0679 Constraint 557 1494 4.8534 6.0667 12.1334 0.0679 Constraint 538 1109 6.2486 7.8107 15.6215 0.0679 Constraint 530 1567 5.2520 6.5649 13.1299 0.0679 Constraint 530 1533 4.5770 5.7212 11.4424 0.0679 Constraint 530 1503 5.8066 7.2582 14.5165 0.0679 Constraint 530 1408 4.3843 5.4804 10.9608 0.0679 Constraint 530 1382 4.8858 6.1072 12.2144 0.0679 Constraint 521 1533 6.3117 7.8896 15.7792 0.0679 Constraint 521 1447 4.7274 5.9092 11.8184 0.0679 Constraint 501 1596 4.2344 5.2930 10.5859 0.0679 Constraint 501 1587 6.3787 7.9734 15.9468 0.0679 Constraint 501 1141 4.8385 6.0481 12.0961 0.0679 Constraint 487 1149 5.6432 7.0540 14.1079 0.0679 Constraint 487 1141 4.7024 5.8780 11.7560 0.0679 Constraint 479 1567 4.7929 5.9911 11.9822 0.0679 Constraint 479 1556 3.8349 4.7936 9.5872 0.0679 Constraint 479 1533 6.0135 7.5169 15.0339 0.0679 Constraint 479 1141 4.8172 6.0215 12.0430 0.0679 Constraint 466 1084 5.6277 7.0346 14.0693 0.0679 Constraint 384 493 2.8592 3.5740 7.1479 0.0679 Constraint 384 487 5.8287 7.2859 14.5717 0.0679 Constraint 306 466 5.5670 6.9588 13.9175 0.0679 Constraint 233 1193 4.8914 6.1142 12.2284 0.0679 Constraint 233 1167 4.5929 5.7411 11.4822 0.0679 Constraint 216 1204 5.7297 7.1622 14.3243 0.0679 Constraint 216 1193 5.1827 6.4784 12.9567 0.0679 Constraint 216 1167 5.3648 6.7061 13.4121 0.0679 Constraint 180 1268 6.0765 7.5957 15.1913 0.0679 Constraint 180 1260 3.2081 4.0101 8.0202 0.0679 Constraint 180 1239 3.7037 4.6297 9.2593 0.0679 Constraint 164 1260 5.9990 7.4988 14.9976 0.0679 Constraint 154 1284 4.8303 6.0378 12.0757 0.0679 Constraint 154 1251 5.8301 7.2877 14.5754 0.0679 Constraint 154 1239 4.8001 6.0001 12.0003 0.0679 Constraint 154 1204 5.2933 6.6166 13.2332 0.0679 Constraint 128 1260 4.0266 5.0333 10.0665 0.0679 Constraint 121 1228 4.2493 5.3117 10.6233 0.0679 Constraint 104 1556 6.3269 7.9087 15.8173 0.0679 Constraint 97 1620 5.9128 7.3910 14.7819 0.0679 Constraint 97 1596 5.3145 6.6431 13.2862 0.0679 Constraint 97 1587 4.3717 5.4646 10.9291 0.0679 Constraint 97 1556 5.0886 6.3607 12.7214 0.0679 Constraint 97 1284 4.6939 5.8674 11.7348 0.0679 Constraint 97 1260 3.6623 4.5779 9.1558 0.0679 Constraint 97 1251 5.4758 6.8447 13.6894 0.0679 Constraint 91 1228 5.9110 7.3887 14.7774 0.0679 Constraint 294 1008 4.4685 5.5856 11.1712 0.0679 Constraint 892 1158 4.7100 5.8875 11.7750 0.0679 Constraint 657 808 5.9337 7.4171 14.8343 0.0679 Constraint 355 681 4.1228 5.1535 10.3070 0.0677 Constraint 597 1634 5.6110 7.0137 14.0275 0.0676 Constraint 756 1556 5.3174 6.6468 13.2936 0.0676 Constraint 859 1649 4.7147 5.8934 11.7868 0.0675 Constraint 836 1596 4.6522 5.8152 11.6304 0.0675 Constraint 1092 1714 4.8305 6.0381 12.0761 0.0674 Constraint 884 1251 5.8860 7.3574 14.7149 0.0674 Constraint 884 1220 5.3934 6.7418 13.4836 0.0674 Constraint 412 623 5.0968 6.3710 12.7421 0.0674 Constraint 403 792 5.1797 6.4747 12.9494 0.0674 Constraint 355 549 5.0225 6.2781 12.5562 0.0674 Constraint 227 630 5.6085 7.0106 14.0212 0.0674 Constraint 136 299 4.7686 5.9607 11.9215 0.0674 Constraint 59 955 4.5173 5.6466 11.2932 0.0674 Constraint 1246 1325 5.8131 7.2663 14.5327 0.0672 Constraint 608 892 4.1886 5.2357 10.4715 0.0672 Constraint 493 1084 5.5414 6.9268 13.8536 0.0672 Constraint 1494 1703 4.6243 5.7804 11.5608 0.0670 Constraint 1158 1756 5.5125 6.8906 13.7813 0.0669 Constraint 1100 1649 4.9104 6.1380 12.2761 0.0669 Constraint 363 1634 4.1414 5.1768 10.3536 0.0668 Constraint 363 1567 5.6836 7.1044 14.2089 0.0668 Constraint 355 1634 3.7249 4.6562 9.3124 0.0668 Constraint 355 1620 4.9991 6.2489 12.4979 0.0668 Constraint 25 256 4.9631 6.2038 12.4077 0.0668 Constraint 1014 1548 6.0182 7.5228 15.0455 0.0667 Constraint 412 1008 5.6522 7.0653 14.1305 0.0667 Constraint 706 937 4.0538 5.0672 10.1344 0.0667 Constraint 241 589 6.1657 7.7071 15.4141 0.0667 Constraint 778 1556 5.8838 7.3547 14.7094 0.0667 Constraint 778 963 4.9847 6.2309 12.4617 0.0666 Constraint 384 673 6.1211 7.6513 15.3027 0.0666 Constraint 128 829 5.0306 6.2883 12.5765 0.0666 Constraint 1117 1611 3.7736 4.7170 9.4340 0.0666 Constraint 11 1567 5.9258 7.4073 14.8145 0.0666 Constraint 11 1533 4.7453 5.9316 11.8632 0.0666 Constraint 1611 1748 6.1816 7.7270 15.4540 0.0666 Constraint 1141 1777 5.6178 7.0223 14.0446 0.0666 Constraint 1141 1334 5.5179 6.8973 13.7946 0.0666 Constraint 608 988 5.4265 6.7831 13.5663 0.0666 Constraint 557 756 4.0436 5.0545 10.1090 0.0666 Constraint 557 748 4.1571 5.1964 10.3928 0.0666 Constraint 549 1054 5.4466 6.8083 13.6165 0.0666 Constraint 530 1035 5.2367 6.5459 13.0918 0.0666 Constraint 368 1035 4.9940 6.2425 12.4850 0.0666 Constraint 97 968 4.7059 5.8823 11.7647 0.0666 Constraint 66 997 4.5466 5.6832 11.3665 0.0666 Constraint 1059 1309 5.9540 7.4425 14.8851 0.0666 Constraint 3 241 4.6207 5.7759 11.5517 0.0666 Constraint 241 375 5.7454 7.1818 14.3636 0.0664 Constraint 597 892 5.5763 6.9703 13.9406 0.0664 Constraint 479 783 4.7199 5.8999 11.7998 0.0664 Constraint 1343 1526 6.0528 7.5660 15.1319 0.0664 Constraint 1022 1092 5.2341 6.5426 13.0852 0.0664 Constraint 997 1068 5.5125 6.8906 13.7811 0.0664 Constraint 501 1008 5.9612 7.4515 14.9029 0.0664 Constraint 479 968 4.4383 5.5478 11.0957 0.0664 Constraint 466 997 6.2779 7.8473 15.6947 0.0664 Constraint 466 963 4.8886 6.1107 12.2214 0.0664 Constraint 306 739 4.6003 5.7503 11.5007 0.0664 Constraint 263 1325 3.9919 4.9898 9.9796 0.0664 Constraint 241 1301 6.0776 7.5970 15.1939 0.0664 Constraint 241 1268 4.7206 5.9008 11.8015 0.0664 Constraint 233 1325 6.0544 7.5680 15.1361 0.0664 Constraint 216 1575 4.9071 6.1339 12.2678 0.0664 Constraint 216 1301 5.7114 7.1392 14.2784 0.0664 Constraint 216 1276 5.9866 7.4832 14.9664 0.0664 Constraint 189 1246 5.2719 6.5899 13.1798 0.0664 Constraint 104 227 5.9500 7.4375 14.8749 0.0664 Constraint 39 1511 4.8995 6.1244 12.2488 0.0664 Constraint 121 233 4.9223 6.1529 12.3058 0.0663 Constraint 930 1109 4.8724 6.0904 12.1809 0.0663 Constraint 630 1167 5.9956 7.4946 14.9891 0.0663 Constraint 530 892 5.8824 7.3530 14.7060 0.0663 Constraint 403 713 4.9348 6.1686 12.3371 0.0663 Constraint 189 955 4.7196 5.8995 11.7989 0.0663 Constraint 189 921 4.8005 6.0006 12.0012 0.0663 Constraint 145 421 3.8040 4.7550 9.5099 0.0663 Constraint 136 333 4.1014 5.1267 10.2535 0.0663 Constraint 11 884 6.1919 7.7398 15.4796 0.0663 Constraint 572 836 6.0474 7.5592 15.1184 0.0663 Constraint 1358 1541 5.1241 6.4051 12.8101 0.0663 Constraint 306 722 5.2605 6.5756 13.1512 0.0663 Constraint 208 521 5.3219 6.6523 13.3047 0.0663 Constraint 1228 1399 5.0643 6.3304 12.6607 0.0662 Constraint 384 579 4.4485 5.5607 11.1214 0.0662 Constraint 375 623 5.1905 6.4881 12.9761 0.0662 Constraint 375 572 4.7370 5.9213 11.8426 0.0662 Constraint 808 1620 4.6351 5.7939 11.5878 0.0662 Constraint 557 1447 4.5716 5.7145 11.4290 0.0661 Constraint 538 892 6.2692 7.8365 15.6729 0.0661 Constraint 448 988 5.1317 6.4146 12.8293 0.0661 Constraint 448 980 5.5647 6.9559 13.9118 0.0661 Constraint 256 403 3.4824 4.3530 8.7059 0.0661 Constraint 955 1620 5.4231 6.7789 13.5578 0.0661 Constraint 899 1109 4.4636 5.5795 11.1590 0.0661 Constraint 876 1479 5.2905 6.6132 13.2263 0.0661 Constraint 47 1068 5.0140 6.2675 12.5351 0.0661 Constraint 3 876 3.6744 4.5930 9.1861 0.0661 Constraint 3 189 5.3180 6.6475 13.2949 0.0661 Constraint 1268 1692 5.8688 7.3360 14.6720 0.0660 Constraint 997 1649 5.4761 6.8451 13.6902 0.0660 Constraint 848 1035 4.7643 5.9554 11.9109 0.0660 Constraint 739 980 5.1915 6.4893 12.9786 0.0660 Constraint 564 921 6.2188 7.7734 15.5469 0.0660 Constraint 457 673 5.6664 7.0831 14.1661 0.0660 Constraint 263 665 4.6944 5.8680 11.7360 0.0660 Constraint 1149 1575 4.5382 5.6728 11.3456 0.0659 Constraint 739 1447 4.7059 5.8824 11.7648 0.0659 Constraint 713 1503 5.9357 7.4196 14.8391 0.0659 Constraint 392 997 6.0190 7.5237 15.0474 0.0659 Constraint 892 1317 5.0095 6.2618 12.5237 0.0656 Constraint 104 249 5.6014 7.0017 14.0034 0.0656 Constraint 1438 1788 5.1348 6.4185 12.8370 0.0656 Constraint 164 731 4.7254 5.9068 11.8135 0.0654 Constraint 892 1556 5.8768 7.3460 14.6920 0.0654 Constraint 892 1548 5.5101 6.8876 13.7753 0.0654 Constraint 892 1526 4.2594 5.3243 10.6485 0.0654 Constraint 769 963 5.4662 6.8328 13.6656 0.0654 Constraint 557 1141 5.9630 7.4538 14.9076 0.0654 Constraint 1117 1343 5.5355 6.9194 13.8387 0.0653 Constraint 1567 1748 4.6292 5.7865 11.5730 0.0653 Constraint 1611 1739 4.5390 5.6738 11.3475 0.0651 Constraint 1204 1748 6.2947 7.8683 15.7367 0.0651 Constraint 1100 1301 3.2381 4.0476 8.0952 0.0651 Constraint 1100 1276 5.8777 7.3471 14.6942 0.0651 Constraint 1014 1720 3.8801 4.8501 9.7003 0.0651 Constraint 988 1720 4.1961 5.2452 10.4903 0.0651 Constraint 988 1567 5.6448 7.0560 14.1120 0.0651 Constraint 963 1567 5.2265 6.5331 13.0663 0.0651 Constraint 739 1068 4.2154 5.2692 10.5384 0.0651 Constraint 722 1068 3.7428 4.6785 9.3570 0.0651 Constraint 579 1657 6.1016 7.6270 15.2541 0.0651 Constraint 579 1649 4.3119 5.3899 10.7798 0.0651 Constraint 557 1649 5.2190 6.5238 13.0475 0.0651 Constraint 549 1649 4.7671 5.9589 11.9178 0.0651 Constraint 493 988 4.8344 6.0430 12.0861 0.0651 Constraint 487 988 4.9731 6.2164 12.4327 0.0651 Constraint 457 876 6.0693 7.5866 15.1732 0.0651 Constraint 233 1260 4.7222 5.9028 11.8056 0.0651 Constraint 112 792 4.6130 5.7662 11.5324 0.0651 Constraint 97 1503 6.2828 7.8535 15.7069 0.0651 Constraint 59 1068 5.8131 7.2664 14.5328 0.0651 Constraint 59 1054 5.2991 6.6238 13.2477 0.0651 Constraint 33 1035 6.3689 7.9611 15.9222 0.0651 Constraint 761 1260 5.0155 6.2694 12.5387 0.0651 Constraint 1374 1692 4.7667 5.9584 11.9167 0.0651 Constraint 913 1703 5.7523 7.1903 14.3806 0.0651 Constraint 82 530 5.1568 6.4460 12.8920 0.0651 Constraint 77 443 5.7615 7.2019 14.4037 0.0651 Constraint 1133 1556 4.4467 5.5584 11.1168 0.0650 Constraint 1596 1739 4.6251 5.7814 11.5628 0.0650 Constraint 1100 1596 4.2812 5.3515 10.7030 0.0650 Constraint 1054 1692 5.9739 7.4674 14.9349 0.0650 Constraint 208 1317 5.7631 7.2039 14.4078 0.0650 Constraint 681 1059 5.8627 7.3283 14.6567 0.0649 Constraint 530 1416 4.6267 5.7834 11.5668 0.0649 Constraint 564 1077 4.7305 5.9132 11.8264 0.0649 Constraint 285 435 3.9462 4.9327 9.8655 0.0649 Constraint 249 466 3.9879 4.9849 9.9697 0.0649 Constraint 66 1204 5.5912 6.9890 13.9781 0.0649 Constraint 136 868 5.5926 6.9908 13.9815 0.0649 Constraint 1246 1567 4.3477 5.4347 10.8693 0.0649 Constraint 597 1054 4.6067 5.7584 11.5167 0.0648 Constraint 363 564 5.4084 6.7605 13.5210 0.0648 Constraint 136 241 5.8436 7.3046 14.6091 0.0648 Constraint 104 233 4.3710 5.4637 10.9274 0.0648 Constraint 930 1649 5.3966 6.7458 13.4915 0.0648 Constraint 892 1503 5.4796 6.8495 13.6989 0.0648 Constraint 892 1035 5.6129 7.0161 14.0322 0.0648 Constraint 868 1246 5.5148 6.8936 13.7871 0.0648 Constraint 698 1343 3.8070 4.7587 9.5175 0.0648 Constraint 222 457 5.6390 7.0487 14.0974 0.0647 Constraint 722 884 5.1399 6.4249 12.8498 0.0647 Constraint 1046 1772 4.8921 6.1151 12.2301 0.0646 Constraint 368 968 5.1646 6.4557 12.9114 0.0646 Constraint 1149 1471 5.5245 6.9056 13.8112 0.0644 Constraint 722 1678 4.8360 6.0450 12.0899 0.0644 Constraint 530 1246 4.6894 5.8618 11.7236 0.0644 Constraint 104 208 4.7937 5.9922 11.9843 0.0644 Constraint 112 521 4.9527 6.1909 12.3818 0.0644 Constraint 104 347 4.5742 5.7177 11.4355 0.0643 Constraint 868 1764 5.6980 7.1225 14.2450 0.0642 Constraint 868 1739 4.3072 5.3840 10.7681 0.0642 Constraint 589 1374 5.4069 6.7587 13.5173 0.0642 Constraint 466 1014 3.7245 4.6556 9.3112 0.0642 Constraint 412 1084 4.9391 6.1739 12.3477 0.0642 Constraint 412 1077 5.5776 6.9720 13.9440 0.0642 Constraint 363 639 5.3300 6.6625 13.3251 0.0642 Constraint 196 1284 5.0899 6.3624 12.7248 0.0642 Constraint 154 256 5.0667 6.3334 12.6667 0.0642 Constraint 112 347 3.9922 4.9902 9.9805 0.0642 Constraint 25 1092 4.0922 5.1152 10.2305 0.0642 Constraint 1596 1714 5.0589 6.3236 12.6472 0.0640 Constraint 128 306 4.9050 6.1312 12.2624 0.0640 Constraint 136 466 4.6377 5.7971 11.5941 0.0640 Constraint 1178 1649 4.7772 5.9715 11.9430 0.0640 Constraint 681 1125 5.9135 7.3919 14.7839 0.0640 Constraint 608 1125 5.3760 6.7199 13.4399 0.0640 Constraint 579 1670 5.6115 7.0144 14.0287 0.0640 Constraint 557 1670 5.0094 6.2618 12.5236 0.0640 Constraint 538 1022 5.7093 7.1366 14.2732 0.0640 Constraint 530 1703 5.2899 6.6124 13.2248 0.0640 Constraint 521 1692 5.5512 6.9390 13.8780 0.0640 Constraint 216 1343 4.9355 6.1694 12.3387 0.0640 Constraint 189 1374 4.1511 5.1889 10.3778 0.0640 Constraint 739 876 5.0195 6.2743 12.5486 0.0639 Constraint 713 908 5.4929 6.8661 13.7321 0.0639 Constraint 913 1720 5.5371 6.9214 13.8428 0.0639 Constraint 769 1268 5.6909 7.1137 14.2273 0.0639 Constraint 579 1167 5.4327 6.7909 13.5817 0.0639 Constraint 466 800 5.6811 7.1014 14.2027 0.0639 Constraint 355 756 4.0687 5.0858 10.1716 0.0639 Constraint 314 1054 5.2922 6.6152 13.2304 0.0639 Constraint 306 1054 5.6578 7.0722 14.1445 0.0639 Constraint 299 1408 5.0144 6.2680 12.5360 0.0639 Constraint 222 892 4.3100 5.3875 10.7751 0.0639 Constraint 154 997 4.6068 5.7585 11.5170 0.0639 Constraint 18 1109 5.1032 6.3790 12.7581 0.0639 Constraint 18 1068 5.1807 6.4758 12.9517 0.0639 Constraint 988 1204 5.2226 6.5283 13.0566 0.0638 Constraint 963 1204 6.1669 7.7086 15.4173 0.0638 Constraint 930 1358 4.2304 5.2880 10.5759 0.0638 Constraint 778 1438 3.8204 4.7755 9.5509 0.0638 Constraint 347 466 5.8111 7.2638 14.5277 0.0638 Constraint 1374 1678 4.6657 5.8322 11.6644 0.0637 Constraint 1343 1756 5.4249 6.7811 13.5621 0.0637 Constraint 368 572 5.2755 6.5943 13.1887 0.0637 Constraint 521 1548 4.8035 6.0044 12.0088 0.0637 Constraint 1343 1494 4.6858 5.8573 11.7146 0.0637 Constraint 1149 1334 4.5801 5.7252 11.4503 0.0637 Constraint 913 1620 5.1436 6.4295 12.8590 0.0636 Constraint 241 368 4.6967 5.8709 11.7418 0.0635 Constraint 630 937 4.9979 6.2474 12.4947 0.0635 Constraint 564 1035 5.2180 6.5225 13.0451 0.0635 Constraint 510 623 5.9434 7.4293 14.8586 0.0635 Constraint 112 249 5.3186 6.6483 13.2965 0.0635 Constraint 466 829 5.7174 7.1468 14.2935 0.0634 Constraint 457 722 4.6635 5.8294 11.6588 0.0634 Constraint 136 457 4.2831 5.3539 10.7078 0.0634 Constraint 39 1213 4.3934 5.4917 10.9835 0.0634 Constraint 39 1204 5.1562 6.4452 12.8904 0.0634 Constraint 756 1109 4.8038 6.0048 12.0096 0.0634 Constraint 681 1317 4.5686 5.7108 11.4215 0.0633 Constraint 963 1246 5.7913 7.2391 14.4783 0.0633 Constraint 955 1276 5.3402 6.6753 13.3505 0.0633 Constraint 299 616 5.3890 6.7362 13.4725 0.0633 Constraint 673 769 4.9045 6.1306 12.2613 0.0633 Constraint 630 783 4.3176 5.3970 10.7940 0.0632 Constraint 616 1260 4.6590 5.8238 11.6476 0.0632 Constraint 608 761 4.9636 6.2045 12.4090 0.0632 Constraint 227 557 4.7453 5.9316 11.8633 0.0632 Constraint 128 868 5.2210 6.5263 13.0525 0.0632 Constraint 128 836 4.0768 5.0960 10.1920 0.0632 Constraint 112 859 6.3318 7.9148 15.8296 0.0632 Constraint 97 412 6.2761 7.8451 15.6901 0.0632 Constraint 892 1239 4.6899 5.8624 11.7248 0.0631 Constraint 783 1046 5.0316 6.2895 12.5791 0.0631 Constraint 681 908 5.9091 7.3864 14.7728 0.0630 Constraint 630 876 3.5007 4.3759 8.7517 0.0630 Constraint 521 1416 5.9974 7.4968 14.9935 0.0630 Constraint 493 818 5.4189 6.7736 13.5472 0.0630 Constraint 572 808 4.5827 5.7284 11.4568 0.0629 Constraint 955 1756 5.3851 6.7314 13.4628 0.0629 Constraint 937 1416 5.9790 7.4738 14.9476 0.0629 Constraint 1587 1756 5.9349 7.4187 14.8374 0.0629 Constraint 1251 1620 5.1817 6.4771 12.9542 0.0629 Constraint 980 1343 4.2674 5.3343 10.6686 0.0629 Constraint 285 630 4.4692 5.5865 11.1730 0.0629 Constraint 39 392 5.6500 7.0625 14.1250 0.0629 Constraint 33 154 4.8073 6.0091 12.0182 0.0628 Constraint 1167 1466 5.4776 6.8470 13.6939 0.0628 Constraint 1178 1438 4.8330 6.0413 12.0825 0.0627 Constraint 241 1100 5.4132 6.7664 13.5329 0.0626 Constraint 1178 1447 5.1743 6.4678 12.9356 0.0625 Constraint 868 1479 3.9732 4.9665 9.9329 0.0625 Constraint 1309 1720 4.6183 5.7729 11.5458 0.0625 Constraint 698 1678 5.0226 6.2783 12.5566 0.0625 Constraint 673 1084 4.6757 5.8446 11.6891 0.0625 Constraint 180 347 5.4733 6.8417 13.6833 0.0625 Constraint 1046 1193 4.3536 5.4419 10.8839 0.0624 Constraint 189 368 4.2934 5.3668 10.7336 0.0624 Constraint 597 1670 4.8364 6.0455 12.0911 0.0623 Constraint 572 1077 4.2876 5.3595 10.7191 0.0623 Constraint 104 937 4.9833 6.2291 12.4583 0.0623 Constraint 1054 1503 5.2412 6.5515 13.1030 0.0622 Constraint 333 769 4.9803 6.2254 12.4508 0.0622 Constraint 249 521 5.8362 7.2952 14.5904 0.0622 Constraint 564 1374 4.8341 6.0426 12.0852 0.0622 Constraint 392 1030 3.8509 4.8137 9.6274 0.0622 Constraint 368 1030 5.4765 6.8456 13.6912 0.0622 Constraint 249 368 4.5200 5.6499 11.2999 0.0622 Constraint 241 457 5.3198 6.6498 13.2995 0.0622 Constraint 164 549 6.1696 7.7119 15.4239 0.0622 Constraint 97 1193 5.5155 6.8944 13.7889 0.0622 Constraint 121 216 5.7725 7.2157 14.4314 0.0621 Constraint 47 180 4.4075 5.5094 11.0189 0.0621 Constraint 1246 1575 4.1619 5.2024 10.4048 0.0621 Constraint 1220 1575 5.8053 7.2567 14.5133 0.0621 Constraint 690 1603 6.0477 7.5596 15.1192 0.0621 Constraint 690 1596 5.4864 6.8580 13.7161 0.0621 Constraint 681 1382 5.5408 6.9260 13.8519 0.0621 Constraint 368 597 4.9821 6.2276 12.4553 0.0621 Constraint 665 1548 6.1271 7.6589 15.3178 0.0621 Constraint 249 597 5.5168 6.8960 13.7919 0.0620 Constraint 955 1466 4.4492 5.5614 11.1229 0.0620 Constraint 25 1059 4.3334 5.4167 10.8334 0.0620 Constraint 1251 1756 5.4091 6.7614 13.5227 0.0620 Constraint 222 1503 5.1849 6.4811 12.9622 0.0619 Constraint 921 1391 5.5297 6.9121 13.8242 0.0619 Constraint 722 1141 4.2034 5.2542 10.5085 0.0619 Constraint 650 1077 5.9227 7.4034 14.8067 0.0619 Constraint 145 1526 5.5586 6.9482 13.8965 0.0619 Constraint 97 1008 5.5164 6.8955 13.7910 0.0619 Constraint 256 538 5.0164 6.2704 12.5409 0.0618 Constraint 77 180 3.5488 4.4360 8.8720 0.0618 Constraint 557 1077 5.7068 7.1335 14.2671 0.0618 Constraint 597 1382 4.9947 6.2434 12.4868 0.0618 Constraint 829 1438 6.3192 7.8990 15.7981 0.0618 Constraint 808 1511 4.0758 5.0947 10.1894 0.0618 Constraint 800 1511 5.6762 7.0953 14.1906 0.0618 Constraint 783 1511 5.3797 6.7246 13.4493 0.0618 Constraint 908 1239 4.3052 5.3815 10.7630 0.0617 Constraint 892 1519 6.0636 7.5795 15.1589 0.0617 Constraint 761 1084 6.2334 7.7918 15.5836 0.0617 Constraint 722 1511 4.4414 5.5518 11.1036 0.0617 Constraint 690 1533 4.0251 5.0313 10.0627 0.0617 Constraint 650 1692 4.1133 5.1417 10.2833 0.0617 Constraint 564 1260 5.2566 6.5708 13.1415 0.0617 Constraint 538 1260 4.8105 6.0132 12.0263 0.0617 Constraint 538 1251 5.1528 6.4410 12.8820 0.0617 Constraint 521 968 6.1761 7.7202 15.4403 0.0617 Constraint 501 908 6.1797 7.7247 15.4494 0.0617 Constraint 493 892 5.6515 7.0644 14.1288 0.0617 Constraint 487 829 3.8509 4.8136 9.6272 0.0617 Constraint 443 1022 5.0923 6.3654 12.7309 0.0617 Constraint 429 1748 3.8762 4.8453 9.6905 0.0617 Constraint 421 1054 4.4866 5.6082 11.2164 0.0617 Constraint 412 1777 5.1022 6.3777 12.7554 0.0617 Constraint 412 1772 4.7711 5.9639 11.9277 0.0617 Constraint 384 1777 5.3867 6.7334 13.4668 0.0617 Constraint 384 937 4.1241 5.1552 10.3103 0.0617 Constraint 363 921 5.0433 6.3041 12.6083 0.0617 Constraint 325 1133 5.4928 6.8660 13.7320 0.0617 Constraint 325 913 4.7446 5.9307 11.8614 0.0617 Constraint 325 892 4.0156 5.0196 10.0391 0.0617 Constraint 306 479 3.3670 4.2087 8.4174 0.0617 Constraint 233 1447 4.4288 5.5360 11.0719 0.0617 Constraint 227 884 5.8063 7.2578 14.5157 0.0617 Constraint 227 333 6.2524 7.8156 15.6311 0.0617 Constraint 222 868 6.1528 7.6910 15.3821 0.0617 Constraint 216 884 5.5120 6.8900 13.7800 0.0617 Constraint 164 375 5.0739 6.3424 12.6848 0.0617 Constraint 579 706 4.5639 5.7049 11.4098 0.0617 Constraint 421 921 5.9252 7.4065 14.8131 0.0617 Constraint 1503 1739 4.1242 5.1553 10.3106 0.0616 Constraint 1471 1678 5.1073 6.3842 12.7683 0.0616 Constraint 1068 1149 4.6110 5.7638 11.5275 0.0616 Constraint 673 908 3.4650 4.3312 8.6624 0.0614 Constraint 549 859 4.7463 5.9328 11.8657 0.0614 Constraint 222 435 5.0865 6.3581 12.7162 0.0614 Constraint 876 1092 4.9534 6.1918 12.3836 0.0613 Constraint 429 681 4.5752 5.7190 11.4380 0.0613 Constraint 285 487 4.4625 5.5781 11.1562 0.0613 Constraint 263 487 5.1014 6.3768 12.7536 0.0613 Constraint 249 589 5.1535 6.4418 12.8836 0.0613 Constraint 1284 1731 4.7397 5.9246 11.8493 0.0613 Constraint 104 510 5.7715 7.2143 14.4287 0.0613 Constraint 673 1100 5.5860 6.9825 13.9649 0.0612 Constraint 639 997 3.8570 4.8212 9.6425 0.0612 Constraint 104 384 4.5171 5.6463 11.2927 0.0612 Constraint 1213 1526 4.9252 6.1566 12.3131 0.0611 Constraint 808 1541 5.5707 6.9634 13.9268 0.0611 Constraint 128 521 5.8168 7.2710 14.5419 0.0611 Constraint 172 249 5.5113 6.8891 13.7781 0.0611 Constraint 241 1720 5.1126 6.3907 12.7814 0.0609 Constraint 216 1720 5.3356 6.6695 13.3391 0.0609 Constraint 136 665 4.4806 5.6007 11.2014 0.0609 Constraint 963 1117 4.9979 6.2474 12.4947 0.0609 Constraint 955 1301 4.4859 5.6074 11.2148 0.0609 Constraint 227 368 6.2863 7.8578 15.7156 0.0609 Constraint 222 368 5.0865 6.3581 12.7162 0.0609 Constraint 510 778 4.0283 5.0353 10.0707 0.0609 Constraint 487 616 4.7380 5.9225 11.8451 0.0608 Constraint 285 616 6.0235 7.5294 15.0588 0.0608 Constraint 988 1228 3.7811 4.7264 9.4529 0.0608 Constraint 1611 1692 5.5523 6.9404 13.8807 0.0607 Constraint 521 1382 5.2285 6.5356 13.0713 0.0607 Constraint 294 557 4.4622 5.5777 11.1554 0.0607 Constraint 1158 1471 5.4535 6.8169 13.6338 0.0606 Constraint 164 876 4.7525 5.9407 11.8813 0.0606 Constraint 1391 1772 5.7232 7.1540 14.3081 0.0604 Constraint 690 892 5.3943 6.7429 13.4858 0.0604 Constraint 263 1046 5.5380 6.9225 13.8450 0.0604 Constraint 263 1035 5.2709 6.5886 13.1771 0.0604 Constraint 263 1030 4.2270 5.2838 10.5675 0.0604 Constraint 59 1022 5.1651 6.4564 12.9127 0.0604 Constraint 47 1220 4.7741 5.9677 11.9353 0.0604 Constraint 25 1220 5.5940 6.9925 13.9849 0.0604 Constraint 623 980 6.0599 7.5748 15.1496 0.0603 Constraint 1068 1158 5.6512 7.0640 14.1279 0.0603 Constraint 1488 1703 6.1632 7.7040 15.4080 0.0603 Constraint 955 1662 5.8059 7.2574 14.5148 0.0603 Constraint 836 1519 5.8200 7.2750 14.5499 0.0603 Constraint 792 1657 5.1142 6.3927 12.7855 0.0603 Constraint 639 1399 3.8406 4.8008 9.6015 0.0603 Constraint 501 630 5.0258 6.2822 12.5644 0.0603 Constraint 487 1054 4.7097 5.8872 11.7743 0.0603 Constraint 375 608 5.6777 7.0971 14.1942 0.0603 Constraint 368 616 5.1217 6.4021 12.8041 0.0603 Constraint 355 443 4.8066 6.0082 12.0164 0.0603 Constraint 333 530 4.6376 5.7970 11.5940 0.0603 Constraint 77 937 4.5941 5.7426 11.4853 0.0603 Constraint 597 1416 5.0640 6.3300 12.6600 0.0603 Constraint 1511 1634 5.8921 7.3652 14.7304 0.0603 Constraint 1204 1511 6.0281 7.5351 15.0702 0.0603 Constraint 690 1220 5.6322 7.0402 14.0805 0.0603 Constraint 657 1133 4.0407 5.0509 10.1017 0.0603 Constraint 466 1351 5.5703 6.9629 13.9258 0.0603 Constraint 421 980 4.8139 6.0173 12.0347 0.0603 Constraint 241 980 6.0532 7.5665 15.1329 0.0603 Constraint 66 955 5.7678 7.2098 14.4196 0.0601 Constraint 25 1213 5.3818 6.7273 13.4545 0.0601 Constraint 665 1657 4.9528 6.1910 12.3820 0.0601 Constraint 1059 1503 5.9630 7.4538 14.9075 0.0600 Constraint 233 859 5.8687 7.3359 14.6717 0.0600 Constraint 3 1109 5.3434 6.6792 13.3585 0.0600 Constraint 1204 1670 4.8541 6.0676 12.1352 0.0599 Constraint 988 1133 5.6495 7.0618 14.1236 0.0598 Constraint 368 1548 3.6005 4.5006 9.0012 0.0598 Constraint 363 1548 5.9614 7.4517 14.9035 0.0598 Constraint 136 1479 5.7925 7.2406 14.4812 0.0598 Constraint 429 1035 3.3264 4.1580 8.3161 0.0597 Constraint 429 1030 5.2426 6.5533 13.1065 0.0597 Constraint 403 1030 5.3833 6.7291 13.4583 0.0597 Constraint 392 1035 4.7888 5.9860 11.9720 0.0597 Constraint 306 1084 5.5170 6.8962 13.7924 0.0597 Constraint 128 1204 5.5403 6.9254 13.8508 0.0597 Constraint 412 487 5.2664 6.5829 13.1659 0.0596 Constraint 510 748 5.0052 6.2565 12.5130 0.0595 Constraint 530 963 6.1736 7.7170 15.4340 0.0594 Constraint 800 1556 5.8071 7.2588 14.5177 0.0593 Constraint 1109 1748 4.7539 5.9424 11.8847 0.0591 Constraint 274 761 3.2505 4.0632 8.1263 0.0591 Constraint 808 908 5.9207 7.4009 14.8019 0.0591 Constraint 980 1325 4.0445 5.0556 10.1112 0.0590 Constraint 630 1519 4.6609 5.8261 11.6523 0.0590 Constraint 623 1519 5.7650 7.2062 14.4124 0.0590 Constraint 623 1030 6.0060 7.5074 15.0149 0.0590 Constraint 597 1526 4.7304 5.9130 11.8260 0.0590 Constraint 530 1178 6.0041 7.5051 15.0102 0.0590 Constraint 249 347 5.3759 6.7199 13.4398 0.0590 Constraint 314 1030 4.8092 6.0115 12.0231 0.0590 Constraint 164 443 4.7555 5.9444 11.8888 0.0589 Constraint 1100 1438 3.5503 4.4379 8.8759 0.0589 Constraint 876 1317 5.4525 6.8157 13.6313 0.0589 Constraint 1133 1720 4.4040 5.5050 11.0101 0.0589 Constraint 1526 1692 4.3409 5.4261 10.8523 0.0587 Constraint 1526 1649 5.3727 6.7159 13.4319 0.0587 Constraint 1293 1519 2.9355 3.6694 7.3389 0.0587 Constraint 1284 1519 5.0064 6.2579 12.5159 0.0587 Constraint 1178 1284 3.0902 3.8627 7.7255 0.0587 Constraint 1158 1408 5.6913 7.1141 14.2283 0.0587 Constraint 1158 1309 2.5439 3.1799 6.3598 0.0587 Constraint 1125 1366 3.6815 4.6019 9.2038 0.0587 Constraint 1125 1343 3.4249 4.2812 8.5623 0.0587 Constraint 1125 1334 5.2157 6.5197 13.0394 0.0587 Constraint 1092 1343 3.8195 4.7744 9.5488 0.0587 Constraint 908 1141 6.1612 7.7015 15.4029 0.0587 Constraint 876 1141 5.6158 7.0197 14.0394 0.0587 Constraint 876 1117 4.0108 5.0135 10.0270 0.0587 Constraint 868 1046 3.8202 4.7752 9.5504 0.0587 Constraint 698 884 3.9099 4.8874 9.7748 0.0587 Constraint 572 884 5.6877 7.1096 14.2192 0.0587 Constraint 493 792 3.8672 4.8341 9.6681 0.0587 Constraint 487 792 5.7374 7.1717 14.3435 0.0587 Constraint 392 487 6.1265 7.6581 15.3162 0.0587 Constraint 299 579 6.2975 7.8719 15.7438 0.0587 Constraint 294 510 5.9360 7.4199 14.8399 0.0587 Constraint 285 443 3.5947 4.4934 8.9867 0.0587 Constraint 222 294 6.1577 7.6972 15.3944 0.0587 Constraint 196 314 3.3011 4.1264 8.2529 0.0587 Constraint 145 355 3.9798 4.9747 9.9495 0.0587 Constraint 128 347 4.0133 5.0166 10.0332 0.0587 Constraint 47 306 5.4871 6.8589 13.7178 0.0587 Constraint 47 285 3.7792 4.7240 9.4480 0.0587 Constraint 18 241 3.9307 4.9133 9.8267 0.0587 Constraint 1276 1748 5.1629 6.4536 12.9072 0.0586 Constraint 681 937 5.0595 6.3244 12.6488 0.0586 Constraint 196 403 4.9535 6.1919 12.3839 0.0586 Constraint 1494 1596 5.1569 6.4461 12.8922 0.0586 Constraint 1246 1334 4.3727 5.4659 10.9318 0.0586 Constraint 1125 1587 6.3584 7.9480 15.8959 0.0586 Constraint 1054 1228 4.3341 5.4176 10.8352 0.0586 Constraint 731 899 5.4330 6.7913 13.5825 0.0586 Constraint 722 908 5.3992 6.7490 13.4980 0.0586 Constraint 722 899 5.3606 6.7008 13.4016 0.0586 Constraint 608 706 4.7717 5.9646 11.9292 0.0586 Constraint 121 355 4.5515 5.6894 11.3788 0.0586 Constraint 97 937 4.3910 5.4888 10.9776 0.0586 Constraint 59 1030 4.1600 5.2000 10.4000 0.0586 Constraint 33 665 6.3688 7.9610 15.9220 0.0586 Constraint 216 848 4.7437 5.9297 11.8594 0.0585 Constraint 493 1158 5.5166 6.8957 13.7914 0.0585 Constraint 1511 1731 4.5825 5.7281 11.4562 0.0584 Constraint 1596 1692 4.7955 5.9944 11.9887 0.0584 Constraint 698 1391 3.3793 4.2241 8.4481 0.0584 Constraint 884 1479 5.5957 6.9946 13.9893 0.0583 Constraint 104 294 5.4280 6.7850 13.5699 0.0583 Constraint 955 1391 4.6162 5.7703 11.5406 0.0583 Constraint 800 1068 5.0526 6.3157 12.6314 0.0582 Constraint 501 818 4.8927 6.1158 12.2316 0.0582 Constraint 908 988 5.4940 6.8675 13.7350 0.0582 Constraint 1100 1366 5.0579 6.3224 12.6449 0.0581 Constraint 698 963 5.4937 6.8671 13.7343 0.0581 Constraint 1611 1772 5.4891 6.8614 13.7227 0.0581 Constraint 899 1374 4.8735 6.0919 12.1837 0.0581 Constraint 623 1117 6.0120 7.5150 15.0300 0.0581 Constraint 487 673 5.8687 7.3359 14.6718 0.0581 Constraint 868 1022 5.6114 7.0142 14.0284 0.0581 Constraint 731 1466 4.0424 5.0531 10.1061 0.0581 Constraint 448 1054 5.6339 7.0423 14.0846 0.0581 Constraint 112 650 5.7831 7.2289 14.4578 0.0581 Constraint 104 538 5.4136 6.7670 13.5339 0.0581 Constraint 97 572 4.4384 5.5480 11.0961 0.0581 Constraint 1125 1471 4.2715 5.3394 10.6787 0.0580 Constraint 1100 1471 5.6016 7.0020 14.0040 0.0580 Constraint 164 466 4.8916 6.1145 12.2290 0.0580 Constraint 1358 1479 4.8626 6.0782 12.1564 0.0580 Constraint 1351 1479 3.7491 4.6864 9.3729 0.0580 Constraint 1059 1662 3.8925 4.8656 9.7312 0.0580 Constraint 756 1503 4.7953 5.9941 11.9882 0.0580 Constraint 665 1556 4.7813 5.9767 11.9533 0.0580 Constraint 665 792 4.6637 5.8296 11.6592 0.0580 Constraint 392 466 5.6105 7.0131 14.0262 0.0580 Constraint 347 493 4.9662 6.2078 12.4156 0.0580 Constraint 314 493 4.7227 5.9034 11.8068 0.0580 Constraint 299 698 5.6363 7.0454 14.0907 0.0580 Constraint 294 698 4.5609 5.7011 11.4022 0.0580 Constraint 937 1046 4.2780 5.3475 10.6950 0.0579 Constraint 154 227 6.1176 7.6469 15.2939 0.0579 Constraint 997 1567 4.1629 5.2037 10.4073 0.0578 Constraint 681 1133 5.1641 6.4552 12.9103 0.0578 Constraint 249 1343 6.1559 7.6948 15.3896 0.0578 Constraint 66 325 5.0428 6.3035 12.6071 0.0578 Constraint 1358 1455 5.7897 7.2372 14.4743 0.0577 Constraint 665 1541 5.3514 6.6893 13.3786 0.0577 Constraint 325 884 3.1396 3.9245 7.8491 0.0577 Constraint 216 1455 5.2517 6.5646 13.1293 0.0577 Constraint 630 1471 5.5125 6.8906 13.7811 0.0577 Constraint 521 630 6.2724 7.8405 15.6810 0.0577 Constraint 299 1777 3.1678 3.9597 7.9195 0.0577 Constraint 299 1772 4.5256 5.6570 11.3139 0.0577 Constraint 299 1756 6.1173 7.6466 15.2932 0.0577 Constraint 299 1748 6.1711 7.7138 15.4276 0.0577 Constraint 294 1777 3.3816 4.2270 8.4539 0.0577 Constraint 294 1772 4.8491 6.0614 12.1228 0.0577 Constraint 285 1777 5.9448 7.4310 14.8621 0.0577 Constraint 274 1777 5.0971 6.3713 12.7426 0.0577 Constraint 263 1777 2.8149 3.5186 7.0372 0.0577 Constraint 256 1777 5.7613 7.2016 14.4032 0.0577 Constraint 256 756 4.5893 5.7367 11.4733 0.0577 Constraint 233 731 5.1350 6.4187 12.8375 0.0577 Constraint 216 630 5.1057 6.3822 12.7643 0.0577 Constraint 172 1756 5.9229 7.4036 14.8072 0.0577 Constraint 164 1777 5.3200 6.6500 13.3001 0.0577 Constraint 154 1756 5.8884 7.3604 14.7209 0.0577 Constraint 145 1756 3.2658 4.0823 8.1646 0.0577 Constraint 145 1731 5.8713 7.3391 14.6782 0.0577 Constraint 121 1756 5.0429 6.3037 12.6074 0.0577 Constraint 121 1731 3.2757 4.0946 8.1893 0.0577 Constraint 121 1720 4.1691 5.2114 10.4229 0.0577 Constraint 121 1447 5.3213 6.6516 13.3033 0.0577 Constraint 97 1703 4.2960 5.3700 10.7400 0.0577 Constraint 97 1438 4.3979 5.4974 10.9948 0.0577 Constraint 77 1268 4.3753 5.4692 10.9383 0.0577 Constraint 66 1703 3.1808 3.9760 7.9521 0.0577 Constraint 47 1268 4.4962 5.6202 11.2405 0.0577 Constraint 39 1657 4.9630 6.2037 12.4074 0.0577 Constraint 33 1239 4.6532 5.8165 11.6331 0.0577 Constraint 3 172 5.7634 7.2043 14.4086 0.0577 Constraint 3 136 5.0329 6.2911 12.5821 0.0577 Constraint 808 876 5.7795 7.2244 14.4488 0.0577 Constraint 1399 1739 4.4695 5.5869 11.1737 0.0577 Constraint 1158 1399 5.8916 7.3645 14.7290 0.0574 Constraint 756 1634 5.6075 7.0094 14.0187 0.0574 Constraint 722 1657 5.6200 7.0250 14.0500 0.0574 Constraint 564 731 5.2349 6.5436 13.0872 0.0574 Constraint 375 657 5.8645 7.3307 14.6613 0.0574 Constraint 227 1720 5.9021 7.3776 14.7552 0.0574 Constraint 196 1720 4.8612 6.0765 12.1530 0.0574 Constraint 1479 1731 5.1439 6.4298 12.8596 0.0574 Constraint 731 930 5.8122 7.2653 14.5306 0.0574 Constraint 222 375 4.8587 6.0733 12.1467 0.0574 Constraint 421 944 4.9430 6.1787 12.3575 0.0574 Constraint 988 1358 4.1061 5.1326 10.2652 0.0574 Constraint 579 1391 5.5857 6.9822 13.9643 0.0574 Constraint 557 1391 4.6173 5.7716 11.5431 0.0574 Constraint 493 1343 4.8743 6.0928 12.1857 0.0574 Constraint 294 403 5.5333 6.9166 13.8332 0.0574 Constraint 997 1084 5.4281 6.7851 13.5703 0.0573 Constraint 33 121 6.1220 7.6525 15.3051 0.0572 Constraint 597 1077 4.4175 5.5219 11.0439 0.0572 Constraint 597 1068 4.1893 5.2366 10.4732 0.0572 Constraint 1260 1526 5.0900 6.3625 12.7249 0.0571 Constraint 1109 1427 4.6288 5.7860 11.5719 0.0571 Constraint 913 1325 6.2648 7.8310 15.6620 0.0571 Constraint 859 1471 5.2856 6.6071 13.2141 0.0571 Constraint 572 980 5.2262 6.5327 13.0654 0.0571 Constraint 164 639 5.1907 6.4884 12.9768 0.0571 Constraint 112 769 5.2385 6.5481 13.0962 0.0571 Constraint 104 769 5.6464 7.0580 14.1161 0.0571 Constraint 25 800 4.6170 5.7712 11.5424 0.0571 Constraint 1268 1567 4.9877 6.2346 12.4693 0.0570 Constraint 1268 1541 5.3892 6.7365 13.4730 0.0570 Constraint 314 557 5.2183 6.5229 13.0458 0.0570 Constraint 690 1284 5.1964 6.4955 12.9910 0.0570 Constraint 479 913 5.5525 6.9406 13.8813 0.0569 Constraint 121 274 4.2252 5.2815 10.5629 0.0569 Constraint 1204 1343 4.1562 5.1952 10.3904 0.0569 Constraint 1178 1556 5.4784 6.8480 13.6959 0.0568 Constraint 968 1739 5.0594 6.3242 12.6485 0.0568 Constraint 968 1731 5.4454 6.8068 13.6136 0.0568 Constraint 769 955 5.6398 7.0498 14.0995 0.0568 Constraint 722 1533 4.9754 6.2193 12.4385 0.0568 Constraint 706 1325 5.1695 6.4619 12.9238 0.0568 Constraint 690 1526 5.9728 7.4660 14.9320 0.0568 Constraint 690 1511 4.6569 5.8211 11.6421 0.0568 Constraint 681 1213 5.8942 7.3677 14.7355 0.0568 Constraint 59 164 4.8433 6.0541 12.1082 0.0568 Constraint 706 1556 5.3199 6.6498 13.2996 0.0567 Constraint 955 1541 4.7524 5.9405 11.8810 0.0567 Constraint 501 739 5.4570 6.8213 13.6426 0.0567 Constraint 1141 1399 5.4522 6.8153 13.6306 0.0565 Constraint 1657 1764 5.6059 7.0073 14.0146 0.0564 Constraint 829 1649 5.5126 6.8907 13.7815 0.0564 Constraint 39 1678 5.8436 7.3045 14.6090 0.0563 Constraint 249 403 4.8906 6.1133 12.2265 0.0563 Constraint 154 1109 5.2366 6.5458 13.0916 0.0563 Constraint 97 1239 5.3518 6.6897 13.3795 0.0563 Constraint 748 1301 5.1060 6.3825 12.7651 0.0562 Constraint 988 1466 5.6837 7.1046 14.2093 0.0562 Constraint 988 1438 4.9936 6.2420 12.4840 0.0562 Constraint 955 1399 4.7796 5.9745 11.9490 0.0562 Constraint 792 1178 3.8436 4.8045 9.6090 0.0562 Constraint 783 1178 4.1248 5.1560 10.3120 0.0562 Constraint 222 412 3.6671 4.5838 9.1677 0.0562 Constraint 1178 1382 4.7576 5.9470 11.8941 0.0562 Constraint 47 980 5.3145 6.6431 13.2862 0.0562 Constraint 1109 1587 5.6114 7.0143 14.0286 0.0562 Constraint 549 1634 4.3948 5.4935 10.9871 0.0562 Constraint 1678 1777 5.6192 7.0240 14.0479 0.0561 Constraint 1351 1777 5.9258 7.4072 14.8144 0.0561 Constraint 968 1662 5.6263 7.0329 14.0658 0.0561 Constraint 913 1022 4.7219 5.9023 11.8046 0.0561 Constraint 630 1117 5.8021 7.2526 14.5053 0.0561 Constraint 608 1533 4.7671 5.9589 11.9177 0.0561 Constraint 608 1526 4.6963 5.8704 11.7408 0.0561 Constraint 706 1471 5.7222 7.1527 14.3054 0.0561 Constraint 1239 1366 4.8269 6.0337 12.0673 0.0560 Constraint 1117 1317 4.4741 5.5926 11.1852 0.0560 Constraint 756 963 4.3424 5.4280 10.8561 0.0560 Constraint 333 579 3.8142 4.7678 9.5356 0.0560 Constraint 47 249 4.2630 5.3287 10.6574 0.0560 Constraint 1084 1587 6.0414 7.5518 15.1035 0.0560 Constraint 769 1239 5.4556 6.8195 13.6391 0.0560 Constraint 756 1494 5.7157 7.1447 14.2893 0.0560 Constraint 673 1519 5.2153 6.5191 13.0382 0.0560 Constraint 457 899 6.2111 7.7639 15.5278 0.0560 Constraint 412 944 5.7403 7.1754 14.3507 0.0560 Constraint 392 963 5.1095 6.3869 12.7737 0.0560 Constraint 375 937 5.3837 6.7297 13.4594 0.0560 Constraint 325 698 3.8034 4.7543 9.5085 0.0560 Constraint 249 355 6.0108 7.5135 15.0270 0.0560 Constraint 1276 1427 5.1717 6.4647 12.9293 0.0560 Constraint 1022 1117 4.0484 5.0605 10.1210 0.0558 Constraint 363 1620 5.7073 7.1341 14.2682 0.0558 Constraint 241 1533 4.8822 6.1027 12.2054 0.0558 Constraint 196 392 5.6609 7.0761 14.1523 0.0558 Constraint 121 1035 4.5599 5.6999 11.3998 0.0558 Constraint 1488 1575 4.0751 5.0939 10.1877 0.0558 Constraint 77 216 5.0638 6.3298 12.6595 0.0558 Constraint 1567 1764 4.0705 5.0882 10.1763 0.0557 Constraint 1334 1692 5.6524 7.0655 14.1310 0.0557 Constraint 1317 1692 5.3799 6.7248 13.4496 0.0557 Constraint 1251 1714 6.0323 7.5404 15.0808 0.0557 Constraint 748 1046 3.0026 3.7532 7.5064 0.0557 Constraint 748 1022 5.0862 6.3578 12.7155 0.0557 Constraint 457 557 6.1795 7.7244 15.4489 0.0557 Constraint 448 657 4.1558 5.1947 10.3894 0.0557 Constraint 412 579 4.3961 5.4951 10.9901 0.0557 Constraint 333 435 6.2941 7.8676 15.7352 0.0557 Constraint 1343 1455 5.7910 7.2387 14.4775 0.0557 Constraint 731 1077 4.3492 5.4365 10.8730 0.0556 Constraint 808 1228 5.7648 7.2060 14.4121 0.0556 Constraint 792 1204 4.8511 6.0639 12.1278 0.0556 Constraint 778 1204 4.1968 5.2460 10.4921 0.0556 Constraint 769 1204 5.5905 6.9882 13.9764 0.0556 Constraint 769 1193 4.6344 5.7930 11.5861 0.0556 Constraint 608 1141 4.2860 5.3575 10.7150 0.0556 Constraint 836 1317 5.1942 6.4927 12.9855 0.0556 Constraint 829 1366 5.7524 7.1905 14.3810 0.0556 Constraint 97 1158 5.5197 6.8997 13.7994 0.0556 Constraint 1251 1471 4.0166 5.0207 10.0415 0.0555 Constraint 1276 1455 5.5183 6.8979 13.7957 0.0555 Constraint 761 1030 5.5567 6.9458 13.8917 0.0555 Constraint 227 363 4.6311 5.7889 11.5777 0.0554 Constraint 1466 1731 5.2366 6.5457 13.0915 0.0554 Constraint 1109 1391 5.4723 6.8404 13.6807 0.0554 Constraint 1447 1703 5.3123 6.6404 13.2808 0.0553 Constraint 608 944 5.2536 6.5669 13.1339 0.0552 Constraint 1022 1246 5.4894 6.8618 13.7235 0.0551 Constraint 314 657 5.2400 6.5500 13.1001 0.0551 Constraint 623 818 5.3478 6.6848 13.3696 0.0551 Constraint 616 818 5.8940 7.3676 14.7351 0.0551 Constraint 216 1077 4.9819 6.2274 12.4547 0.0551 Constraint 82 241 4.7497 5.9372 11.8743 0.0551 Constraint 1351 1503 4.3588 5.4486 10.8971 0.0551 Constraint 783 1416 5.6829 7.1036 14.2072 0.0551 Constraint 608 1343 5.3496 6.6869 13.3739 0.0551 Constraint 623 1596 5.0051 6.2563 12.5127 0.0550 Constraint 623 1567 5.0034 6.2542 12.5085 0.0550 Constraint 589 1596 5.9121 7.3901 14.7802 0.0550 Constraint 1260 1533 4.7580 5.9475 11.8950 0.0550 Constraint 937 1077 5.2816 6.6020 13.2040 0.0550 Constraint 913 1149 3.2571 4.0713 8.1427 0.0550 Constraint 892 1125 4.0479 5.0599 10.1198 0.0550 Constraint 769 1022 6.1201 7.6501 15.3002 0.0550 Constraint 731 1366 3.9984 4.9980 9.9960 0.0550 Constraint 722 1366 4.8578 6.0722 12.1444 0.0550 Constraint 1284 1756 5.5100 6.8875 13.7751 0.0549 Constraint 589 1526 4.7027 5.8783 11.7567 0.0549 Constraint 564 818 6.1636 7.7045 15.4090 0.0549 Constraint 564 792 4.1341 5.1676 10.3352 0.0549 Constraint 429 899 4.4392 5.5490 11.0981 0.0549 Constraint 421 899 5.8528 7.3161 14.6321 0.0549 Constraint 164 493 4.6702 5.8378 11.6756 0.0549 Constraint 1077 1519 5.9339 7.4174 14.8347 0.0549 Constraint 285 739 4.7988 5.9985 11.9970 0.0549 Constraint 145 818 5.7496 7.1870 14.3740 0.0549 Constraint 3 1084 5.5830 6.9788 13.9576 0.0549 Constraint 429 778 5.0387 6.2983 12.5967 0.0549 Constraint 1117 1366 5.5193 6.8991 13.7982 0.0548 Constraint 1092 1317 4.7422 5.9277 11.8554 0.0548 Constraint 756 913 4.6443 5.8054 11.6107 0.0548 Constraint 690 1447 5.1495 6.4368 12.8737 0.0547 Constraint 3 104 5.4513 6.8141 13.6282 0.0547 Constraint 18 128 5.2487 6.5609 13.1218 0.0547 Constraint 1014 1479 5.0809 6.3511 12.7023 0.0543 Constraint 1014 1447 5.5869 6.9837 13.9673 0.0543 Constraint 988 1670 5.2607 6.5758 13.1516 0.0543 Constraint 836 1611 5.9439 7.4299 14.8598 0.0543 Constraint 829 1611 3.6199 4.5248 9.0497 0.0543 Constraint 713 1059 5.1143 6.3928 12.7856 0.0543 Constraint 681 1092 4.3445 5.4306 10.8612 0.0543 Constraint 616 706 4.6314 5.7893 11.5786 0.0543 Constraint 249 623 4.7903 5.9878 11.9756 0.0543 Constraint 222 623 5.0694 6.3367 12.6734 0.0543 Constraint 1416 1670 4.9728 6.2161 12.4321 0.0542 Constraint 868 1213 4.3436 5.4295 10.8590 0.0542 Constraint 818 1022 5.8707 7.3384 14.6769 0.0542 Constraint 616 899 4.7484 5.9354 11.8709 0.0542 Constraint 363 589 4.9331 6.1663 12.3327 0.0541 Constraint 698 1556 4.9452 6.1814 12.3629 0.0540 Constraint 112 403 5.9976 7.4970 14.9940 0.0540 Constraint 104 955 5.2704 6.5880 13.1760 0.0540 Constraint 769 876 6.2539 7.8173 15.6346 0.0539 Constraint 650 1084 4.9883 6.2353 12.4706 0.0539 Constraint 713 808 5.7933 7.2416 14.4832 0.0539 Constraint 930 1488 5.5664 6.9580 13.9161 0.0538 Constraint 876 1239 5.6434 7.0542 14.1084 0.0538 Constraint 756 1141 4.7107 5.8883 11.7766 0.0538 Constraint 690 1678 4.6990 5.8737 11.7474 0.0538 Constraint 466 1703 5.1704 6.4630 12.9261 0.0538 Constraint 443 673 4.8677 6.0846 12.1692 0.0538 Constraint 189 1351 5.0475 6.3093 12.6187 0.0538 Constraint 1239 1358 5.4139 6.7674 13.5348 0.0537 Constraint 892 988 4.7437 5.9296 11.8591 0.0537 Constraint 884 1022 5.6839 7.1049 14.2099 0.0537 Constraint 572 1408 5.2422 6.5528 13.1055 0.0537 Constraint 435 988 3.8249 4.7811 9.5622 0.0537 Constraint 412 988 5.0525 6.3157 12.6314 0.0537 Constraint 412 955 5.0722 6.3402 12.6804 0.0537 Constraint 249 1503 5.4564 6.8205 13.6410 0.0537 Constraint 216 673 5.7199 7.1498 14.2997 0.0537 Constraint 363 1494 5.5758 6.9698 13.9395 0.0537 Constraint 1276 1756 4.3689 5.4612 10.9223 0.0534 Constraint 1649 1739 4.6625 5.8281 11.6563 0.0533 Constraint 1526 1620 4.7916 5.9895 11.9791 0.0533 Constraint 1014 1100 4.2191 5.2739 10.5478 0.0533 Constraint 47 241 4.9465 6.1832 12.3663 0.0533 Constraint 47 227 4.8090 6.0112 12.0224 0.0533 Constraint 650 868 6.2134 7.7667 15.5334 0.0533 Constraint 82 333 3.9190 4.8987 9.7974 0.0533 Constraint 39 145 4.1709 5.2136 10.4273 0.0533 Constraint 681 884 4.5986 5.7483 11.4966 0.0532 Constraint 1117 1374 5.0186 6.2733 12.5465 0.0531 Constraint 868 1068 4.4179 5.5224 11.0448 0.0531 Constraint 829 1068 4.2405 5.3006 10.6012 0.0531 Constraint 294 435 5.6052 7.0065 14.0130 0.0531 Constraint 25 263 4.6062 5.7578 11.5156 0.0531 Constraint 25 233 3.7873 4.7341 9.4683 0.0531 Constraint 18 256 3.9812 4.9765 9.9530 0.0531 Constraint 818 1374 5.7995 7.2493 14.4987 0.0530 Constraint 1351 1488 5.5240 6.9051 13.8101 0.0530 Constraint 1149 1438 5.4694 6.8367 13.6735 0.0530 Constraint 1022 1756 5.2952 6.6191 13.2381 0.0530 Constraint 1022 1748 4.7927 5.9909 11.9817 0.0530 Constraint 1008 1548 4.2277 5.2846 10.5692 0.0530 Constraint 650 1092 5.1856 6.4820 12.9641 0.0530 Constraint 1399 1603 3.3839 4.2299 8.4599 0.0529 Constraint 848 1100 5.4462 6.8078 13.6155 0.0529 Constraint 549 808 5.0731 6.3414 12.6828 0.0529 Constraint 930 1059 4.4733 5.5916 11.1833 0.0528 Constraint 930 1046 4.3810 5.4762 10.9524 0.0528 Constraint 921 1059 4.9961 6.2451 12.4902 0.0528 Constraint 908 1046 5.0837 6.3546 12.7092 0.0528 Constraint 325 457 4.6743 5.8429 11.6858 0.0528 Constraint 180 263 4.8054 6.0068 12.0136 0.0528 Constraint 1466 1764 5.3647 6.7059 13.4119 0.0527 Constraint 1008 1092 3.8623 4.8278 9.6556 0.0527 Constraint 355 836 5.9711 7.4638 14.9277 0.0526 Constraint 1634 1764 4.9060 6.1325 12.2650 0.0525 Constraint 1284 1494 4.2330 5.2912 10.5824 0.0523 Constraint 1100 1494 4.7395 5.9243 11.8486 0.0523 Constraint 1059 1408 4.8687 6.0858 12.1717 0.0523 Constraint 808 1556 5.4981 6.8726 13.7452 0.0523 Constraint 189 859 6.0722 7.5903 15.1805 0.0523 Constraint 145 241 4.5087 5.6359 11.2718 0.0523 Constraint 1046 1178 5.1980 6.4975 12.9950 0.0523 Constraint 997 1246 3.2944 4.1180 8.2360 0.0523 Constraint 908 1100 5.3961 6.7451 13.4902 0.0523 Constraint 808 930 4.3361 5.4202 10.8403 0.0523 Constraint 572 1351 5.4359 6.7949 13.5898 0.0523 Constraint 538 921 5.2356 6.5445 13.0891 0.0523 Constraint 479 564 5.4057 6.7572 13.5143 0.0523 Constraint 375 616 4.5999 5.7498 11.4997 0.0523 Constraint 368 1479 4.7956 5.9945 11.9890 0.0523 Constraint 164 448 5.3095 6.6368 13.2736 0.0523 Constraint 59 384 5.4044 6.7555 13.5110 0.0523 Constraint 1141 1317 4.5786 5.7233 11.4465 0.0521 Constraint 876 1035 5.2265 6.5331 13.0662 0.0521 Constraint 859 1141 4.0163 5.0204 10.0408 0.0520 Constraint 818 1141 5.9016 7.3770 14.7539 0.0520 Constraint 748 1526 4.5620 5.7025 11.4050 0.0520 Constraint 859 1366 5.6678 7.0847 14.1695 0.0518 Constraint 963 1657 5.2770 6.5963 13.1926 0.0518 Constraint 706 1084 4.7524 5.9405 11.8810 0.0518 Constraint 363 698 5.6448 7.0560 14.1120 0.0518 Constraint 1455 1731 5.7946 7.2433 14.4866 0.0517 Constraint 347 921 4.7860 5.9825 11.9649 0.0516 Constraint 690 859 5.9579 7.4474 14.8948 0.0515 Constraint 18 208 5.6832 7.1040 14.2079 0.0515 Constraint 921 1358 5.4788 6.8485 13.6970 0.0515 Constraint 921 1351 5.6319 7.0399 14.0799 0.0515 Constraint 899 1427 4.3044 5.3805 10.7610 0.0515 Constraint 443 1084 4.9352 6.1690 12.3381 0.0515 Constraint 172 1167 4.3125 5.3906 10.7812 0.0515 Constraint 128 1167 4.4960 5.6200 11.2400 0.0515 Constraint 97 1317 5.4746 6.8433 13.6866 0.0515 Constraint 59 1014 5.0251 6.2814 12.5628 0.0515 Constraint 579 997 5.3354 6.6692 13.3384 0.0512 Constraint 608 698 5.1139 6.3923 12.7846 0.0511 Constraint 630 1317 4.7870 5.9838 11.9676 0.0511 Constraint 892 1149 3.5524 4.4405 8.8811 0.0510 Constraint 868 1511 5.8651 7.3314 14.6628 0.0510 Constraint 868 1408 5.7070 7.1337 14.2674 0.0510 Constraint 829 1471 5.9602 7.4502 14.9004 0.0510 Constraint 783 1634 5.2580 6.5725 13.1451 0.0510 Constraint 706 1343 4.4971 5.6214 11.2428 0.0510 Constraint 403 1358 5.7064 7.1330 14.2659 0.0510 Constraint 713 1447 4.9635 6.2044 12.4088 0.0510 Constraint 1620 1683 5.4415 6.8019 13.6038 0.0509 Constraint 355 690 4.9943 6.2429 12.4858 0.0508 Constraint 121 208 5.3216 6.6520 13.3040 0.0508 Constraint 623 1416 5.5345 6.9182 13.8363 0.0508 Constraint 739 1293 5.3654 6.7068 13.4136 0.0507 Constraint 1511 1611 4.9596 6.1994 12.3989 0.0506 Constraint 1117 1714 3.6002 4.5003 9.0006 0.0506 Constraint 1084 1714 4.2752 5.3440 10.6879 0.0506 Constraint 1068 1692 4.8210 6.0262 12.0525 0.0506 Constraint 1059 1683 5.6487 7.0609 14.1219 0.0506 Constraint 980 1158 3.6786 4.5982 9.1965 0.0506 Constraint 868 1084 4.9121 6.1401 12.2802 0.0506 Constraint 769 892 4.8796 6.0995 12.1990 0.0506 Constraint 739 884 5.2208 6.5260 13.0519 0.0506 Constraint 681 1447 6.3493 7.9366 15.8733 0.0506 Constraint 665 1059 5.2771 6.5964 13.1929 0.0506 Constraint 657 988 4.8896 6.1120 12.2239 0.0506 Constraint 375 466 4.7950 5.9937 11.9874 0.0506 Constraint 314 706 5.3473 6.6841 13.3682 0.0506 Constraint 222 608 3.4156 4.2695 8.5390 0.0506 Constraint 136 375 5.8007 7.2508 14.5017 0.0506 Constraint 112 294 5.5737 6.9671 13.9342 0.0506 Constraint 66 937 5.6004 7.0005 14.0010 0.0506 Constraint 1220 1678 5.2311 6.5389 13.0779 0.0505 Constraint 1030 1511 5.5994 6.9993 13.9986 0.0505 Constraint 963 1455 5.1826 6.4783 12.9565 0.0505 Constraint 937 1511 4.7978 5.9973 11.9945 0.0505 Constraint 868 1317 3.9383 4.9229 9.8457 0.0505 Constraint 145 1351 6.0414 7.5517 15.1034 0.0505 Constraint 698 1068 5.5828 6.9785 13.9570 0.0505 Constraint 196 1133 4.4478 5.5597 11.1195 0.0505 Constraint 136 249 4.6092 5.7614 11.5229 0.0505 Constraint 333 457 4.9575 6.1968 12.3937 0.0505 Constraint 97 1213 4.8740 6.0925 12.1851 0.0505 Constraint 1649 1714 5.0718 6.3397 12.6795 0.0504 Constraint 892 1109 4.7803 5.9754 11.9508 0.0504 Constraint 892 1068 5.4930 6.8662 13.7325 0.0504 Constraint 479 557 5.3374 6.6718 13.3436 0.0504 Constraint 363 681 5.7793 7.2241 14.4482 0.0504 Constraint 333 564 5.9544 7.4430 14.8860 0.0504 Constraint 698 1471 4.6029 5.7536 11.5073 0.0503 Constraint 650 1046 5.4603 6.8254 13.6508 0.0503 Constraint 227 623 4.8993 6.1241 12.2483 0.0503 Constraint 77 1213 5.6904 7.1130 14.2260 0.0503 Constraint 11 1014 5.4058 6.7572 13.5144 0.0503 Constraint 11 698 5.5583 6.9479 13.8958 0.0503 Constraint 97 1141 5.7516 7.1895 14.3790 0.0502 Constraint 836 963 5.3181 6.6476 13.2952 0.0502 Constraint 783 1567 5.8564 7.3205 14.6410 0.0501 Constraint 778 1567 4.5794 5.7243 11.4485 0.0501 Constraint 1158 1503 5.1503 6.4379 12.8758 0.0500 Constraint 690 1683 6.1027 7.6284 15.2569 0.0500 Constraint 466 1471 4.7410 5.9263 11.8526 0.0500 Constraint 466 1158 4.8700 6.0874 12.1749 0.0500 Constraint 435 650 5.9624 7.4530 14.9061 0.0500 Constraint 435 639 5.2152 6.5191 13.0381 0.0500 Constraint 435 630 5.0977 6.3721 12.7443 0.0500 Constraint 421 1511 4.1163 5.1454 10.2908 0.0500 Constraint 363 1479 5.5769 6.9711 13.9423 0.0500 Constraint 128 955 4.9390 6.1737 12.3474 0.0500 Constraint 104 980 5.4060 6.7575 13.5149 0.0500 Constraint 82 256 6.1847 7.7309 15.4617 0.0500 Constraint 39 955 4.4317 5.5396 11.0793 0.0500 Constraint 33 227 5.4529 6.8161 13.6321 0.0500 Constraint 616 800 4.2572 5.3215 10.6430 0.0499 Constraint 1149 1391 5.1761 6.4702 12.9403 0.0498 Constraint 944 1317 4.1972 5.2465 10.4931 0.0498 Constraint 921 1678 5.0224 6.2780 12.5560 0.0498 Constraint 848 1358 5.5523 6.9403 13.8806 0.0498 Constraint 829 1133 5.8477 7.3096 14.6193 0.0498 Constraint 665 1447 5.8278 7.2848 14.5696 0.0498 Constraint 233 748 5.9239 7.4048 14.8097 0.0498 Constraint 216 892 5.6195 7.0244 14.0487 0.0498 Constraint 196 1246 5.3045 6.6306 13.2612 0.0498 Constraint 608 968 5.9364 7.4205 14.8409 0.0498 Constraint 1382 1526 3.6363 4.5454 9.0908 0.0498 Constraint 1178 1620 6.3096 7.8870 15.7740 0.0498 Constraint 1125 1611 6.2094 7.7618 15.5236 0.0498 Constraint 1109 1611 5.9107 7.3884 14.7767 0.0498 Constraint 731 1133 4.8473 6.0592 12.1183 0.0498 Constraint 549 1220 4.9284 6.1605 12.3211 0.0498 Constraint 530 1220 4.5083 5.6354 11.2708 0.0498 Constraint 521 1193 5.2921 6.6151 13.2303 0.0498 Constraint 154 706 6.2365 7.7956 15.5913 0.0498 Constraint 128 980 4.6706 5.8383 11.6765 0.0498 Constraint 97 698 4.8069 6.0086 12.0172 0.0498 Constraint 97 208 5.0499 6.3124 12.6248 0.0498 Constraint 66 1213 4.4200 5.5249 11.0499 0.0498 Constraint 66 1092 6.1608 7.7010 15.4020 0.0498 Constraint 66 1084 4.5764 5.7205 11.4411 0.0498 Constraint 59 1220 5.1688 6.4610 12.9220 0.0498 Constraint 59 1213 4.2697 5.3372 10.6744 0.0498 Constraint 33 1149 4.6366 5.7958 11.5915 0.0498 Constraint 33 1117 4.8580 6.0725 12.1450 0.0498 Constraint 25 1117 4.8096 6.0120 12.0240 0.0498 Constraint 11 1541 3.7722 4.7152 9.4304 0.0498 Constraint 11 1511 4.4667 5.5834 11.1668 0.0498 Constraint 3 1117 4.2013 5.2516 10.5031 0.0498 Constraint 713 884 4.3245 5.4056 10.8112 0.0498 Constraint 713 876 3.5206 4.4008 8.8016 0.0498 Constraint 713 836 4.1743 5.2179 10.4358 0.0498 Constraint 706 876 6.3754 7.9692 15.9385 0.0498 Constraint 1620 1788 4.2455 5.3069 10.6137 0.0498 Constraint 1620 1777 4.2742 5.3427 10.6854 0.0498 Constraint 1611 1764 4.4113 5.5142 11.0284 0.0498 Constraint 1228 1519 5.1809 6.4761 12.9522 0.0498 Constraint 1204 1526 4.2401 5.3001 10.6002 0.0498 Constraint 1178 1777 3.3685 4.2107 8.4214 0.0498 Constraint 1167 1334 4.0808 5.1009 10.2019 0.0498 Constraint 1149 1777 4.5686 5.7107 11.4215 0.0498 Constraint 980 1620 3.7786 4.7232 9.4464 0.0498 Constraint 722 937 5.5124 6.8905 13.7810 0.0498 Constraint 650 800 4.9217 6.1521 12.3043 0.0498 Constraint 639 808 5.4426 6.8032 13.6064 0.0498 Constraint 616 1526 4.7207 5.9008 11.8017 0.0498 Constraint 616 1178 3.1776 3.9720 7.9440 0.0498 Constraint 608 1503 4.0804 5.1005 10.2009 0.0498 Constraint 608 1494 5.3333 6.6666 13.3332 0.0498 Constraint 608 1178 4.4912 5.6140 11.2280 0.0498 Constraint 597 988 6.0488 7.5611 15.1221 0.0498 Constraint 589 1479 4.0999 5.1249 10.2498 0.0498 Constraint 549 1141 3.2511 4.0639 8.1278 0.0498 Constraint 538 1125 5.0566 6.3208 12.6415 0.0498 Constraint 530 1117 6.2413 7.8016 15.6032 0.0498 Constraint 530 1100 5.9914 7.4893 14.9786 0.0498 Constraint 530 1092 6.3824 7.9780 15.9560 0.0498 Constraint 521 1125 6.1690 7.7113 15.4226 0.0498 Constraint 521 1117 3.4088 4.2610 8.5220 0.0498 Constraint 521 1092 4.0168 5.0210 10.0421 0.0498 Constraint 510 1092 5.3904 6.7380 13.4761 0.0498 Constraint 501 1092 4.9057 6.1321 12.2642 0.0498 Constraint 501 988 5.2184 6.5230 13.0461 0.0498 Constraint 501 955 3.9068 4.8836 9.7671 0.0498 Constraint 487 899 5.1203 6.4003 12.8007 0.0498 Constraint 466 899 4.8955 6.1193 12.2387 0.0498 Constraint 466 892 4.3944 5.4930 10.9859 0.0498 Constraint 429 1077 4.8192 6.0240 12.0481 0.0498 Constraint 403 1084 6.3569 7.9462 15.8923 0.0498 Constraint 403 1059 5.8450 7.3063 14.6125 0.0498 Constraint 403 1054 5.9939 7.4923 14.9846 0.0498 Constraint 375 1054 5.5069 6.8836 13.7672 0.0498 Constraint 368 1068 5.2742 6.5927 13.1854 0.0498 Constraint 368 1054 5.7535 7.1918 14.3837 0.0498 Constraint 363 457 4.8843 6.1054 12.2107 0.0498 Constraint 363 448 5.5636 6.9545 13.9089 0.0498 Constraint 355 435 5.8050 7.2562 14.5125 0.0498 Constraint 347 457 6.3501 7.9376 15.8752 0.0498 Constraint 325 435 6.2364 7.7955 15.5910 0.0498 Constraint 241 1092 4.5688 5.7109 11.4219 0.0498 Constraint 216 1059 3.6281 4.5351 9.0702 0.0498 Constraint 208 1059 5.8461 7.3077 14.6153 0.0498 Constraint 208 448 3.5756 4.4696 8.9391 0.0498 Constraint 154 487 3.1196 3.8995 7.7991 0.0498 Constraint 145 487 4.3588 5.4485 10.8969 0.0498 Constraint 97 1077 4.6690 5.8363 11.6726 0.0498 Constraint 11 97 5.0837 6.3547 12.7093 0.0498 Constraint 11 91 5.1462 6.4327 12.8655 0.0498 Constraint 756 1382 5.9104 7.3880 14.7760 0.0497 Constraint 616 955 5.4492 6.8115 13.6231 0.0496 Constraint 1466 1772 4.0583 5.0729 10.1458 0.0495 Constraint 1366 1692 5.1375 6.4219 12.8437 0.0495 Constraint 1092 1325 4.4801 5.6001 11.2002 0.0495 Constraint 1030 1764 5.7691 7.2113 14.4227 0.0495 Constraint 1022 1731 6.2493 7.8117 15.6233 0.0495 Constraint 968 1772 5.4645 6.8306 13.6612 0.0495 Constraint 944 1756 5.3867 6.7334 13.4669 0.0495 Constraint 944 1720 4.8163 6.0203 12.0406 0.0495 Constraint 944 1703 6.2225 7.7781 15.5562 0.0495 Constraint 930 1228 6.2851 7.8564 15.7128 0.0495 Constraint 930 1125 4.5199 5.6499 11.2999 0.0495 Constraint 930 1084 4.6710 5.8387 11.6775 0.0495 Constraint 913 1692 5.1709 6.4636 12.9272 0.0495 Constraint 908 1178 6.0436 7.5545 15.1091 0.0495 Constraint 908 1109 5.7117 7.1396 14.2793 0.0495 Constraint 876 1777 5.7590 7.1988 14.3976 0.0495 Constraint 859 1455 5.5513 6.9392 13.8783 0.0495 Constraint 848 1268 6.2727 7.8409 15.6818 0.0495 Constraint 818 1301 6.0013 7.5017 15.0034 0.0495 Constraint 818 1293 3.1279 3.9098 7.8196 0.0495 Constraint 818 1284 6.3128 7.8910 15.7820 0.0495 Constraint 818 1268 3.6741 4.5927 9.1854 0.0495 Constraint 818 1213 3.4852 4.3565 8.7130 0.0495 Constraint 808 1213 5.8087 7.2609 14.5218 0.0495 Constraint 756 908 4.1965 5.2456 10.4912 0.0495 Constraint 673 859 4.4039 5.5049 11.0098 0.0495 Constraint 650 792 6.3703 7.9629 15.9258 0.0495 Constraint 616 1301 6.0266 7.5332 15.0664 0.0495 Constraint 616 1268 3.6475 4.5594 9.1187 0.0495 Constraint 608 1239 3.9913 4.9891 9.9782 0.0495 Constraint 608 1228 6.2915 7.8644 15.7289 0.0495 Constraint 608 1193 6.3259 7.9074 15.8149 0.0495 Constraint 608 1054 3.2776 4.0970 8.1940 0.0495 Constraint 608 1035 3.9913 4.9891 9.9782 0.0495 Constraint 597 1167 5.6617 7.0771 14.1542 0.0495 Constraint 589 1293 4.7097 5.8871 11.7743 0.0495 Constraint 579 1260 5.8604 7.3255 14.6509 0.0495 Constraint 557 944 4.4898 5.6122 11.2244 0.0495 Constraint 557 892 5.5458 6.9323 13.8646 0.0495 Constraint 493 884 5.3445 6.6806 13.3612 0.0495 Constraint 479 1178 5.1669 6.4586 12.9172 0.0495 Constraint 479 657 6.2912 7.8640 15.7280 0.0495 Constraint 479 623 6.3533 7.9416 15.8831 0.0495 Constraint 466 1167 4.7469 5.9336 11.8672 0.0495 Constraint 466 884 4.5974 5.7467 11.4934 0.0495 Constraint 466 722 4.6857 5.8571 11.7143 0.0495 Constraint 457 1772 4.6366 5.7958 11.5916 0.0495 Constraint 457 1466 4.5169 5.6461 11.2921 0.0495 Constraint 457 1438 5.2113 6.5142 13.0284 0.0495 Constraint 457 1178 6.0588 7.5735 15.1470 0.0495 Constraint 457 698 6.2035 7.7544 15.5089 0.0495 Constraint 448 944 6.2509 7.8137 15.6273 0.0495 Constraint 443 1471 6.1417 7.6772 15.3544 0.0495 Constraint 443 1447 4.9512 6.1890 12.3779 0.0495 Constraint 435 829 6.2613 7.8267 15.6534 0.0495 Constraint 429 1008 6.3054 7.8818 15.7636 0.0495 Constraint 421 1447 5.0469 6.3086 12.6173 0.0495 Constraint 421 892 4.6510 5.8138 11.6276 0.0495 Constraint 412 829 5.7954 7.2442 14.4884 0.0495 Constraint 392 1438 4.9483 6.1853 12.3706 0.0495 Constraint 392 1427 5.8480 7.3100 14.6200 0.0495 Constraint 392 1399 5.7088 7.1361 14.2721 0.0495 Constraint 384 1479 4.9468 6.1835 12.3670 0.0495 Constraint 368 818 5.5062 6.8828 13.7656 0.0495 Constraint 363 1466 4.4976 5.6220 11.2440 0.0495 Constraint 355 937 5.8405 7.3006 14.6013 0.0495 Constraint 355 783 5.8753 7.3441 14.6882 0.0495 Constraint 355 778 5.8405 7.3006 14.6013 0.0495 Constraint 347 1167 6.1704 7.7130 15.4259 0.0495 Constraint 347 848 4.8393 6.0491 12.0983 0.0495 Constraint 347 673 4.5753 5.7191 11.4382 0.0495 Constraint 347 657 4.3778 5.4722 10.9445 0.0495 Constraint 333 1471 4.8212 6.0265 12.0529 0.0495 Constraint 333 1054 6.3325 7.9156 15.8311 0.0495 Constraint 325 1471 5.2994 6.6242 13.2485 0.0495 Constraint 325 657 3.9236 4.9045 9.8090 0.0495 Constraint 299 1764 6.0933 7.6166 15.2332 0.0495 Constraint 299 1374 5.7535 7.1919 14.3838 0.0495 Constraint 263 1466 4.5027 5.6283 11.2566 0.0495 Constraint 263 1438 5.2206 6.5257 13.0514 0.0495 Constraint 263 908 6.0948 7.6185 15.2370 0.0495 Constraint 249 892 3.2742 4.0927 8.1855 0.0495 Constraint 241 1748 6.2357 7.7946 15.5892 0.0495 Constraint 241 1466 6.0704 7.5880 15.1760 0.0495 Constraint 241 1427 5.8222 7.2778 14.5556 0.0495 Constraint 227 892 5.8766 7.3458 14.6915 0.0495 Constraint 216 1756 4.6703 5.8378 11.6757 0.0495 Constraint 216 1748 4.6249 5.7811 11.5623 0.0495 Constraint 216 1408 4.9495 6.1869 12.3737 0.0495 Constraint 216 314 5.8742 7.3427 14.6855 0.0495 Constraint 196 937 5.9390 7.4237 14.8474 0.0495 Constraint 196 921 4.5244 5.6555 11.3110 0.0495 Constraint 180 1772 4.6366 5.7958 11.5916 0.0495 Constraint 180 1764 4.5854 5.7318 11.4636 0.0495 Constraint 180 1756 5.3453 6.6817 13.3634 0.0495 Constraint 180 375 4.5979 5.7474 11.4947 0.0495 Constraint 172 429 4.6710 5.8388 11.6776 0.0495 Constraint 172 392 6.3605 7.9506 15.9011 0.0495 Constraint 172 375 3.3833 4.2291 8.4583 0.0495 Constraint 164 1133 6.2971 7.8713 15.7427 0.0495 Constraint 154 1772 4.9261 6.1576 12.3152 0.0495 Constraint 154 868 6.1617 7.7022 15.4043 0.0495 Constraint 154 859 5.3142 6.6427 13.2854 0.0495 Constraint 154 836 4.3782 5.4727 10.9455 0.0495 Constraint 145 1772 5.2935 6.6169 13.2338 0.0495 Constraint 145 435 4.8707 6.0884 12.1768 0.0495 Constraint 145 392 5.9441 7.4301 14.8603 0.0495 Constraint 145 363 3.4763 4.3453 8.6906 0.0495 Constraint 145 333 4.7812 5.9765 11.9530 0.0495 Constraint 136 968 4.5516 5.6896 11.3791 0.0495 Constraint 136 435 4.2714 5.3393 10.6786 0.0495 Constraint 128 908 5.2727 6.5909 13.1817 0.0495 Constraint 121 884 6.1680 7.7100 15.4201 0.0495 Constraint 104 1008 4.2061 5.2576 10.5152 0.0495 Constraint 104 783 5.2122 6.5153 13.0305 0.0495 Constraint 91 443 6.3191 7.8989 15.7978 0.0495 Constraint 82 479 5.1595 6.4493 12.8986 0.0495 Constraint 82 466 5.9537 7.4421 14.8842 0.0495 Constraint 82 457 4.2331 5.2914 10.5828 0.0495 Constraint 82 412 5.8292 7.2865 14.5729 0.0495 Constraint 82 196 6.1666 7.7082 15.4165 0.0495 Constraint 77 1167 6.1894 7.7368 15.4735 0.0495 Constraint 77 435 3.8588 4.8235 9.6470 0.0495 Constraint 77 429 4.7200 5.9000 11.7999 0.0495 Constraint 77 196 5.3520 6.6900 13.3800 0.0495 Constraint 66 1772 4.8691 6.0864 12.1728 0.0495 Constraint 66 1054 6.3188 7.8985 15.7970 0.0495 Constraint 66 1030 4.4748 5.5935 11.1870 0.0495 Constraint 59 1772 5.3400 6.6750 13.3500 0.0495 Constraint 59 1503 4.7146 5.8933 11.7866 0.0495 Constraint 59 1494 4.5178 5.6472 11.2944 0.0495 Constraint 59 1471 5.3080 6.6350 13.2701 0.0495 Constraint 59 457 4.8385 6.0481 12.0963 0.0495 Constraint 47 1167 6.1824 7.7280 15.4560 0.0495 Constraint 47 1109 5.2463 6.5579 13.1159 0.0495 Constraint 47 868 6.1824 7.7280 15.4560 0.0495 Constraint 47 530 4.0415 5.0519 10.1038 0.0495 Constraint 39 1471 4.9671 6.2088 12.4176 0.0495 Constraint 39 968 4.1579 5.1973 10.3947 0.0495 Constraint 39 783 6.1485 7.6857 15.3713 0.0495 Constraint 39 778 5.2184 6.5230 13.0461 0.0495 Constraint 39 623 4.1281 5.1601 10.3202 0.0495 Constraint 39 597 4.4575 5.5718 11.1436 0.0495 Constraint 39 530 5.0914 6.3643 12.7286 0.0495 Constraint 39 501 4.3879 5.4849 10.9698 0.0495 Constraint 39 493 4.1282 5.1602 10.3205 0.0495 Constraint 33 1503 5.2856 6.6071 13.2141 0.0495 Constraint 33 1471 5.2856 6.6071 13.2141 0.0495 Constraint 18 980 4.1881 5.2351 10.4701 0.0495 Constraint 18 859 3.7517 4.6896 9.3793 0.0495 Constraint 18 836 5.4033 6.7542 13.5083 0.0495 Constraint 18 800 5.2320 6.5400 13.0800 0.0495 Constraint 18 783 5.2122 6.5153 13.0305 0.0495 Constraint 18 756 4.2431 5.3039 10.6078 0.0495 Constraint 18 549 5.3059 6.6324 13.2647 0.0495 Constraint 18 530 5.4033 6.7542 13.5083 0.0495 Constraint 18 501 4.2004 5.2506 10.5011 0.0495 Constraint 18 487 5.3185 6.6482 13.2964 0.0495 Constraint 18 443 4.2431 5.3039 10.6078 0.0495 Constraint 11 868 6.1101 7.6377 15.2754 0.0495 Constraint 11 783 6.0072 7.5090 15.0180 0.0495 Constraint 3 1764 5.5220 6.9025 13.8049 0.0495 Constraint 3 1756 4.3306 5.4133 10.8266 0.0495 Constraint 3 1503 4.2076 5.2595 10.5191 0.0495 Constraint 3 1455 5.3671 6.7089 13.4179 0.0495 Constraint 3 1054 4.5180 5.6475 11.2950 0.0495 Constraint 3 1046 3.4743 4.3429 8.6858 0.0495 Constraint 3 892 5.6243 7.0303 14.0606 0.0495 Constraint 3 868 4.6047 5.7558 11.5117 0.0495 Constraint 3 859 3.4098 4.2623 8.5246 0.0495 Constraint 3 783 4.6574 5.8217 11.6435 0.0495 Constraint 3 778 3.4743 4.3429 8.6858 0.0495 Constraint 3 530 3.5152 4.3940 8.7879 0.0495 Constraint 3 466 3.4443 4.3053 8.6106 0.0495 Constraint 3 384 5.1887 6.4859 12.9718 0.0495 Constraint 3 375 4.8717 6.0896 12.1791 0.0495 Constraint 3 180 4.8085 6.0107 12.0213 0.0495 Constraint 836 1382 4.7151 5.8939 11.7878 0.0494 Constraint 698 1213 6.0715 7.5893 15.1787 0.0494 Constraint 608 1100 5.3650 6.7062 13.4125 0.0494 Constraint 579 1100 4.6713 5.8392 11.6784 0.0494 Constraint 572 1100 5.0081 6.2601 12.5202 0.0494 Constraint 479 1703 5.2377 6.5471 13.0942 0.0494 Constraint 479 1213 4.8257 6.0322 12.0643 0.0494 Constraint 375 1149 5.2758 6.5948 13.1895 0.0494 Constraint 375 1141 3.8412 4.8016 9.6031 0.0494 Constraint 355 1141 5.4395 6.7994 13.5988 0.0494 Constraint 196 963 5.0964 6.3705 12.7411 0.0494 Constraint 1228 1408 5.1320 6.4149 12.8299 0.0493 Constraint 1204 1408 5.5947 6.9934 13.9868 0.0493 Constraint 892 1133 5.3533 6.6916 13.3832 0.0493 Constraint 706 1416 5.9732 7.4665 14.9329 0.0493 Constraint 501 616 5.9489 7.4361 14.8722 0.0493 Constraint 333 623 4.8698 6.0873 12.1745 0.0493 Constraint 325 538 4.7089 5.8861 11.7723 0.0493 Constraint 306 597 3.5748 4.4684 8.9369 0.0493 Constraint 274 623 4.8167 6.0209 12.0418 0.0493 Constraint 792 876 4.7950 5.9937 11.9874 0.0493 Constraint 650 848 5.6238 7.0297 14.0594 0.0493 Constraint 623 899 4.5277 5.6596 11.3192 0.0493 Constraint 145 368 5.7931 7.2414 14.4829 0.0493 Constraint 913 1596 5.6988 7.1235 14.2471 0.0492 Constraint 597 1035 5.4265 6.7831 13.5661 0.0492 Constraint 589 818 6.2027 7.7534 15.5068 0.0492 Constraint 572 818 4.4569 5.5711 11.1423 0.0492 Constraint 112 829 5.0942 6.3678 12.7356 0.0492 Constraint 25 1657 4.9975 6.2469 12.4937 0.0492 Constraint 1503 1756 4.4641 5.5801 11.1602 0.0491 Constraint 955 1678 4.6304 5.7880 11.5759 0.0491 Constraint 944 1343 3.9170 4.8963 9.7926 0.0491 Constraint 921 1228 6.0968 7.6210 15.2420 0.0491 Constraint 892 1022 4.6647 5.8308 11.6616 0.0491 Constraint 836 1471 6.0645 7.5806 15.1612 0.0491 Constraint 836 1343 5.7175 7.1469 14.2938 0.0491 Constraint 722 1343 5.9732 7.4665 14.9330 0.0491 Constraint 616 1014 5.4872 6.8590 13.7180 0.0491 Constraint 487 1046 6.0368 7.5460 15.0920 0.0491 Constraint 299 713 4.6420 5.8025 11.6049 0.0491 Constraint 241 681 3.8059 4.7573 9.5146 0.0491 Constraint 222 650 4.8636 6.0795 12.1590 0.0491 Constraint 128 285 5.0063 6.2579 12.5157 0.0491 Constraint 944 1068 5.9038 7.3797 14.7594 0.0491 Constraint 778 876 5.5204 6.9005 13.8009 0.0491 Constraint 128 208 4.6860 5.8575 11.7149 0.0489 Constraint 1022 1471 5.4497 6.8121 13.6242 0.0489 Constraint 189 1714 5.1023 6.3779 12.7557 0.0489 Constraint 1533 1611 5.5658 6.9573 13.9145 0.0488 Constraint 876 1228 5.2092 6.5115 13.0231 0.0488 Constraint 778 937 5.3950 6.7438 13.4875 0.0488 Constraint 597 1408 5.5306 6.9133 13.8265 0.0488 Constraint 572 1220 4.9736 6.2170 12.4339 0.0488 Constraint 121 196 5.4629 6.8286 13.6573 0.0488 Constraint 1503 1748 5.2089 6.5111 13.0221 0.0488 Constraint 1494 1587 4.1245 5.1557 10.3113 0.0488 Constraint 59 241 4.9593 6.1992 12.3983 0.0488 Constraint 363 980 6.0266 7.5332 15.0664 0.0487 Constraint 47 164 5.8898 7.3622 14.7244 0.0486 Constraint 963 1213 5.1015 6.3769 12.7538 0.0484 Constraint 1213 1334 4.5083 5.6354 11.2708 0.0483 Constraint 761 1117 5.7844 7.2305 14.4610 0.0483 Constraint 681 1100 5.0493 6.3116 12.6232 0.0481 Constraint 164 997 5.0855 6.3569 12.7138 0.0481 Constraint 1649 1777 5.0776 6.3470 12.6939 0.0481 Constraint 997 1334 3.3329 4.1661 8.3322 0.0481 Constraint 997 1109 6.1827 7.7283 15.4567 0.0481 Constraint 876 1178 5.0530 6.3163 12.6325 0.0481 Constraint 868 1228 4.8117 6.0146 12.0293 0.0481 Constraint 665 930 6.0675 7.5844 15.1687 0.0481 Constraint 347 681 5.5875 6.9843 13.9687 0.0481 Constraint 66 549 5.7101 7.1377 14.2754 0.0481 Constraint 104 848 4.9702 6.2127 12.4254 0.0481 Constraint 913 1141 5.0013 6.2516 12.5032 0.0480 Constraint 639 1077 4.1712 5.2140 10.4280 0.0480 Constraint 589 1008 5.9461 7.4327 14.8653 0.0480 Constraint 521 1077 5.7568 7.1960 14.3920 0.0480 Constraint 368 722 6.1751 7.7189 15.4377 0.0480 Constraint 136 493 4.9460 6.1824 12.3649 0.0480 Constraint 1541 1772 5.4051 6.7564 13.5128 0.0479 Constraint 33 955 4.8968 6.1210 12.2419 0.0479 Constraint 18 955 5.3335 6.6668 13.3337 0.0479 Constraint 731 1649 4.5335 5.6669 11.3337 0.0478 Constraint 650 1533 4.3964 5.4956 10.9911 0.0478 Constraint 227 673 4.6806 5.8508 11.7016 0.0478 Constraint 1117 1556 5.3582 6.6977 13.3955 0.0477 Constraint 510 800 4.6755 5.8443 11.6887 0.0477 Constraint 145 222 5.6169 7.0211 14.0422 0.0477 Constraint 1479 1748 5.5041 6.8801 13.7601 0.0476 Constraint 681 963 4.9797 6.2246 12.4492 0.0476 Constraint 421 713 5.6147 7.0183 14.0367 0.0476 Constraint 384 521 4.7269 5.9087 11.8173 0.0476 Constraint 112 333 5.8368 7.2960 14.5919 0.0476 Constraint 1178 1466 6.3043 7.8803 15.7606 0.0476 Constraint 988 1494 5.3687 6.7109 13.4218 0.0476 Constraint 208 1246 5.8642 7.3303 14.6605 0.0476 Constraint 39 1084 4.8812 6.1015 12.2031 0.0476 Constraint 25 1068 5.5019 6.8774 13.7548 0.0476 Constraint 564 1455 4.9574 6.1968 12.3936 0.0475 Constraint 564 1447 4.7121 5.8901 11.7801 0.0475 Constraint 479 980 4.2310 5.2887 10.5775 0.0475 Constraint 256 1092 5.3728 6.7160 13.4319 0.0475 Constraint 227 1109 5.9876 7.4845 14.9690 0.0475 Constraint 227 1100 5.5066 6.8833 13.7665 0.0475 Constraint 33 1030 5.6520 7.0650 14.1299 0.0475 Constraint 1503 1603 5.1626 6.4533 12.9066 0.0474 Constraint 1391 1620 5.6926 7.1157 14.2314 0.0474 Constraint 1059 1447 5.6799 7.0999 14.1998 0.0474 Constraint 868 1109 5.5449 6.9312 13.8624 0.0474 Constraint 665 1068 5.0289 6.2862 12.5723 0.0474 Constraint 564 963 5.8581 7.3226 14.6452 0.0474 Constraint 233 657 4.8604 6.0755 12.1510 0.0474 Constraint 66 256 6.1794 7.7243 15.4486 0.0474 Constraint 1455 1739 5.9920 7.4900 14.9801 0.0474 Constraint 466 761 5.3901 6.7376 13.4753 0.0474 Constraint 256 521 3.8088 4.7610 9.5220 0.0474 Constraint 1399 1596 4.6228 5.7784 11.5569 0.0472 Constraint 698 859 5.1914 6.4892 12.9785 0.0472 Constraint 196 466 4.7556 5.9445 11.8891 0.0472 Constraint 1657 1720 5.5247 6.9058 13.8116 0.0472 Constraint 1343 1772 4.4413 5.5516 11.1032 0.0471 Constraint 521 731 5.1093 6.3866 12.7732 0.0471 Constraint 487 1756 4.3393 5.4241 10.8482 0.0471 Constraint 487 1720 5.4273 6.7841 13.5682 0.0471 Constraint 1293 1575 5.2801 6.6001 13.2003 0.0471 Constraint 739 908 5.5063 6.8829 13.7658 0.0471 Constraint 82 249 5.7141 7.1426 14.2852 0.0471 Constraint 77 249 5.2488 6.5610 13.1221 0.0471 Constraint 39 1008 4.8249 6.0311 12.0622 0.0471 Constraint 25 1193 5.3632 6.7040 13.4079 0.0471 Constraint 1488 1649 5.1710 6.4637 12.9274 0.0470 Constraint 1479 1620 5.7020 7.1275 14.2549 0.0470 Constraint 1239 1596 5.1632 6.4540 12.9080 0.0470 Constraint 623 1204 4.3204 5.4005 10.8010 0.0469 Constraint 263 1603 4.5002 5.6253 11.2505 0.0469 Constraint 836 1008 5.7118 7.1398 14.2795 0.0469 Constraint 196 761 5.4597 6.8246 13.6491 0.0469 Constraint 868 1471 5.2469 6.5587 13.1174 0.0469 Constraint 650 1391 4.0634 5.0792 10.1585 0.0469 Constraint 623 1391 3.7034 4.6293 9.2586 0.0469 Constraint 1466 1720 4.7875 5.9843 11.9687 0.0469 Constraint 1438 1720 4.9246 6.1557 12.3114 0.0469 Constraint 1133 1714 5.8387 7.2984 14.5968 0.0469 Constraint 1100 1683 4.7106 5.8883 11.7765 0.0469 Constraint 1077 1662 5.9968 7.4960 14.9921 0.0469 Constraint 1068 1683 6.3429 7.9286 15.8572 0.0469 Constraint 930 1519 6.3639 7.9549 15.9097 0.0469 Constraint 884 1158 5.6526 7.0658 14.1315 0.0469 Constraint 876 1634 6.1042 7.6302 15.2604 0.0469 Constraint 859 1596 5.6477 7.0596 14.1192 0.0469 Constraint 818 1519 5.1559 6.4448 12.8896 0.0469 Constraint 650 1014 6.3711 7.9638 15.9277 0.0469 Constraint 639 1117 5.4831 6.8539 13.7078 0.0469 Constraint 630 1268 5.4438 6.8048 13.6096 0.0469 Constraint 557 1556 5.9827 7.4784 14.9568 0.0469 Constraint 530 1587 4.6187 5.7734 11.5468 0.0469 Constraint 530 1575 6.1086 7.6358 15.2716 0.0469 Constraint 530 1548 6.1519 7.6899 15.3797 0.0469 Constraint 521 1587 3.6036 4.5044 9.0089 0.0469 Constraint 501 1611 4.4933 5.6167 11.2333 0.0469 Constraint 421 1548 5.5684 6.9605 13.9210 0.0469 Constraint 97 1030 4.0161 5.0202 10.0403 0.0468 Constraint 91 222 5.0214 6.2768 12.5536 0.0468 Constraint 39 1035 4.8256 6.0320 12.0640 0.0468 Constraint 1416 1788 5.7670 7.2088 14.4176 0.0466 Constraint 1260 1720 4.7621 5.9526 11.9052 0.0466 Constraint 1239 1587 5.7721 7.2151 14.4303 0.0466 Constraint 876 1351 5.0749 6.3436 12.6873 0.0466 Constraint 597 829 4.8822 6.1027 12.2054 0.0466 Constraint 597 818 4.9202 6.1502 12.3005 0.0466 Constraint 557 1030 5.6427 7.0534 14.1068 0.0466 Constraint 493 1059 4.5522 5.6902 11.3804 0.0466 Constraint 448 1008 5.1693 6.4617 12.9233 0.0466 Constraint 443 1008 5.9426 7.4283 14.8566 0.0466 Constraint 384 1596 5.7113 7.1391 14.2782 0.0466 Constraint 97 1092 4.7832 5.9790 11.9580 0.0466 Constraint 538 1634 5.2846 6.6057 13.2114 0.0465 Constraint 530 1634 4.7248 5.9060 11.8120 0.0465 Constraint 1167 1268 5.4424 6.8030 13.6061 0.0462 Constraint 1100 1756 5.4015 6.7519 13.5038 0.0462 Constraint 868 1239 4.4837 5.6046 11.2091 0.0462 Constraint 1511 1748 4.6240 5.7800 11.5600 0.0462 Constraint 91 180 5.2754 6.5943 13.1886 0.0462 Constraint 756 1567 5.8477 7.3096 14.6193 0.0459 Constraint 589 1634 5.0491 6.3113 12.6226 0.0459 Constraint 435 572 5.3415 6.6769 13.3537 0.0459 Constraint 333 630 4.6871 5.8588 11.7176 0.0459 Constraint 299 1548 6.0293 7.5367 15.0733 0.0459 Constraint 249 1683 5.5942 6.9927 13.9854 0.0459 Constraint 208 1731 5.5871 6.9839 13.9678 0.0459 Constraint 189 1731 4.7270 5.9087 11.8174 0.0459 Constraint 189 1720 4.5482 5.6853 11.3706 0.0459 Constraint 1251 1748 6.0028 7.5035 15.0070 0.0459 Constraint 884 1054 5.4626 6.8283 13.6565 0.0458 Constraint 859 1293 6.3724 7.9655 15.9310 0.0458 Constraint 1309 1714 5.4479 6.8098 13.6196 0.0457 Constraint 1141 1343 3.6125 4.5157 9.0314 0.0457 Constraint 731 1488 5.2137 6.5171 13.0343 0.0457 Constraint 333 1030 4.7662 5.9578 11.9155 0.0457 Constraint 314 988 5.7056 7.1320 14.2641 0.0457 Constraint 82 908 5.1441 6.4302 12.8603 0.0457 Constraint 59 921 4.5484 5.6854 11.3709 0.0457 Constraint 988 1541 6.1040 7.6300 15.2600 0.0457 Constraint 980 1519 5.3769 6.7211 13.4422 0.0457 Constraint 944 1678 5.4054 6.7568 13.5135 0.0457 Constraint 597 1141 5.1431 6.4289 12.8578 0.0457 Constraint 375 731 3.6100 4.5125 9.0250 0.0457 Constraint 375 722 4.3866 5.4833 10.9665 0.0457 Constraint 355 731 4.7633 5.9542 11.9083 0.0457 Constraint 347 731 5.5647 6.9558 13.9117 0.0457 Constraint 698 1634 5.6355 7.0444 14.0888 0.0456 Constraint 222 1533 5.3467 6.6834 13.3669 0.0456 Constraint 196 1533 5.1890 6.4862 12.9725 0.0456 Constraint 1239 1692 5.2377 6.5472 13.0944 0.0455 Constraint 997 1670 5.1741 6.4677 12.9354 0.0455 Constraint 968 1391 5.9293 7.4117 14.8233 0.0455 Constraint 963 1054 4.3111 5.3889 10.7778 0.0455 Constraint 955 1575 4.6514 5.8142 11.6284 0.0455 Constraint 868 1391 5.3751 6.7189 13.4379 0.0455 Constraint 836 1587 5.2564 6.5705 13.1411 0.0455 Constraint 639 1408 4.5404 5.6755 11.3510 0.0455 Constraint 616 1541 5.1106 6.3882 12.7764 0.0455 Constraint 597 1678 5.4074 6.7593 13.5185 0.0455 Constraint 549 1077 5.6077 7.0097 14.0194 0.0455 Constraint 521 1054 4.4326 5.5408 11.0815 0.0455 Constraint 487 921 5.8880 7.3600 14.7200 0.0455 Constraint 479 937 5.9215 7.4019 14.8038 0.0455 Constraint 443 650 5.1456 6.4319 12.8639 0.0455 Constraint 435 921 4.7206 5.9007 11.8014 0.0455 Constraint 403 921 4.2765 5.3456 10.6912 0.0455 Constraint 189 1382 4.9982 6.2478 12.4956 0.0455 Constraint 154 1374 4.3024 5.3780 10.7561 0.0455 Constraint 1178 1317 4.5162 5.6453 11.2906 0.0454 Constraint 164 988 4.6545 5.8181 11.6362 0.0454 Constraint 66 1399 4.9985 6.2481 12.4962 0.0454 Constraint 1466 1603 5.5810 6.9762 13.9525 0.0453 Constraint 1284 1670 3.9796 4.9745 9.9490 0.0453 Constraint 968 1117 5.7677 7.2096 14.4192 0.0453 Constraint 963 1125 5.2370 6.5462 13.0925 0.0453 Constraint 899 1416 4.5704 5.7129 11.4259 0.0453 Constraint 808 1158 5.6867 7.1084 14.2168 0.0453 Constraint 783 1133 5.5779 6.9724 13.9448 0.0453 Constraint 748 1466 6.3961 7.9952 15.9903 0.0453 Constraint 731 1455 4.7419 5.9274 11.8548 0.0453 Constraint 722 1149 6.3204 7.9005 15.8010 0.0453 Constraint 713 1567 5.2732 6.5915 13.1830 0.0453 Constraint 713 1556 6.3061 7.8826 15.7653 0.0453 Constraint 713 1494 5.2930 6.6162 13.2324 0.0453 Constraint 713 1471 5.4198 6.7748 13.5495 0.0453 Constraint 589 1117 5.6734 7.0917 14.1834 0.0453 Constraint 589 1092 6.2790 7.8488 15.6976 0.0453 Constraint 589 1059 6.2590 7.8238 15.6475 0.0453 Constraint 564 1351 6.1546 7.6932 15.3864 0.0453 Constraint 557 1408 5.1509 6.4386 12.8772 0.0453 Constraint 530 1471 5.0111 6.2639 12.5278 0.0453 Constraint 487 1447 4.8436 6.0545 12.1091 0.0453 Constraint 479 955 4.4165 5.5206 11.0413 0.0453 Constraint 466 1466 5.6647 7.0809 14.1618 0.0453 Constraint 448 1084 6.0671 7.5839 15.1677 0.0453 Constraint 448 1035 5.7646 7.2057 14.4115 0.0453 Constraint 448 955 5.9287 7.4109 14.8218 0.0453 Constraint 421 1035 5.2061 6.5076 13.0151 0.0453 Constraint 363 997 5.7612 7.2015 14.4030 0.0453 Constraint 333 908 4.3339 5.4174 10.8348 0.0453 Constraint 325 466 4.5897 5.7372 11.4743 0.0453 Constraint 299 1455 5.6588 7.0735 14.1469 0.0453 Constraint 299 466 4.0892 5.1115 10.2230 0.0453 Constraint 294 1494 4.8634 6.0793 12.1585 0.0453 Constraint 294 501 6.0992 7.6240 15.2480 0.0453 Constraint 285 457 5.8649 7.3312 14.6623 0.0453 Constraint 274 457 4.7030 5.8788 11.7575 0.0453 Constraint 263 1556 6.2450 7.8063 15.6126 0.0453 Constraint 263 1533 4.5867 5.7334 11.4668 0.0453 Constraint 263 1503 5.8441 7.3052 14.6103 0.0453 Constraint 263 1494 5.3237 6.6547 13.3093 0.0453 Constraint 263 1455 5.8224 7.2779 14.5559 0.0453 Constraint 256 1533 6.2747 7.8434 15.6868 0.0453 Constraint 241 1596 5.2662 6.5828 13.1655 0.0453 Constraint 180 1193 4.8861 6.1076 12.2152 0.0453 Constraint 180 1167 4.5959 5.7449 11.4899 0.0453 Constraint 154 1268 5.2382 6.5478 13.0956 0.0453 Constraint 154 1193 5.2205 6.5257 13.0513 0.0453 Constraint 145 1556 6.1464 7.6830 15.3659 0.0453 Constraint 136 630 5.9585 7.4481 14.8962 0.0453 Constraint 136 623 4.1258 5.1572 10.3144 0.0453 Constraint 128 1293 4.2867 5.3584 10.7168 0.0453 Constraint 121 1268 6.0403 7.5504 15.1008 0.0453 Constraint 121 1260 3.3955 4.2443 8.4887 0.0453 Constraint 121 1204 4.8712 6.0890 12.1781 0.0453 Constraint 91 1260 6.0982 7.6228 15.2455 0.0453 Constraint 66 1228 5.6699 7.0874 14.1749 0.0453 Constraint 47 630 6.3555 7.9443 15.8886 0.0453 Constraint 25 630 5.6102 7.0128 14.0255 0.0453 Constraint 25 623 4.6990 5.8738 11.7476 0.0453 Constraint 18 1077 4.2827 5.3534 10.7068 0.0453 Constraint 18 1046 3.8714 4.8392 9.6784 0.0453 Constraint 18 650 5.3727 6.7158 13.4316 0.0453 Constraint 18 623 4.8059 6.0074 12.0148 0.0453 Constraint 1391 1764 5.7450 7.1813 14.3626 0.0453 Constraint 1382 1772 6.2856 7.8570 15.7140 0.0453 Constraint 756 1325 4.5865 5.7331 11.4662 0.0453 Constraint 748 1213 6.2896 7.8620 15.7241 0.0453 Constraint 748 921 5.0831 6.3539 12.7078 0.0453 Constraint 731 1100 4.2078 5.2598 10.5196 0.0453 Constraint 722 1325 5.6048 7.0060 14.0119 0.0453 Constraint 241 1109 5.3732 6.7165 13.4330 0.0453 Constraint 216 1133 5.4659 6.8323 13.6646 0.0453 Constraint 216 1100 5.6088 7.0109 14.0219 0.0453 Constraint 189 1158 5.5996 6.9995 13.9989 0.0453 Constraint 189 1133 3.9882 4.9852 9.9704 0.0453 Constraint 97 997 4.6369 5.7961 11.5921 0.0453 Constraint 91 241 5.4455 6.8069 13.6137 0.0453 Constraint 25 1204 6.0383 7.5478 15.0957 0.0453 Constraint 792 1158 5.0571 6.3214 12.6427 0.0453 Constraint 769 1158 6.0775 7.5968 15.1937 0.0453 Constraint 761 1158 5.0372 6.2965 12.5931 0.0453 Constraint 690 1567 5.0338 6.2922 12.5845 0.0453 Constraint 564 829 5.7008 7.1260 14.2519 0.0452 Constraint 1117 1358 4.8290 6.0362 12.0724 0.0452 Constraint 368 739 3.5075 4.3844 8.7688 0.0452 Constraint 347 739 4.0345 5.0432 10.0863 0.0452 Constraint 955 1479 5.4282 6.7853 13.5706 0.0451 Constraint 347 1575 5.6725 7.0906 14.1812 0.0451 Constraint 1068 1438 5.1708 6.4635 12.9270 0.0450 Constraint 1068 1408 5.4569 6.8211 13.6421 0.0450 Constraint 294 579 5.5454 6.9317 13.8634 0.0450 Constraint 608 1519 4.7362 5.9202 11.8404 0.0450 Constraint 128 227 4.3968 5.4960 10.9920 0.0448 Constraint 1014 1438 3.9022 4.8778 9.7556 0.0447 Constraint 892 1100 5.1306 6.4132 12.8265 0.0447 Constraint 597 859 5.2962 6.6202 13.2405 0.0447 Constraint 435 616 4.2371 5.2964 10.5929 0.0447 Constraint 347 487 4.8890 6.1112 12.2225 0.0447 Constraint 314 690 5.2532 6.5665 13.1330 0.0447 Constraint 285 572 4.0211 5.0264 10.0528 0.0447 Constraint 233 403 4.6632 5.8290 11.6581 0.0447 Constraint 216 355 4.5999 5.7499 11.4998 0.0447 Constraint 208 355 5.6369 7.0461 14.0922 0.0447 Constraint 1046 1427 5.7729 7.2161 14.4322 0.0447 Constraint 1239 1374 3.9883 4.9854 9.9708 0.0447 Constraint 249 1511 5.3700 6.7125 13.4250 0.0447 Constraint 222 1541 4.4884 5.6105 11.2211 0.0447 Constraint 154 1603 5.1259 6.4073 12.8146 0.0447 Constraint 145 227 4.1691 5.2114 10.4228 0.0447 Constraint 761 1068 4.7064 5.8830 11.7659 0.0445 Constraint 333 681 4.9451 6.1813 12.3627 0.0445 Constraint 1634 1748 4.4514 5.5642 11.1284 0.0445 Constraint 1634 1720 4.9388 6.1735 12.3470 0.0445 Constraint 1494 1649 5.9135 7.3918 14.7837 0.0445 Constraint 1301 1494 5.0659 6.3324 12.6648 0.0445 Constraint 722 1391 5.5846 6.9808 13.9616 0.0445 Constraint 713 892 5.2640 6.5800 13.1599 0.0445 Constraint 347 597 5.3562 6.6953 13.3905 0.0445 Constraint 33 263 5.7239 7.1549 14.3098 0.0445 Constraint 1374 1720 5.3781 6.7226 13.4453 0.0445 Constraint 1309 1634 4.5158 5.6448 11.2895 0.0445 Constraint 783 908 5.7333 7.1666 14.3332 0.0445 Constraint 690 1334 5.1095 6.3868 12.7737 0.0445 Constraint 921 1100 5.4610 6.8263 13.6526 0.0444 Constraint 285 564 4.6160 5.7700 11.5400 0.0444 Constraint 233 1100 4.3473 5.4341 10.8682 0.0444 Constraint 136 650 5.0564 6.3206 12.6411 0.0444 Constraint 1133 1541 5.9260 7.4075 14.8149 0.0443 Constraint 829 1351 5.5496 6.9369 13.8739 0.0443 Constraint 564 1109 5.3967 6.7459 13.4918 0.0443 Constraint 448 769 4.1669 5.2086 10.4171 0.0443 Constraint 91 412 5.9744 7.4680 14.9361 0.0443 Constraint 59 421 5.4893 6.8616 13.7232 0.0443 Constraint 59 216 5.0624 6.3280 12.6560 0.0443 Constraint 59 325 5.9508 7.4385 14.8771 0.0441 Constraint 1325 1548 4.3392 5.4240 10.8481 0.0439 Constraint 722 1301 5.6021 7.0026 14.0052 0.0439 Constraint 808 1567 5.2169 6.5211 13.0421 0.0435 Constraint 657 1533 4.6858 5.8573 11.7146 0.0435 Constraint 623 1556 5.4538 6.8172 13.6345 0.0435 Constraint 333 510 4.5888 5.7361 11.4721 0.0435 Constraint 608 1455 5.7704 7.2130 14.4260 0.0435 Constraint 608 876 4.3280 5.4100 10.8199 0.0435 Constraint 263 761 4.9982 6.2478 12.4956 0.0435 Constraint 299 429 5.4303 6.7879 13.5757 0.0435 Constraint 39 1193 4.5865 5.7331 11.4662 0.0435 Constraint 1239 1541 6.3318 7.9147 15.8294 0.0434 Constraint 1204 1720 5.0158 6.2697 12.5394 0.0434 Constraint 1193 1748 5.5949 6.9936 13.9872 0.0434 Constraint 1193 1334 6.1890 7.7362 15.4724 0.0434 Constraint 1178 1678 4.6002 5.7503 11.5005 0.0434 Constraint 1178 1494 6.1491 7.6864 15.3728 0.0434 Constraint 1167 1634 4.7434 5.9293 11.8585 0.0434 Constraint 1167 1494 4.2372 5.2966 10.5931 0.0434 Constraint 1167 1246 4.1432 5.1790 10.3581 0.0434 Constraint 1149 1748 5.3413 6.6767 13.3533 0.0434 Constraint 1133 1334 4.1561 5.1951 10.3901 0.0434 Constraint 1125 1325 3.8313 4.7891 9.5783 0.0434 Constraint 1125 1301 6.3430 7.9287 15.8574 0.0434 Constraint 1092 1276 5.6460 7.0575 14.1150 0.0434 Constraint 1068 1503 5.9142 7.3928 14.7855 0.0434 Constraint 1059 1526 6.3471 7.9339 15.8677 0.0434 Constraint 1030 1548 5.0572 6.3214 12.6429 0.0434 Constraint 1030 1526 5.2855 6.6069 13.2138 0.0434 Constraint 1030 1149 4.2688 5.3360 10.6721 0.0434 Constraint 1022 1556 3.6284 4.5356 9.0711 0.0434 Constraint 1022 1548 6.2617 7.8272 15.6544 0.0434 Constraint 997 1692 5.7549 7.1936 14.3871 0.0434 Constraint 988 1748 5.6182 7.0227 14.0454 0.0434 Constraint 988 1325 6.1578 7.6973 15.3946 0.0434 Constraint 937 1596 5.8855 7.3569 14.7138 0.0434 Constraint 908 1408 4.7686 5.9608 11.9215 0.0434 Constraint 899 1317 6.0111 7.5139 15.0277 0.0434 Constraint 868 1351 5.6035 7.0044 14.0088 0.0434 Constraint 829 1301 5.7769 7.2212 14.4424 0.0434 Constraint 748 1220 5.9915 7.4894 14.9787 0.0434 Constraint 731 1193 5.1767 6.4709 12.9417 0.0434 Constraint 722 1228 6.1305 7.6632 15.3263 0.0434 Constraint 722 1220 3.3588 4.1985 8.3970 0.0434 Constraint 722 1193 5.1444 6.4305 12.8610 0.0434 Constraint 713 1220 5.9984 7.4979 14.9959 0.0434 Constraint 713 1100 3.6847 4.6058 9.2117 0.0434 Constraint 706 1100 4.4055 5.5069 11.0138 0.0434 Constraint 698 1251 5.7807 7.2259 14.4518 0.0434 Constraint 698 1220 5.4484 6.8105 13.6210 0.0434 Constraint 690 1158 4.5375 5.6718 11.3436 0.0434 Constraint 657 1125 5.6117 7.0146 14.0291 0.0434 Constraint 650 1109 5.0622 6.3278 12.6556 0.0434 Constraint 630 1603 4.9251 6.1564 12.3128 0.0434 Constraint 630 1100 3.9835 4.9794 9.9588 0.0434 Constraint 630 1077 5.5694 6.9617 13.9235 0.0434 Constraint 608 1603 3.2437 4.0546 8.1092 0.0434 Constraint 597 1548 5.6619 7.0774 14.1547 0.0434 Constraint 597 1008 4.4402 5.5503 11.1006 0.0434 Constraint 589 955 3.9505 4.9381 9.8762 0.0434 Constraint 579 1634 4.5785 5.7232 11.4463 0.0434 Constraint 579 1603 5.5887 6.9858 13.9717 0.0434 Constraint 579 1548 5.9903 7.4879 14.9758 0.0434 Constraint 572 1014 4.8463 6.0579 12.1157 0.0434 Constraint 572 930 4.6014 5.7517 11.5034 0.0434 Constraint 564 955 5.6975 7.1219 14.2437 0.0434 Constraint 564 783 5.6517 7.0647 14.1293 0.0434 Constraint 557 1427 4.8008 6.0010 12.0019 0.0434 Constraint 549 1670 4.0974 5.1218 10.2436 0.0434 Constraint 538 930 4.5374 5.6718 11.3436 0.0434 Constraint 530 1427 5.5114 6.8892 13.7785 0.0434 Constraint 530 1343 5.8793 7.3492 14.6983 0.0434 Constraint 530 1309 5.7611 7.2013 14.4027 0.0434 Constraint 530 988 5.6968 7.1210 14.2421 0.0434 Constraint 510 1788 5.2267 6.5333 13.0667 0.0434 Constraint 510 808 6.3352 7.9189 15.8379 0.0434 Constraint 501 1125 5.7932 7.2415 14.4830 0.0434 Constraint 493 1358 5.5083 6.8854 13.7708 0.0434 Constraint 493 1351 6.2807 7.8509 15.7018 0.0434 Constraint 493 1246 6.1927 7.7409 15.4819 0.0434 Constraint 493 1220 5.5083 6.8854 13.7708 0.0434 Constraint 487 1358 5.9291 7.4114 14.8227 0.0434 Constraint 487 1351 4.2661 5.3327 10.6653 0.0434 Constraint 487 1343 5.8230 7.2787 14.5574 0.0434 Constraint 487 1220 5.9291 7.4114 14.8227 0.0434 Constraint 487 1213 5.7015 7.1268 14.2537 0.0434 Constraint 479 1008 6.0481 7.5601 15.1202 0.0434 Constraint 479 761 4.8076 6.0094 12.0189 0.0434 Constraint 466 1382 5.7563 7.1953 14.3907 0.0434 Constraint 466 1374 6.0333 7.5417 15.0833 0.0434 Constraint 466 1358 3.7273 4.6591 9.3183 0.0434 Constraint 466 1246 5.8290 7.2862 14.5724 0.0434 Constraint 466 1220 3.7273 4.6591 9.3183 0.0434 Constraint 448 892 5.2729 6.5912 13.1823 0.0434 Constraint 333 1284 5.5259 6.9074 13.8147 0.0434 Constraint 333 1260 3.9681 4.9601 9.9202 0.0434 Constraint 333 1251 4.6644 5.8305 11.6610 0.0434 Constraint 325 403 4.3364 5.4205 10.8411 0.0434 Constraint 314 1260 3.9317 4.9146 9.8292 0.0434 Constraint 314 1251 4.6138 5.7673 11.5346 0.0434 Constraint 299 1284 4.6610 5.8263 11.6525 0.0434 Constraint 263 1479 5.8407 7.3009 14.6018 0.0434 Constraint 241 908 5.5972 6.9964 13.9929 0.0434 Constraint 233 1438 5.5085 6.8856 13.7712 0.0434 Constraint 233 1408 3.9492 4.9366 9.8731 0.0434 Constraint 233 1343 5.4974 6.8717 13.7434 0.0434 Constraint 233 908 4.9108 6.1385 12.2769 0.0434 Constraint 233 829 4.9537 6.1921 12.3842 0.0434 Constraint 227 1343 6.1059 7.6324 15.2649 0.0434 Constraint 227 731 5.9365 7.4206 14.8411 0.0434 Constraint 216 1366 5.2023 6.5028 13.0056 0.0434 Constraint 216 899 3.6387 4.5484 9.0968 0.0434 Constraint 216 829 3.1201 3.9001 7.8002 0.0434 Constraint 208 1556 6.3579 7.9474 15.8948 0.0434 Constraint 196 1438 4.6563 5.8203 11.6406 0.0434 Constraint 196 1408 5.3099 6.6374 13.2747 0.0434 Constraint 196 1399 5.1820 6.4775 12.9549 0.0434 Constraint 196 731 5.5600 6.9500 13.8999 0.0434 Constraint 136 829 5.9067 7.3833 14.7667 0.0434 Constraint 136 818 3.9855 4.9819 9.9638 0.0434 Constraint 136 800 5.3438 6.6797 13.3595 0.0434 Constraint 112 800 4.6138 5.7672 11.5344 0.0434 Constraint 82 792 3.8023 4.7529 9.5058 0.0434 Constraint 77 792 3.0977 3.8721 7.7442 0.0434 Constraint 66 792 6.2913 7.8641 15.7282 0.0434 Constraint 59 1556 6.3194 7.8992 15.7984 0.0434 Constraint 59 792 5.8990 7.3737 14.7474 0.0434 Constraint 18 1503 5.2797 6.5996 13.1992 0.0434 Constraint 3 1100 5.8765 7.3456 14.6913 0.0434 Constraint 3 706 6.2473 7.8092 15.6184 0.0434 Constraint 1399 1620 3.8010 4.7512 9.5024 0.0433 Constraint 1084 1596 4.8752 6.0940 12.1880 0.0433 Constraint 980 1284 5.0474 6.3092 12.6184 0.0432 Constraint 963 1466 4.7114 5.8892 11.7784 0.0432 Constraint 944 1714 4.8551 6.0688 12.1377 0.0432 Constraint 937 1519 5.5064 6.8830 13.7660 0.0432 Constraint 921 1748 5.6334 7.0417 14.0834 0.0432 Constraint 913 1714 4.7748 5.9685 11.9371 0.0432 Constraint 848 1488 4.0782 5.0978 10.1956 0.0432 Constraint 829 1575 5.7368 7.1710 14.3421 0.0432 Constraint 829 1519 5.2636 6.5795 13.1589 0.0432 Constraint 818 1488 5.7730 7.2163 14.4325 0.0432 Constraint 792 1416 4.5369 5.6711 11.3422 0.0432 Constraint 792 1391 5.9225 7.4032 14.8063 0.0432 Constraint 792 1382 5.6576 7.0719 14.1439 0.0432 Constraint 769 1391 5.0985 6.3731 12.7461 0.0432 Constraint 769 1358 3.8002 4.7503 9.5006 0.0432 Constraint 690 1309 5.6788 7.0984 14.1969 0.0432 Constraint 690 1301 4.7204 5.9005 11.8010 0.0432 Constraint 623 1466 6.0374 7.5467 15.0935 0.0432 Constraint 623 1438 3.6054 4.5067 9.0135 0.0432 Constraint 608 1471 4.0810 5.1012 10.2024 0.0432 Constraint 521 913 6.1490 7.6863 15.3726 0.0432 Constraint 521 908 5.7325 7.1656 14.3312 0.0432 Constraint 479 1193 6.2797 7.8496 15.6993 0.0432 Constraint 435 1014 5.1510 6.4387 12.8774 0.0432 Constraint 403 988 5.0225 6.2782 12.5564 0.0432 Constraint 384 1764 4.5615 5.7018 11.4036 0.0432 Constraint 375 955 3.5092 4.3865 8.7730 0.0432 Constraint 355 1772 3.8192 4.7741 9.5481 0.0432 Constraint 355 1764 5.2259 6.5323 13.0647 0.0432 Constraint 355 1739 4.5893 5.7367 11.4734 0.0432 Constraint 355 955 6.2014 7.7518 15.5035 0.0432 Constraint 325 1739 3.5452 4.4316 8.8631 0.0432 Constraint 314 808 4.0268 5.0335 10.0669 0.0432 Constraint 306 756 5.7050 7.1313 14.2626 0.0432 Constraint 285 756 3.6395 4.5493 9.0987 0.0432 Constraint 274 1526 5.7680 7.2100 14.4199 0.0432 Constraint 274 1276 5.6207 7.0258 14.0516 0.0432 Constraint 263 1548 5.3937 6.7421 13.4841 0.0432 Constraint 263 1526 3.3319 4.1649 8.3298 0.0432 Constraint 256 1526 5.8329 7.2911 14.5822 0.0432 Constraint 222 1251 4.9140 6.1426 12.2851 0.0432 Constraint 222 1246 4.0933 5.1166 10.2333 0.0432 Constraint 189 1503 3.3781 4.2227 8.4453 0.0432 Constraint 164 944 6.3707 7.9634 15.9268 0.0432 Constraint 145 1479 3.3830 4.2287 8.4574 0.0432 Constraint 112 1479 5.8283 7.2854 14.5708 0.0432 Constraint 97 1325 5.2202 6.5252 13.0505 0.0432 Constraint 82 944 4.3223 5.4029 10.8058 0.0432 Constraint 82 921 4.4306 5.5383 11.0766 0.0432 Constraint 77 1301 5.2611 6.5764 13.1529 0.0432 Constraint 66 1301 3.9193 4.8992 9.7984 0.0432 Constraint 66 1293 4.8814 6.1017 12.2035 0.0432 Constraint 59 1301 4.5628 5.7035 11.4070 0.0432 Constraint 39 1634 5.7815 7.2269 14.4539 0.0432 Constraint 39 1455 5.9119 7.3899 14.7797 0.0432 Constraint 39 1293 4.4924 5.6155 11.2309 0.0432 Constraint 39 1268 5.5255 6.9069 13.8138 0.0432 Constraint 33 1603 6.1262 7.6578 15.3156 0.0432 Constraint 33 1455 3.3704 4.2131 8.4261 0.0432 Constraint 33 1301 4.5212 5.6514 11.3029 0.0432 Constraint 33 1268 4.4115 5.5144 11.0287 0.0432 Constraint 33 1246 4.3788 5.4735 10.9470 0.0432 Constraint 25 1301 4.2740 5.3425 10.6850 0.0432 Constraint 25 1239 6.0037 7.5046 15.0092 0.0432 Constraint 18 1657 4.6636 5.8296 11.6591 0.0432 Constraint 18 1455 3.8087 4.7609 9.5219 0.0432 Constraint 18 1125 6.3391 7.9238 15.8476 0.0432 Constraint 1662 1748 4.8303 6.0379 12.0758 0.0432 Constraint 1068 1193 4.7139 5.8924 11.7847 0.0432 Constraint 1054 1488 4.4750 5.5938 11.1876 0.0432 Constraint 899 1239 4.4537 5.5671 11.1341 0.0432 Constraint 899 1213 5.9177 7.3971 14.7942 0.0432 Constraint 739 1466 4.4617 5.5771 11.1543 0.0432 Constraint 665 1634 5.2437 6.5546 13.1092 0.0432 Constraint 189 510 5.6714 7.0893 14.1786 0.0432 Constraint 154 538 5.6452 7.0566 14.1131 0.0432 Constraint 136 510 5.1271 6.4089 12.8178 0.0432 Constraint 18 112 4.4035 5.5043 11.0086 0.0432 Constraint 829 1046 5.7958 7.2448 14.4896 0.0431 Constraint 818 1046 5.4431 6.8038 13.6076 0.0431 Constraint 808 937 6.1795 7.7244 15.4488 0.0431 Constraint 579 1541 5.2585 6.5731 13.1462 0.0431 Constraint 1471 1764 4.9376 6.1720 12.3439 0.0429 Constraint 1447 1739 5.9712 7.4640 14.9281 0.0429 Constraint 1046 1167 5.7733 7.2167 14.4334 0.0428 Constraint 963 1471 4.9909 6.2387 12.4773 0.0428 Constraint 333 731 6.3560 7.9450 15.8900 0.0428 Constraint 66 1657 5.0999 6.3749 12.7498 0.0428 Constraint 630 739 4.4460 5.5575 11.1150 0.0427 Constraint 859 1603 5.9885 7.4856 14.9712 0.0427 Constraint 623 868 5.0507 6.3134 12.6268 0.0427 Constraint 233 333 4.2389 5.2986 10.5972 0.0427 Constraint 892 1260 5.0189 6.2736 12.5472 0.0426 Constraint 783 1488 5.4020 6.7525 13.5050 0.0426 Constraint 59 1657 5.7914 7.2393 14.4785 0.0426 Constraint 11 1756 5.8680 7.3349 14.6699 0.0426 Constraint 1030 1117 5.4896 6.8620 13.7241 0.0425 Constraint 1268 1603 5.5168 6.8960 13.7919 0.0423 Constraint 1178 1670 5.6310 7.0388 14.0775 0.0423 Constraint 963 1756 4.6939 5.8674 11.7348 0.0423 Constraint 908 1343 5.8580 7.3225 14.6450 0.0423 Constraint 579 1309 5.3968 6.7460 13.4919 0.0423 Constraint 241 930 5.2904 6.6129 13.2259 0.0423 Constraint 82 769 4.6523 5.8154 11.6308 0.0423 Constraint 59 800 5.5966 6.9958 13.9916 0.0423 Constraint 59 769 5.3436 6.6795 13.3590 0.0423 Constraint 1427 1739 5.9027 7.3784 14.7568 0.0422 Constraint 233 510 3.7901 4.7376 9.4752 0.0422 Constraint 97 1634 5.3528 6.6910 13.3820 0.0421 Constraint 1054 1479 5.7360 7.1700 14.3401 0.0420 Constraint 1519 1756 4.8256 6.0320 12.0641 0.0419 Constraint 706 1133 6.0966 7.6207 15.2414 0.0419 Constraint 33 1657 4.6193 5.7741 11.5481 0.0419 Constraint 908 1503 4.7485 5.9356 11.8713 0.0418 Constraint 1479 1739 4.1991 5.2488 10.4977 0.0418 Constraint 1204 1351 5.6108 7.0135 14.0270 0.0418 Constraint 980 1427 6.1312 7.6640 15.3280 0.0418 Constraint 944 1366 5.5853 6.9816 13.9633 0.0418 Constraint 921 1366 5.8730 7.3412 14.6824 0.0418 Constraint 792 1167 6.3623 7.9529 15.9057 0.0418 Constraint 706 913 4.9348 6.1685 12.3370 0.0418 Constraint 650 908 4.3782 5.4727 10.9455 0.0418 Constraint 608 1014 6.1866 7.7333 15.4666 0.0418 Constraint 501 1447 4.0127 5.0159 10.0319 0.0418 Constraint 222 403 3.2390 4.0488 8.0976 0.0418 Constraint 196 623 4.7481 5.9351 11.8701 0.0418 Constraint 82 347 5.5299 6.9124 13.8248 0.0418 Constraint 1204 1662 5.3492 6.6865 13.3731 0.0417 Constraint 1178 1391 5.3951 6.7439 13.4879 0.0417 Constraint 988 1408 4.3102 5.3877 10.7755 0.0417 Constraint 908 1092 5.3769 6.7211 13.4423 0.0417 Constraint 908 1077 5.1252 6.4065 12.8130 0.0417 Constraint 892 1167 4.5268 5.6585 11.3170 0.0417 Constraint 630 899 4.8731 6.0914 12.1828 0.0417 Constraint 623 1662 4.8306 6.0382 12.0764 0.0417 Constraint 597 836 4.9925 6.2406 12.4812 0.0417 Constraint 589 681 5.1122 6.3903 12.7806 0.0417 Constraint 579 1077 4.7224 5.9031 11.8061 0.0417 Constraint 549 1059 5.0375 6.2969 12.5938 0.0417 Constraint 530 608 4.4683 5.5854 11.1707 0.0417 Constraint 510 1054 5.0016 6.2519 12.5039 0.0417 Constraint 448 650 4.0410 5.0513 10.1026 0.0417 Constraint 256 597 4.4838 5.6048 11.2095 0.0417 Constraint 256 589 5.4878 6.8597 13.7194 0.0417 Constraint 97 963 5.7073 7.1341 14.2681 0.0417 Constraint 97 944 5.4441 6.8052 13.6103 0.0417 Constraint 77 913 5.7303 7.1628 14.3256 0.0417 Constraint 66 963 5.5992 6.9990 13.9981 0.0417 Constraint 47 172 5.4045 6.7556 13.5111 0.0417 Constraint 18 121 5.1579 6.4474 12.8948 0.0417 Constraint 1438 1634 5.0645 6.3307 12.6614 0.0416 Constraint 299 375 5.4651 6.8314 13.6628 0.0416 Constraint 1325 1438 5.2279 6.5349 13.0697 0.0415 Constraint 859 1567 5.3992 6.7490 13.4980 0.0415 Constraint 859 1260 5.4473 6.8092 13.6184 0.0415 Constraint 608 980 5.5248 6.9060 13.8119 0.0415 Constraint 487 937 5.3634 6.7042 13.4084 0.0415 Constraint 487 930 4.9139 6.1424 12.2847 0.0415 Constraint 392 1611 6.0824 7.6031 15.2061 0.0415 Constraint 392 1587 4.3238 5.4048 10.8096 0.0415 Constraint 274 876 4.6501 5.8126 11.6252 0.0415 Constraint 241 1479 5.3248 6.6559 13.3119 0.0415 Constraint 136 1022 6.3157 7.8947 15.7894 0.0415 Constraint 136 1014 5.2963 6.6203 13.2407 0.0415 Constraint 128 1014 5.4173 6.7716 13.5433 0.0415 Constraint 97 1084 4.6673 5.8341 11.6682 0.0415 Constraint 1220 1427 4.5878 5.7348 11.4696 0.0414 Constraint 783 1068 5.2024 6.5030 13.0059 0.0414 Constraint 639 968 3.8811 4.8513 9.7027 0.0414 Constraint 731 963 4.4952 5.6190 11.2381 0.0413 Constraint 706 836 5.2190 6.5237 13.0474 0.0413 Constraint 665 899 4.9599 6.1999 12.3998 0.0413 Constraint 154 657 5.9713 7.4642 14.9283 0.0413 Constraint 1178 1764 5.9882 7.4853 14.9706 0.0412 Constraint 1158 1764 3.1207 3.9008 7.8017 0.0412 Constraint 988 1141 5.7517 7.1896 14.3792 0.0412 Constraint 963 1228 4.7703 5.9628 11.9257 0.0412 Constraint 921 1587 5.3574 6.6967 13.3934 0.0412 Constraint 884 1408 6.3842 7.9802 15.9605 0.0412 Constraint 818 1239 5.1421 6.4277 12.8554 0.0412 Constraint 800 1228 2.8827 3.6034 7.2067 0.0412 Constraint 800 1213 5.9779 7.4723 14.9447 0.0412 Constraint 800 1193 6.2565 7.8207 15.6413 0.0412 Constraint 778 1228 3.4516 4.3145 8.6289 0.0412 Constraint 778 1193 4.4305 5.5382 11.0764 0.0412 Constraint 769 1167 5.4492 6.8115 13.6231 0.0412 Constraint 756 1309 5.4335 6.7918 13.5836 0.0412 Constraint 608 1149 4.5136 5.6421 11.2841 0.0412 Constraint 608 1117 5.8528 7.3160 14.6320 0.0412 Constraint 608 792 4.5857 5.7321 11.4642 0.0412 Constraint 589 1178 6.3831 7.9789 15.9578 0.0412 Constraint 589 1167 5.5182 6.8978 13.7955 0.0412 Constraint 306 657 5.8331 7.2914 14.5827 0.0412 Constraint 128 859 4.0691 5.0863 10.1727 0.0412 Constraint 18 299 5.5108 6.8885 13.7771 0.0412 Constraint 1611 1714 4.4465 5.5582 11.1163 0.0411 Constraint 1293 1488 5.9469 7.4337 14.8674 0.0411 Constraint 1092 1620 6.2533 7.8166 15.6332 0.0411 Constraint 1084 1662 6.0361 7.5451 15.0903 0.0411 Constraint 1059 1611 6.0498 7.5623 15.1245 0.0411 Constraint 1054 1777 5.7785 7.2231 14.4463 0.0411 Constraint 1054 1662 5.9024 7.3779 14.7559 0.0411 Constraint 1035 1662 5.6986 7.1232 14.2465 0.0411 Constraint 1030 1777 4.3066 5.3832 10.7664 0.0411 Constraint 1022 1358 3.0141 3.7676 7.5352 0.0411 Constraint 997 1764 5.2806 6.6007 13.2014 0.0411 Constraint 997 1739 4.7685 5.9607 11.9214 0.0411 Constraint 997 1391 5.6725 7.0906 14.1813 0.0411 Constraint 988 1764 4.1636 5.2045 10.4089 0.0411 Constraint 968 1756 4.5480 5.6850 11.3700 0.0411 Constraint 963 1772 4.6749 5.8436 11.6873 0.0411 Constraint 963 1764 3.7088 4.6359 9.2719 0.0411 Constraint 963 1739 3.7792 4.7239 9.4479 0.0411 Constraint 930 1382 6.0105 7.5131 15.0262 0.0411 Constraint 930 1351 4.8771 6.0963 12.1927 0.0411 Constraint 930 1343 6.0854 7.6068 15.2135 0.0411 Constraint 930 1325 4.2424 5.3030 10.6060 0.0411 Constraint 930 1309 4.8098 6.0123 12.0245 0.0411 Constraint 908 1657 4.9559 6.1948 12.3897 0.0411 Constraint 859 1511 5.6887 7.1109 14.2218 0.0411 Constraint 848 1382 5.6791 7.0989 14.1978 0.0411 Constraint 836 1670 4.3287 5.4108 10.8216 0.0411 Constraint 836 1117 5.7512 7.1890 14.3779 0.0411 Constraint 829 1678 6.1082 7.6352 15.2705 0.0411 Constraint 818 1059 3.7902 4.7377 9.4755 0.0411 Constraint 808 1391 4.1795 5.2243 10.4487 0.0411 Constraint 792 1427 5.9192 7.3990 14.7981 0.0411 Constraint 792 1374 5.2504 6.5630 13.1259 0.0411 Constraint 792 930 6.3858 7.9822 15.9645 0.0411 Constraint 783 1391 6.1879 7.7349 15.4698 0.0411 Constraint 778 1334 6.2107 7.7634 15.5267 0.0411 Constraint 769 1325 5.5376 6.9220 13.8440 0.0411 Constraint 769 1141 3.7923 4.7403 9.4807 0.0411 Constraint 761 963 5.7135 7.1418 14.2837 0.0411 Constraint 756 1533 6.1987 7.7484 15.4968 0.0411 Constraint 756 1466 5.7293 7.1617 14.3234 0.0411 Constraint 756 1427 5.7848 7.2310 14.4619 0.0411 Constraint 748 1455 6.1195 7.6494 15.2988 0.0411 Constraint 739 1374 5.6337 7.0422 14.0843 0.0411 Constraint 739 1351 3.0252 3.7816 7.5631 0.0411 Constraint 739 1343 4.1574 5.1967 10.3935 0.0411 Constraint 739 1092 5.7219 7.1524 14.3049 0.0411 Constraint 739 1084 3.4622 4.3278 8.6555 0.0411 Constraint 731 1035 6.2449 7.8061 15.6122 0.0411 Constraint 722 1494 5.4542 6.8177 13.6355 0.0411 Constraint 722 1488 4.8865 6.1081 12.2162 0.0411 Constraint 706 1317 5.0834 6.3542 12.7085 0.0411 Constraint 706 1293 4.2427 5.3034 10.6068 0.0411 Constraint 706 1178 5.4450 6.8062 13.6124 0.0411 Constraint 706 1158 3.5523 4.4404 8.8809 0.0411 Constraint 698 1228 5.2651 6.5814 13.1628 0.0411 Constraint 690 1213 6.0202 7.5253 15.0505 0.0411 Constraint 681 1634 4.5689 5.7112 11.4223 0.0411 Constraint 673 1125 4.5668 5.7085 11.4171 0.0411 Constraint 665 1567 6.1654 7.7068 15.4135 0.0411 Constraint 665 1533 4.2501 5.3126 10.6253 0.0411 Constraint 657 1683 5.4660 6.8324 13.6649 0.0411 Constraint 657 1634 4.5550 5.6937 11.3874 0.0411 Constraint 657 1351 5.4873 6.8592 13.7184 0.0411 Constraint 657 1343 5.4451 6.8063 13.6127 0.0411 Constraint 639 1213 6.3898 7.9873 15.9746 0.0411 Constraint 639 1178 4.7067 5.8834 11.7668 0.0411 Constraint 639 1125 5.7764 7.2205 14.4410 0.0411 Constraint 616 1343 5.6335 7.0419 14.0838 0.0411 Constraint 608 1720 4.8030 6.0037 12.0074 0.0411 Constraint 608 1703 5.5663 6.9579 13.9158 0.0411 Constraint 608 1692 4.3207 5.4009 10.8017 0.0411 Constraint 597 1343 5.9424 7.4280 14.8560 0.0411 Constraint 597 1125 5.7534 7.1917 14.3834 0.0411 Constraint 589 1317 6.2827 7.8534 15.7068 0.0411 Constraint 572 1284 4.9546 6.1932 12.3864 0.0411 Constraint 564 1317 5.5163 6.8953 13.7907 0.0411 Constraint 564 1284 4.0821 5.1026 10.2052 0.0411 Constraint 538 1284 5.4312 6.7889 13.5779 0.0411 Constraint 538 1084 3.6923 4.6154 9.2309 0.0411 Constraint 530 1260 4.4916 5.6145 11.2290 0.0411 Constraint 521 1374 4.3659 5.4573 10.9146 0.0411 Constraint 521 1351 4.9046 6.1307 12.2615 0.0411 Constraint 521 899 5.8148 7.2684 14.5369 0.0411 Constraint 521 892 5.1395 6.4244 12.8489 0.0411 Constraint 510 1374 4.4144 5.5180 11.0359 0.0411 Constraint 510 1228 5.0743 6.3429 12.6858 0.0411 Constraint 501 1260 4.8089 6.0112 12.0224 0.0411 Constraint 501 1251 6.2144 7.7680 15.5359 0.0411 Constraint 501 1228 3.0360 3.7950 7.5900 0.0411 Constraint 501 1213 4.4013 5.5017 11.0034 0.0411 Constraint 501 1084 5.0700 6.3375 12.6750 0.0411 Constraint 487 1408 3.0915 3.8644 7.7288 0.0411 Constraint 487 1382 5.8947 7.3684 14.7368 0.0411 Constraint 487 1374 4.1220 5.1524 10.3049 0.0411 Constraint 487 808 5.1081 6.3852 12.7703 0.0411 Constraint 479 1720 5.5484 6.9355 13.8710 0.0411 Constraint 479 1084 5.4673 6.8341 13.6683 0.0411 Constraint 466 1748 6.1032 7.6290 15.2580 0.0411 Constraint 457 829 6.1898 7.7372 15.4744 0.0411 Constraint 457 778 4.7347 5.9184 11.8367 0.0411 Constraint 429 884 4.4246 5.5308 11.0616 0.0411 Constraint 403 1309 6.0838 7.6047 15.2094 0.0411 Constraint 403 1046 5.7853 7.2317 14.4634 0.0411 Constraint 403 884 5.7881 7.2352 14.4703 0.0411 Constraint 392 1046 6.0888 7.6110 15.2220 0.0411 Constraint 384 892 5.3653 6.7066 13.4133 0.0411 Constraint 384 868 3.0458 3.8072 7.6145 0.0411 Constraint 375 868 6.0181 7.5226 15.0451 0.0411 Constraint 363 1046 6.2169 7.7711 15.5423 0.0411 Constraint 363 899 5.3523 6.6904 13.3809 0.0411 Constraint 314 530 3.3510 4.1888 8.3776 0.0411 Constraint 314 521 2.3873 2.9841 5.9682 0.0411 Constraint 314 510 6.0934 7.6168 15.2336 0.0411 Constraint 314 487 6.2980 7.8726 15.7451 0.0411 Constraint 306 487 6.3303 7.9129 15.8257 0.0411 Constraint 306 457 5.9649 7.4562 14.9123 0.0411 Constraint 294 521 6.2772 7.8465 15.6930 0.0411 Constraint 285 479 3.9046 4.8807 9.7614 0.0411 Constraint 263 1408 6.1024 7.6280 15.2560 0.0411 Constraint 263 1022 3.9067 4.8834 9.7668 0.0411 Constraint 256 868 4.4411 5.5514 11.1028 0.0411 Constraint 233 1022 5.9609 7.4511 14.9023 0.0411 Constraint 222 876 6.1677 7.7097 15.4193 0.0411 Constraint 216 868 3.7042 4.6302 9.2604 0.0411 Constraint 208 690 6.3569 7.9461 15.8922 0.0411 Constraint 208 639 5.9851 7.4813 14.9626 0.0411 Constraint 196 868 5.2697 6.5872 13.1743 0.0411 Constraint 189 1391 5.9569 7.4462 14.8923 0.0411 Constraint 164 980 6.2024 7.7530 15.5060 0.0411 Constraint 59 1133 6.1691 7.7114 15.4227 0.0411 Constraint 1309 1488 5.5060 6.8825 13.7649 0.0405 Constraint 1284 1466 5.0477 6.3097 12.6193 0.0405 Constraint 1220 1548 5.1965 6.4956 12.9911 0.0405 Constraint 937 1054 5.1859 6.4824 12.9647 0.0405 Constraint 868 1427 4.8901 6.1127 12.2253 0.0405 Constraint 859 1678 6.0534 7.5668 15.1336 0.0405 Constraint 859 1220 3.9539 4.9424 9.8848 0.0405 Constraint 739 1548 5.5747 6.9684 13.9369 0.0405 Constraint 616 1511 4.9924 6.2405 12.4810 0.0405 Constraint 616 1488 3.8837 4.8547 9.7093 0.0405 Constraint 616 1479 3.9749 4.9686 9.9372 0.0405 Constraint 608 1479 5.5749 6.9686 13.9372 0.0405 Constraint 589 1533 6.1833 7.7291 15.4583 0.0405 Constraint 589 1511 4.4280 5.5350 11.0699 0.0405 Constraint 944 1519 5.8584 7.3230 14.6460 0.0403 Constraint 274 1466 5.6422 7.0528 14.1056 0.0403 Constraint 249 1526 3.4134 4.2668 8.5336 0.0403 Constraint 1317 1511 4.5682 5.7102 11.4205 0.0402 Constraint 1293 1511 4.3567 5.4459 10.8918 0.0402 Constraint 706 1596 6.1928 7.7410 15.4821 0.0402 Constraint 256 690 5.3988 6.7485 13.4969 0.0402 Constraint 59 347 6.0918 7.6148 15.2296 0.0402 Constraint 1488 1756 5.7309 7.1636 14.3272 0.0400 Constraint 1488 1720 5.7842 7.2302 14.4605 0.0400 Constraint 1455 1756 3.7034 4.6292 9.2585 0.0400 Constraint 97 1100 5.8756 7.3445 14.6890 0.0400 Constraint 1084 1466 5.5237 6.9046 13.8093 0.0398 Constraint 1046 1399 6.1949 7.7436 15.4872 0.0398 Constraint 848 1649 5.2168 6.5210 13.0421 0.0398 Constraint 384 698 4.0304 5.0380 10.0759 0.0398 Constraint 375 564 4.6721 5.8402 11.6804 0.0398 Constraint 208 392 4.8939 6.1174 12.2347 0.0398 Constraint 256 608 5.7629 7.2036 14.4072 0.0396 Constraint 249 608 5.4081 6.7601 13.5201 0.0396 Constraint 1519 1739 5.3186 6.6483 13.2965 0.0395 Constraint 778 1662 5.2603 6.5754 13.1507 0.0395 Constraint 698 1603 4.7812 5.9765 11.9530 0.0395 Constraint 673 1408 4.4559 5.5698 11.1396 0.0395 Constraint 355 466 4.9866 6.2332 12.4664 0.0395 Constraint 263 457 4.8601 6.0751 12.1502 0.0395 Constraint 256 564 5.9529 7.4411 14.8822 0.0395 Constraint 11 1030 4.0632 5.0790 10.1580 0.0395 Constraint 208 589 6.2335 7.7918 15.5837 0.0393 Constraint 1220 1334 5.1973 6.4966 12.9932 0.0393 Constraint 1125 1220 4.2068 5.2585 10.5170 0.0393 Constraint 944 1670 4.7893 5.9866 11.9732 0.0393 Constraint 937 1587 4.7787 5.9733 11.9467 0.0393 Constraint 412 616 5.4940 6.8675 13.7351 0.0393 Constraint 249 1777 6.1216 7.6520 15.3039 0.0393 Constraint 208 722 4.6299 5.7874 11.5747 0.0393 Constraint 196 1068 3.5157 4.3946 8.7891 0.0393 Constraint 172 1046 5.8142 7.2678 14.5356 0.0393 Constraint 33 1059 5.4487 6.8108 13.6216 0.0393 Constraint 921 1084 4.5852 5.7315 11.4631 0.0392 Constraint 899 1382 5.3606 6.7007 13.4014 0.0392 Constraint 800 1611 4.3726 5.4657 10.9315 0.0392 Constraint 285 493 5.8602 7.3252 14.6504 0.0392 Constraint 1438 1692 5.8727 7.3409 14.6818 0.0392 Constraint 1276 1567 5.1708 6.4635 12.9270 0.0392 Constraint 1228 1455 5.3075 6.6344 13.2688 0.0392 Constraint 1228 1366 6.0708 7.5885 15.1771 0.0392 Constraint 1220 1374 5.5418 6.9273 13.8546 0.0392 Constraint 1220 1366 3.5514 4.4393 8.8786 0.0392 Constraint 1213 1374 6.3251 7.9063 15.8127 0.0392 Constraint 1204 1366 6.2202 7.7752 15.5504 0.0392 Constraint 1125 1399 5.6489 7.0611 14.1223 0.0392 Constraint 1125 1374 5.5401 6.9251 13.8502 0.0392 Constraint 1117 1399 5.1124 6.3905 12.7810 0.0392 Constraint 1117 1391 5.1779 6.4724 12.9448 0.0392 Constraint 1117 1309 4.5232 5.6540 11.3080 0.0392 Constraint 1092 1374 5.3911 6.7389 13.4778 0.0392 Constraint 1092 1284 5.7602 7.2002 14.4004 0.0392 Constraint 1084 1391 5.5757 6.9697 13.9393 0.0392 Constraint 1068 1334 4.5579 5.6973 11.3946 0.0392 Constraint 1035 1284 5.3191 6.6489 13.2978 0.0392 Constraint 1022 1167 5.8877 7.3596 14.7191 0.0392 Constraint 892 1046 3.7258 4.6572 9.3145 0.0392 Constraint 665 892 6.0866 7.6083 15.2166 0.0392 Constraint 549 722 3.1833 3.9791 7.9582 0.0392 Constraint 521 748 5.1451 6.4314 12.8628 0.0392 Constraint 487 739 3.4546 4.3182 8.6365 0.0392 Constraint 466 748 3.9034 4.8792 9.7585 0.0392 Constraint 241 479 4.5007 5.6258 11.2516 0.0392 Constraint 180 333 6.0255 7.5319 15.0638 0.0392 Constraint 154 347 5.4642 6.8302 13.6604 0.0392 Constraint 97 448 5.6062 7.0077 14.0154 0.0392 Constraint 82 164 4.5416 5.6769 11.3539 0.0392 Constraint 25 241 3.3570 4.1962 8.3925 0.0392 Constraint 18 285 5.4047 6.7559 13.5118 0.0392 Constraint 18 216 3.6090 4.5113 9.0226 0.0392 Constraint 11 241 5.7930 7.2413 14.4825 0.0392 Constraint 3 263 2.7014 3.3767 6.7534 0.0392 Constraint 3 233 6.2161 7.7701 15.5402 0.0392 Constraint 136 443 3.7771 4.7214 9.4428 0.0391 Constraint 1603 1777 6.3208 7.9010 15.8019 0.0388 Constraint 792 1670 5.4863 6.8579 13.7158 0.0388 Constraint 739 1030 4.3148 5.3934 10.7869 0.0388 Constraint 681 944 6.2239 7.7799 15.5597 0.0388 Constraint 1059 1399 6.2444 7.8055 15.6110 0.0386 Constraint 818 1068 5.7529 7.1911 14.3822 0.0386 Constraint 650 808 5.6669 7.0836 14.1672 0.0386 Constraint 623 1670 4.3140 5.3925 10.7851 0.0386 Constraint 616 1670 6.0487 7.5608 15.1217 0.0386 Constraint 608 1077 5.3978 6.7473 13.4945 0.0386 Constraint 572 731 5.2846 6.6058 13.2115 0.0386 Constraint 564 1014 5.2318 6.5398 13.0795 0.0386 Constraint 549 1479 4.5266 5.6583 11.3165 0.0386 Constraint 521 1068 6.0620 7.5775 15.1550 0.0386 Constraint 487 848 5.8953 7.3692 14.7383 0.0386 Constraint 39 1748 4.0062 5.0077 10.0154 0.0386 Constraint 39 1739 5.7796 7.2245 14.4490 0.0386 Constraint 39 1714 4.2788 5.3486 10.6971 0.0386 Constraint 756 1548 5.5622 6.9527 13.9055 0.0386 Constraint 748 1548 4.4364 5.5455 11.0910 0.0386 Constraint 1213 1301 5.9474 7.4343 14.8685 0.0386 Constraint 1167 1455 6.0313 7.5392 15.0783 0.0386 Constraint 1117 1466 5.0760 6.3450 12.6900 0.0386 Constraint 1092 1748 4.6101 5.7627 11.5253 0.0386 Constraint 630 892 5.3644 6.7056 13.4111 0.0386 Constraint 616 921 4.3756 5.4695 10.9390 0.0386 Constraint 608 1309 5.6281 7.0351 14.0703 0.0386 Constraint 597 808 3.9346 4.9183 9.8365 0.0386 Constraint 435 808 5.3785 6.7232 13.4464 0.0386 Constraint 59 980 5.5524 6.9405 13.8810 0.0386 Constraint 39 937 4.7085 5.8856 11.7712 0.0386 Constraint 913 1343 4.4050 5.5062 11.0125 0.0383 Constraint 876 1343 5.7249 7.1561 14.3123 0.0383 Constraint 876 1309 5.0842 6.3552 12.7105 0.0383 Constraint 493 1193 4.2829 5.3536 10.7073 0.0383 Constraint 363 1399 5.2281 6.5351 13.0703 0.0383 Constraint 347 1408 5.3527 6.6909 13.3817 0.0383 Constraint 33 921 5.8141 7.2676 14.5352 0.0383 Constraint 18 1022 5.1001 6.3752 12.7503 0.0383 Constraint 1309 1777 5.6447 7.0559 14.1118 0.0383 Constraint 997 1117 5.4369 6.7962 13.5923 0.0383 Constraint 997 1092 5.1401 6.4251 12.8503 0.0383 Constraint 988 1092 4.9635 6.2044 12.4088 0.0383 Constraint 314 1596 5.3968 6.7460 13.4920 0.0383 Constraint 104 549 5.5745 6.9681 13.9361 0.0383 Constraint 3 128 5.5810 6.9763 13.9526 0.0381 Constraint 222 1133 4.8081 6.0101 12.0201 0.0377 Constraint 180 1008 4.5814 5.7267 11.4535 0.0377 Constraint 145 1204 5.7163 7.1454 14.2908 0.0377 Constraint 77 1220 5.4127 6.7659 13.5317 0.0377 Constraint 39 1030 4.4118 5.5147 11.0295 0.0377 Constraint 1662 1739 4.4974 5.6218 11.2436 0.0374 Constraint 1391 1511 4.2932 5.3664 10.7329 0.0374 Constraint 1366 1511 5.1586 6.4483 12.8965 0.0374 Constraint 1204 1466 5.5282 6.9103 13.8205 0.0374 Constraint 1167 1777 5.5543 6.9428 13.8857 0.0374 Constraint 876 1670 4.3174 5.3967 10.7934 0.0374 Constraint 848 1620 5.6076 7.0095 14.0190 0.0374 Constraint 792 1141 4.5595 5.6994 11.3988 0.0374 Constraint 792 1109 5.3289 6.6611 13.3223 0.0374 Constraint 722 1503 4.6589 5.8237 11.6473 0.0374 Constraint 706 1268 6.1703 7.7128 15.4257 0.0374 Constraint 690 1556 4.9161 6.1451 12.2903 0.0374 Constraint 681 1683 5.8312 7.2891 14.5781 0.0374 Constraint 673 1293 3.9454 4.9318 9.8636 0.0374 Constraint 657 792 5.3525 6.6906 13.3812 0.0374 Constraint 623 1683 6.2683 7.8354 15.6708 0.0374 Constraint 457 639 5.6423 7.0529 14.1057 0.0374 Constraint 457 630 5.0764 6.3455 12.6910 0.0374 Constraint 285 722 4.0494 5.0618 10.1236 0.0374 Constraint 285 698 5.5561 6.9452 13.8903 0.0374 Constraint 196 944 5.5005 6.8757 13.7514 0.0374 Constraint 435 783 4.6406 5.8007 11.6014 0.0374 Constraint 227 1526 4.6565 5.8206 11.6411 0.0374 Constraint 1391 1788 5.5760 6.9700 13.9400 0.0373 Constraint 1100 1358 3.8579 4.8223 9.6447 0.0373 Constraint 868 1334 5.4406 6.8008 13.6016 0.0373 Constraint 657 955 4.7437 5.9296 11.8592 0.0373 Constraint 608 1317 4.8914 6.1143 12.2285 0.0373 Constraint 608 1213 5.8314 7.2893 14.5786 0.0373 Constraint 597 1309 5.1931 6.4914 12.9828 0.0373 Constraint 47 579 5.3888 6.7360 13.4719 0.0373 Constraint 778 1167 4.4132 5.5165 11.0330 0.0372 Constraint 690 1548 5.7022 7.1278 14.2556 0.0372 Constraint 665 1519 4.2571 5.3214 10.6427 0.0372 Constraint 639 1438 5.4892 6.8615 13.7231 0.0372 Constraint 501 1193 4.7991 5.9988 11.9976 0.0372 Constraint 493 1167 4.9860 6.2325 12.4650 0.0372 Constraint 435 899 4.9997 6.2497 12.4993 0.0372 Constraint 241 1351 5.1168 6.3960 12.7920 0.0372 Constraint 233 1479 5.3091 6.6364 13.2728 0.0372 Constraint 112 930 5.4724 6.8404 13.6809 0.0372 Constraint 930 1391 5.2432 6.5540 13.1081 0.0371 Constraint 748 1284 5.7365 7.1706 14.3412 0.0371 Constraint 306 1068 5.3368 6.6710 13.3419 0.0371 Constraint 274 1068 4.8368 6.0460 12.0920 0.0371 Constraint 222 1471 5.1681 6.4602 12.9204 0.0371 Constraint 128 1587 4.6519 5.8149 11.6297 0.0371 Constraint 97 1293 5.1416 6.4271 12.8541 0.0371 Constraint 314 630 5.1071 6.3839 12.7679 0.0369 Constraint 968 1703 4.6779 5.8474 11.6948 0.0368 Constraint 778 1511 5.4908 6.8635 13.7270 0.0368 Constraint 769 1511 5.2649 6.5811 13.1622 0.0368 Constraint 761 1268 4.6954 5.8693 11.7386 0.0368 Constraint 748 1533 5.0104 6.2630 12.5260 0.0368 Constraint 748 1511 4.0974 5.1217 10.2434 0.0368 Constraint 722 1567 6.1844 7.7305 15.4610 0.0368 Constraint 501 1158 5.1193 6.3991 12.7983 0.0368 Constraint 466 1670 5.5607 6.9509 13.9017 0.0368 Constraint 443 1703 4.3401 5.4252 10.8503 0.0368 Constraint 443 1692 5.6202 7.0252 14.0505 0.0368 Constraint 443 1670 5.9416 7.4270 14.8541 0.0368 Constraint 421 1731 5.9904 7.4880 14.9759 0.0368 Constraint 421 1720 4.7920 5.9900 11.9800 0.0368 Constraint 421 1703 6.0549 7.5687 15.1373 0.0368 Constraint 412 1720 4.4580 5.5725 11.1450 0.0368 Constraint 392 1494 5.4023 6.7529 13.5057 0.0368 Constraint 306 1494 5.7448 7.1810 14.3621 0.0368 Constraint 249 1438 5.3399 6.6748 13.3497 0.0368 Constraint 241 1408 6.1130 7.6412 15.2824 0.0368 Constraint 222 1408 6.3712 7.9640 15.9280 0.0368 Constraint 222 1399 6.0831 7.6039 15.2078 0.0368 Constraint 222 1374 4.5907 5.7383 11.4767 0.0368 Constraint 997 1596 5.2501 6.5626 13.1252 0.0367 Constraint 988 1158 5.2769 6.5961 13.1923 0.0366 Constraint 963 1133 4.7631 5.9539 11.9077 0.0366 Constraint 639 944 4.1500 5.1875 10.3750 0.0366 Constraint 1670 1772 5.2806 6.6008 13.2016 0.0364 Constraint 1519 1772 4.5736 5.7170 11.4340 0.0364 Constraint 1374 1503 3.3436 4.1795 8.3590 0.0364 Constraint 1276 1526 4.6364 5.7955 11.5911 0.0364 Constraint 1246 1526 4.8280 6.0349 12.0699 0.0364 Constraint 1141 1382 5.3487 6.6859 13.3718 0.0364 Constraint 1068 1399 5.7888 7.2360 14.4719 0.0364 Constraint 1008 1284 4.6487 5.8109 11.6219 0.0364 Constraint 899 1117 5.4587 6.8233 13.6467 0.0364 Constraint 876 1109 5.0240 6.2800 12.5601 0.0364 Constraint 859 1077 5.7579 7.1974 14.3948 0.0364 Constraint 572 761 5.2186 6.5232 13.0465 0.0364 Constraint 549 848 5.2364 6.5455 13.0911 0.0364 Constraint 429 706 5.6190 7.0238 14.0476 0.0364 Constraint 429 650 3.7303 4.6629 9.3258 0.0364 Constraint 421 681 6.3242 7.9053 15.8105 0.0364 Constraint 412 1503 5.2866 6.6083 13.2165 0.0364 Constraint 403 501 5.2726 6.5908 13.1816 0.0364 Constraint 392 681 4.7045 5.8807 11.7613 0.0364 Constraint 355 665 4.9965 6.2456 12.4913 0.0364 Constraint 249 487 4.6169 5.7711 11.5423 0.0364 Constraint 136 314 5.4403 6.8004 13.6008 0.0364 Constraint 128 299 5.6793 7.0992 14.1984 0.0364 Constraint 104 256 3.9959 4.9948 9.9896 0.0364 Constraint 82 299 5.7729 7.2162 14.4323 0.0364 Constraint 66 249 5.2212 6.5265 13.0530 0.0364 Constraint 189 1587 6.3906 7.9883 15.9765 0.0364 Constraint 859 1022 3.2317 4.0396 8.0792 0.0364 Constraint 848 1022 4.9509 6.1886 12.3772 0.0364 Constraint 808 1466 5.2143 6.5178 13.0356 0.0364 Constraint 808 1438 4.8159 6.0199 12.0399 0.0364 Constraint 233 1567 5.8681 7.3352 14.6704 0.0364 Constraint 136 501 5.2862 6.6078 13.2155 0.0364 Constraint 980 1479 5.2409 6.5511 13.1022 0.0364 Constraint 510 955 5.4709 6.8386 13.6772 0.0364 Constraint 241 1519 5.4039 6.7549 13.5099 0.0364 Constraint 222 1519 4.5109 5.6386 11.2772 0.0364 Constraint 1239 1466 4.4017 5.5021 11.0043 0.0362 Constraint 1213 1466 6.1708 7.7135 15.4271 0.0362 Constraint 937 1739 5.2862 6.6078 13.2155 0.0362 Constraint 930 1634 5.0937 6.3672 12.7343 0.0362 Constraint 706 1239 5.4370 6.7963 13.5926 0.0362 Constraint 698 1519 3.6085 4.5107 9.0213 0.0362 Constraint 690 1519 5.0098 6.2623 12.5246 0.0362 Constraint 690 1503 5.5579 6.9474 13.8947 0.0362 Constraint 681 1351 5.9653 7.4567 14.9133 0.0362 Constraint 630 1683 5.8238 7.2797 14.5595 0.0362 Constraint 589 1575 5.2940 6.6174 13.2349 0.0362 Constraint 530 1662 5.7925 7.2406 14.4813 0.0362 Constraint 530 1167 6.1405 7.6756 15.3512 0.0362 Constraint 1343 1488 3.6213 4.5266 9.0533 0.0362 Constraint 921 1077 3.8248 4.7810 9.5621 0.0362 Constraint 487 908 4.8283 6.0354 12.0708 0.0362 Constraint 392 1548 5.5932 6.9915 13.9831 0.0362 Constraint 392 1541 4.6796 5.8494 11.6989 0.0362 Constraint 347 884 4.7253 5.9066 11.8133 0.0362 Constraint 25 227 5.4345 6.7932 13.5864 0.0362 Constraint 11 1649 4.2726 5.3408 10.6816 0.0362 Constraint 1204 1703 4.1226 5.1532 10.3064 0.0361 Constraint 1068 1777 5.8794 7.3492 14.6984 0.0361 Constraint 937 1533 4.2570 5.3212 10.6424 0.0361 Constraint 274 1022 5.1433 6.4291 12.8583 0.0361 Constraint 121 1374 6.0241 7.5302 15.0603 0.0361 Constraint 77 829 5.8012 7.2515 14.5029 0.0361 Constraint 25 1603 5.9045 7.3807 14.7613 0.0361 Constraint 18 988 5.3542 6.6928 13.3856 0.0361 Constraint 1022 1777 5.0984 6.3731 12.7461 0.0356 Constraint 1014 1788 5.0028 6.2535 12.5069 0.0356 Constraint 1014 1777 4.7641 5.9551 11.9102 0.0356 Constraint 623 955 6.1986 7.7483 15.4965 0.0356 Constraint 623 930 4.3190 5.3988 10.7976 0.0356 Constraint 616 930 4.3717 5.4646 10.9293 0.0356 Constraint 589 930 5.5199 6.8999 13.7998 0.0356 Constraint 510 1777 5.0724 6.3404 12.6809 0.0356 Constraint 1068 1382 3.9369 4.9211 9.8422 0.0354 Constraint 657 1092 4.7899 5.9874 11.9748 0.0354 Constraint 1526 1603 4.9127 6.1409 12.2818 0.0354 Constraint 1488 1670 3.7244 4.6555 9.3109 0.0354 Constraint 1479 1756 5.0372 6.2966 12.5931 0.0354 Constraint 1343 1703 4.7668 5.9586 11.9171 0.0354 Constraint 1251 1603 5.5794 6.9742 13.9484 0.0354 Constraint 1251 1541 5.5974 6.9967 13.9934 0.0354 Constraint 1228 1575 3.5890 4.4863 8.9725 0.0354 Constraint 1228 1567 2.6095 3.2619 6.5237 0.0354 Constraint 1228 1533 4.0876 5.1096 10.2191 0.0354 Constraint 1220 1603 3.1971 3.9964 7.9928 0.0354 Constraint 1220 1567 5.5291 6.9114 13.8228 0.0354 Constraint 1204 1575 4.7681 5.9601 11.9203 0.0354 Constraint 1204 1358 5.9092 7.3865 14.7730 0.0354 Constraint 1204 1276 5.2657 6.5821 13.1642 0.0354 Constraint 1193 1611 3.3541 4.1926 8.3852 0.0354 Constraint 1193 1438 4.8144 6.0180 12.0359 0.0354 Constraint 1141 1391 3.9222 4.9028 9.8056 0.0354 Constraint 1109 1455 3.4997 4.3746 8.7492 0.0354 Constraint 1100 1455 6.3095 7.8869 15.7739 0.0354 Constraint 1068 1541 6.3671 7.9589 15.9178 0.0354 Constraint 1054 1526 5.8509 7.3136 14.6272 0.0354 Constraint 1046 1213 5.8215 7.2769 14.5538 0.0354 Constraint 1030 1246 4.7190 5.8987 11.7975 0.0354 Constraint 1030 1178 6.0856 7.6070 15.2141 0.0354 Constraint 1022 1649 5.1639 6.4548 12.9097 0.0354 Constraint 1022 1634 5.9784 7.4730 14.9459 0.0354 Constraint 1022 1519 6.3695 7.9619 15.9239 0.0354 Constraint 988 1703 3.5524 4.4404 8.8809 0.0354 Constraint 988 1692 5.5696 6.9620 13.9241 0.0354 Constraint 980 1494 3.4953 4.3692 8.7383 0.0354 Constraint 980 1309 4.0518 5.0647 10.1294 0.0354 Constraint 968 1358 5.5038 6.8797 13.7594 0.0354 Constraint 968 1301 5.8455 7.3069 14.6138 0.0354 Constraint 968 1276 5.2846 6.6057 13.2115 0.0354 Constraint 963 1251 5.1507 6.4383 12.8767 0.0354 Constraint 955 1343 6.1418 7.6773 15.3546 0.0354 Constraint 955 1220 4.1339 5.1674 10.3348 0.0354 Constraint 944 1455 3.6343 4.5428 9.0857 0.0354 Constraint 944 1301 2.7292 3.4115 6.8230 0.0354 Constraint 944 1220 4.8415 6.0518 12.1037 0.0354 Constraint 937 1125 6.1494 7.6867 15.3735 0.0354 Constraint 930 1683 5.3940 6.7425 13.4850 0.0354 Constraint 930 1100 6.3672 7.9590 15.9179 0.0354 Constraint 921 1662 6.1849 7.7312 15.4623 0.0354 Constraint 921 1334 3.7568 4.6960 9.3920 0.0354 Constraint 921 1092 4.1104 5.1380 10.2761 0.0354 Constraint 908 1133 3.3129 4.1412 8.2823 0.0354 Constraint 899 1739 6.2708 7.8385 15.6769 0.0354 Constraint 899 1703 5.6894 7.1118 14.2236 0.0354 Constraint 899 1683 5.2026 6.5033 13.0065 0.0354 Constraint 892 1382 5.3398 6.6748 13.3496 0.0354 Constraint 876 1022 4.7127 5.8908 11.7817 0.0354 Constraint 876 1014 5.7339 7.1674 14.3349 0.0354 Constraint 859 1149 6.1041 7.6302 15.2603 0.0354 Constraint 859 1133 3.0748 3.8435 7.6869 0.0354 Constraint 848 1343 3.0540 3.8175 7.6350 0.0354 Constraint 848 1158 5.3971 6.7464 13.4928 0.0354 Constraint 848 1149 5.5454 6.9317 13.8635 0.0354 Constraint 848 1141 3.0702 3.8378 7.6755 0.0354 Constraint 836 1788 5.8353 7.2941 14.5882 0.0354 Constraint 836 1309 4.1428 5.1785 10.3569 0.0354 Constraint 829 1358 5.6060 7.0075 14.0150 0.0354 Constraint 829 1343 3.2891 4.1114 8.2228 0.0354 Constraint 829 1334 6.0426 7.5532 15.1065 0.0354 Constraint 829 1309 4.8254 6.0318 12.0636 0.0354 Constraint 818 1382 5.9891 7.4864 14.9728 0.0354 Constraint 808 1634 4.6345 5.7931 11.5862 0.0354 Constraint 808 1309 5.4389 6.7986 13.5972 0.0354 Constraint 808 1276 6.2900 7.8625 15.7251 0.0354 Constraint 783 1301 4.9861 6.2327 12.4653 0.0354 Constraint 783 930 5.6387 7.0483 14.0967 0.0354 Constraint 783 899 4.9499 6.1874 12.3749 0.0354 Constraint 778 1657 5.9666 7.4582 14.9165 0.0354 Constraint 778 1526 5.3226 6.6533 13.3066 0.0354 Constraint 761 1683 6.3567 7.9459 15.8918 0.0354 Constraint 761 1657 5.6363 7.0454 14.0907 0.0354 Constraint 756 1683 4.8274 6.0343 12.0685 0.0354 Constraint 756 1657 5.4882 6.8602 13.7204 0.0354 Constraint 756 1471 4.6996 5.8745 11.7490 0.0354 Constraint 756 1399 6.1083 7.6353 15.2706 0.0354 Constraint 748 1519 4.7406 5.9258 11.8516 0.0354 Constraint 748 1447 5.4608 6.8260 13.6520 0.0354 Constraint 731 1714 6.2961 7.8701 15.7401 0.0354 Constraint 731 1683 6.0271 7.5339 15.0678 0.0354 Constraint 731 1494 5.8508 7.3135 14.6271 0.0354 Constraint 731 1358 5.1441 6.4301 12.8602 0.0354 Constraint 731 1351 4.8445 6.0556 12.1112 0.0354 Constraint 722 1739 5.8763 7.3454 14.6909 0.0354 Constraint 722 1556 4.4125 5.5157 11.0313 0.0354 Constraint 713 1764 4.5375 5.6719 11.3437 0.0354 Constraint 706 1382 5.5705 6.9631 13.9263 0.0354 Constraint 698 1739 4.5985 5.7482 11.4963 0.0354 Constraint 690 1343 4.7471 5.9339 11.8678 0.0354 Constraint 673 1541 6.1137 7.6421 15.2843 0.0354 Constraint 673 1260 4.7007 5.8758 11.7516 0.0354 Constraint 665 1479 5.8663 7.3329 14.6658 0.0354 Constraint 650 1374 4.1414 5.1768 10.3536 0.0354 Constraint 650 1366 3.4696 4.3370 8.6740 0.0354 Constraint 650 1284 5.8496 7.3120 14.6240 0.0354 Constraint 650 1251 3.4358 4.2947 8.5894 0.0354 Constraint 639 1479 4.6326 5.7908 11.5816 0.0354 Constraint 639 1391 5.1009 6.3762 12.7524 0.0354 Constraint 639 1374 5.8153 7.2691 14.5383 0.0354 Constraint 639 1366 6.0861 7.6077 15.2154 0.0354 Constraint 630 1399 6.0983 7.6229 15.2457 0.0354 Constraint 630 1374 4.6727 5.8409 11.6818 0.0354 Constraint 623 1427 5.6549 7.0687 14.1374 0.0354 Constraint 616 1391 5.0628 6.3285 12.6570 0.0354 Constraint 597 1366 4.8936 6.1169 12.2339 0.0354 Constraint 589 1366 2.2907 2.8634 5.7269 0.0354 Constraint 589 1343 5.5072 6.8841 13.7681 0.0354 Constraint 579 1374 4.1420 5.1775 10.3551 0.0354 Constraint 579 818 5.8473 7.3091 14.6182 0.0354 Constraint 572 1374 3.4249 4.2812 8.5623 0.0354 Constraint 572 1366 5.1372 6.4216 12.8431 0.0354 Constraint 572 1343 5.9673 7.4591 14.9182 0.0354 Constraint 572 921 5.3398 6.6748 13.3496 0.0354 Constraint 557 1343 4.9468 6.1834 12.3669 0.0354 Constraint 549 1343 2.2907 2.8634 5.7269 0.0354 Constraint 549 1268 5.5770 6.9712 13.9425 0.0354 Constraint 549 944 5.8460 7.3074 14.6149 0.0354 Constraint 538 1343 4.7479 5.9349 11.8698 0.0354 Constraint 493 1035 4.0679 5.0849 10.1698 0.0354 Constraint 493 616 4.8282 6.0352 12.0704 0.0354 Constraint 487 608 4.2902 5.3627 10.7254 0.0354 Constraint 466 1054 6.1823 7.7279 15.4558 0.0354 Constraint 466 1008 6.0821 7.6026 15.2053 0.0354 Constraint 457 1035 4.6154 5.7693 11.5385 0.0354 Constraint 457 1014 6.3997 7.9996 15.9991 0.0354 Constraint 443 1059 6.1466 7.6833 15.3665 0.0354 Constraint 412 968 4.7352 5.9191 11.8381 0.0354 Constraint 412 761 5.1780 6.4725 12.9450 0.0354 Constraint 412 639 5.5359 6.9199 13.8398 0.0354 Constraint 403 1391 6.3317 7.9147 15.8293 0.0354 Constraint 403 997 5.7786 7.2232 14.4465 0.0354 Constraint 403 968 4.1325 5.1657 10.3313 0.0354 Constraint 403 630 5.1526 6.4407 12.8814 0.0354 Constraint 392 1416 5.8362 7.2953 14.5906 0.0354 Constraint 392 1391 6.3019 7.8774 15.7548 0.0354 Constraint 392 1382 6.0057 7.5071 15.0143 0.0354 Constraint 392 1358 5.8907 7.3634 14.7268 0.0354 Constraint 392 944 5.7895 7.2369 14.4738 0.0354 Constraint 384 1133 4.6032 5.7540 11.5081 0.0354 Constraint 384 1117 6.3574 7.9467 15.8935 0.0354 Constraint 384 761 5.7652 7.2065 14.4129 0.0354 Constraint 384 623 4.2666 5.3333 10.6666 0.0354 Constraint 375 859 4.9900 6.2374 12.4749 0.0354 Constraint 375 792 6.2604 7.8254 15.6509 0.0354 Constraint 375 713 6.2616 7.8270 15.6540 0.0354 Constraint 375 665 2.6902 3.3627 6.7254 0.0354 Constraint 375 639 4.4652 5.5815 11.1630 0.0354 Constraint 368 1416 4.6467 5.8084 11.6167 0.0354 Constraint 368 623 3.9028 4.8785 9.7570 0.0354 Constraint 363 623 5.3910 6.7387 13.4774 0.0354 Constraint 355 1133 6.2410 7.8013 15.6026 0.0354 Constraint 355 713 6.2599 7.8248 15.6497 0.0354 Constraint 355 650 4.9727 6.2159 12.4318 0.0354 Constraint 355 639 3.2038 4.0048 8.0096 0.0354 Constraint 355 630 4.8070 6.0087 12.0174 0.0354 Constraint 347 623 5.3202 6.6503 13.3006 0.0354 Constraint 333 429 4.9473 6.1842 12.3684 0.0354 Constraint 325 493 4.4718 5.5897 11.1794 0.0354 Constraint 306 616 4.7335 5.9168 11.8336 0.0354 Constraint 306 608 5.4724 6.8405 13.6810 0.0354 Constraint 299 731 6.1894 7.7368 15.4735 0.0354 Constraint 294 848 3.0702 3.8378 7.6756 0.0354 Constraint 294 639 4.6793 5.8491 11.6982 0.0354 Constraint 294 623 5.3910 6.7387 13.4774 0.0354 Constraint 285 1213 5.3783 6.7228 13.4456 0.0354 Constraint 285 1204 4.0726 5.0907 10.1814 0.0354 Constraint 285 650 5.1284 6.4105 12.8210 0.0354 Constraint 285 639 3.4417 4.3021 8.6043 0.0354 Constraint 263 623 4.0699 5.0874 10.1747 0.0354 Constraint 256 1246 5.4942 6.8678 13.7356 0.0354 Constraint 256 1204 5.4931 6.8664 13.7328 0.0354 Constraint 256 892 6.0093 7.5116 15.0232 0.0354 Constraint 249 1204 5.8188 7.2735 14.5470 0.0354 Constraint 241 868 5.6353 7.0442 14.0883 0.0354 Constraint 227 1246 4.1470 5.1838 10.3676 0.0354 Constraint 227 1228 5.7162 7.1452 14.2904 0.0354 Constraint 222 731 5.9330 7.4163 14.8325 0.0354 Constraint 222 681 5.9515 7.4394 14.8788 0.0354 Constraint 196 1351 5.5111 6.8889 13.7777 0.0354 Constraint 180 800 5.7831 7.2289 14.4578 0.0354 Constraint 180 778 5.8602 7.3253 14.6505 0.0354 Constraint 172 650 5.6830 7.1037 14.2074 0.0354 Constraint 164 1301 4.8047 6.0059 12.0119 0.0354 Constraint 164 1268 5.5529 6.9412 13.8823 0.0354 Constraint 164 650 6.0123 7.5154 15.0308 0.0354 Constraint 154 778 5.3299 6.6624 13.3248 0.0354 Constraint 145 1438 2.2499 2.8123 5.6246 0.0354 Constraint 145 1408 5.4661 6.8327 13.6653 0.0354 Constraint 145 1374 4.7114 5.8892 11.7785 0.0354 Constraint 145 639 4.6654 5.8318 11.6636 0.0354 Constraint 136 1438 4.7649 5.9561 11.9122 0.0354 Constraint 136 1301 5.9411 7.4263 14.8527 0.0354 Constraint 128 1325 6.0052 7.5065 15.0129 0.0354 Constraint 104 1479 4.6812 5.8515 11.7029 0.0354 Constraint 104 1382 4.6521 5.8151 11.6303 0.0354 Constraint 104 616 5.1908 6.4885 12.9770 0.0354 Constraint 82 564 5.6123 7.0154 14.0309 0.0354 Constraint 77 487 5.1727 6.4658 12.9317 0.0354 Constraint 66 403 3.8305 4.7882 9.5764 0.0354 Constraint 59 403 5.7222 7.1527 14.3055 0.0354 Constraint 59 392 6.3576 7.9470 15.8940 0.0354 Constraint 47 930 5.0578 6.3222 12.6445 0.0354 Constraint 47 913 5.7796 7.2245 14.4490 0.0354 Constraint 47 908 6.0507 7.5634 15.1268 0.0354 Constraint 47 800 4.6358 5.7948 11.5896 0.0354 Constraint 47 403 5.8988 7.3735 14.7470 0.0354 Constraint 39 479 5.6460 7.0575 14.1150 0.0354 Constraint 39 412 5.9124 7.3905 14.7810 0.0354 Constraint 39 403 3.6904 4.6130 9.2261 0.0354 Constraint 33 908 4.9620 6.2026 12.4051 0.0354 Constraint 33 448 6.1067 7.6333 15.2667 0.0354 Constraint 33 443 3.9180 4.8976 9.7951 0.0354 Constraint 25 818 5.7430 7.1787 14.3574 0.0354 Constraint 25 792 3.5069 4.3836 8.7673 0.0354 Constraint 25 487 6.3345 7.9181 15.8362 0.0354 Constraint 25 479 5.8202 7.2753 14.5505 0.0354 Constraint 18 479 3.6671 4.5838 9.1677 0.0354 Constraint 1374 1519 3.7720 4.7150 9.4300 0.0352 Constraint 1246 1466 4.6765 5.8457 11.6913 0.0352 Constraint 1193 1466 6.0612 7.5765 15.1530 0.0352 Constraint 1193 1427 5.3373 6.6716 13.3432 0.0352 Constraint 1117 1334 4.9437 6.1796 12.3592 0.0352 Constraint 1092 1309 5.3504 6.6880 13.3760 0.0352 Constraint 1014 1178 5.4332 6.7914 13.5829 0.0352 Constraint 968 1084 3.7438 4.6798 9.3595 0.0352 Constraint 913 1008 5.6031 7.0039 14.0078 0.0352 Constraint 706 1366 5.0073 6.2591 12.5182 0.0352 Constraint 698 1366 3.3888 4.2360 8.4720 0.0352 Constraint 673 1391 4.7857 5.9822 11.9644 0.0352 Constraint 97 457 3.6067 4.5084 9.0167 0.0352 Constraint 1077 1788 5.1242 6.4052 12.8105 0.0350 Constraint 968 1714 5.7987 7.2484 14.4968 0.0350 Constraint 937 1556 4.8931 6.1164 12.2328 0.0350 Constraint 930 1479 5.0534 6.3168 12.6336 0.0350 Constraint 739 1268 5.9290 7.4113 14.8225 0.0350 Constraint 713 1158 3.8964 4.8706 9.7411 0.0350 Constraint 530 1620 4.4153 5.5191 11.0383 0.0350 Constraint 479 1649 5.1107 6.3884 12.7767 0.0350 Constraint 429 1228 5.2116 6.5145 13.0290 0.0350 Constraint 233 1471 5.7948 7.2436 14.4871 0.0350 Constraint 222 930 5.3519 6.6899 13.3798 0.0350 Constraint 196 955 5.8220 7.2775 14.5550 0.0350 Constraint 154 1408 4.4587 5.5734 11.1468 0.0350 Constraint 937 1167 6.2523 7.8153 15.6307 0.0347 Constraint 913 1125 5.8503 7.3129 14.6258 0.0347 Constraint 748 955 5.7502 7.1877 14.3754 0.0347 Constraint 18 227 3.4912 4.3640 8.7280 0.0347 Constraint 18 180 6.2925 7.8656 15.7312 0.0347 Constraint 1284 1541 5.0090 6.2613 12.5226 0.0345 Constraint 1059 1494 3.4441 4.3052 8.6104 0.0345 Constraint 997 1777 5.7279 7.1598 14.3197 0.0345 Constraint 792 1092 5.8896 7.3619 14.7239 0.0345 Constraint 769 1092 4.8870 6.1088 12.2175 0.0345 Constraint 706 1358 6.1726 7.7158 15.4316 0.0345 Constraint 673 1239 5.9795 7.4744 14.9489 0.0345 Constraint 510 1692 5.0221 6.2776 12.5553 0.0345 Constraint 501 1703 4.5825 5.7281 11.4561 0.0345 Constraint 501 1692 4.2015 5.2518 10.5037 0.0345 Constraint 466 549 5.7556 7.1945 14.3890 0.0345 Constraint 384 457 5.6030 7.0037 14.0074 0.0345 Constraint 189 1488 4.5329 5.6661 11.3322 0.0345 Constraint 145 501 5.9588 7.4485 14.8970 0.0345 Constraint 91 333 6.0800 7.6000 15.2000 0.0345 Constraint 66 429 5.5392 6.9241 13.8481 0.0345 Constraint 756 1596 6.1334 7.6667 15.3334 0.0344 Constraint 650 1567 6.0501 7.5626 15.1252 0.0344 Constraint 650 859 5.2524 6.5655 13.1310 0.0344 Constraint 630 1567 5.8180 7.2725 14.5450 0.0344 Constraint 597 1596 6.1309 7.6636 15.3272 0.0344 Constraint 549 1657 5.6352 7.0440 14.0880 0.0344 Constraint 355 530 4.7867 5.9834 11.9668 0.0344 Constraint 347 521 5.2466 6.5583 13.1166 0.0344 Constraint 294 530 4.7539 5.9424 11.8847 0.0344 Constraint 227 1714 3.8662 4.8328 9.6655 0.0344 Constraint 222 1739 5.0341 6.2927 12.5853 0.0344 Constraint 216 1714 5.1007 6.3759 12.7518 0.0344 Constraint 196 1714 4.1833 5.2291 10.4582 0.0344 Constraint 136 616 5.4645 6.8307 13.6613 0.0344 Constraint 1204 1657 4.9381 6.1727 12.3453 0.0343 Constraint 1204 1611 5.1864 6.4830 12.9661 0.0343 Constraint 1100 1777 4.8945 6.1181 12.2362 0.0343 Constraint 988 1678 5.2099 6.5124 13.0248 0.0343 Constraint 963 1678 4.8412 6.0516 12.1031 0.0343 Constraint 963 1649 4.7368 5.9210 11.8419 0.0343 Constraint 930 1620 6.0192 7.5240 15.0480 0.0343 Constraint 665 1204 5.5232 6.9040 13.8079 0.0343 Constraint 665 1092 5.4808 6.8510 13.7020 0.0343 Constraint 623 1678 5.7408 7.1759 14.3519 0.0343 Constraint 589 1030 6.0859 7.6074 15.2147 0.0343 Constraint 557 1054 5.0434 6.3042 12.6084 0.0343 Constraint 521 848 5.2844 6.6055 13.2110 0.0343 Constraint 403 829 4.6480 5.8100 11.6200 0.0343 Constraint 285 713 5.1813 6.4766 12.9532 0.0343 Constraint 722 1416 5.2929 6.6162 13.2323 0.0341 Constraint 448 616 6.1581 7.6976 15.3952 0.0341 Constraint 403 1649 5.8418 7.3023 14.6045 0.0341 Constraint 196 457 4.5779 5.7224 11.4449 0.0341 Constraint 136 589 5.9517 7.4397 14.8793 0.0341 Constraint 104 623 4.9578 6.1972 12.3945 0.0341 Constraint 82 172 4.6365 5.7956 11.5912 0.0341 Constraint 698 876 3.8983 4.8728 9.7457 0.0340 Constraint 557 1416 5.5208 6.9009 13.8019 0.0340 Constraint 222 384 5.0975 6.3719 12.7438 0.0340 Constraint 196 739 5.2040 6.5050 13.0099 0.0340 Constraint 1503 1772 5.5012 6.8765 13.7531 0.0337 Constraint 1479 1772 3.3763 4.2204 8.4408 0.0337 Constraint 1427 1587 5.9769 7.4711 14.9423 0.0337 Constraint 1391 1587 4.2874 5.3592 10.7184 0.0337 Constraint 1351 1427 6.1199 7.6498 15.2997 0.0337 Constraint 1343 1764 5.3802 6.7252 13.4504 0.0337 Constraint 1213 1511 5.9264 7.4080 14.8161 0.0337 Constraint 1158 1692 5.6031 7.0039 14.0078 0.0337 Constraint 1158 1511 4.3668 5.4585 10.9170 0.0337 Constraint 1141 1748 5.3767 6.7209 13.4418 0.0337 Constraint 1133 1620 4.6901 5.8626 11.7253 0.0337 Constraint 1125 1620 4.8692 6.0865 12.1730 0.0337 Constraint 1125 1438 4.8193 6.0241 12.0482 0.0337 Constraint 1100 1634 3.7081 4.6352 9.2704 0.0337 Constraint 1100 1603 6.3077 7.8847 15.7694 0.0337 Constraint 1100 1587 3.0765 3.8456 7.6912 0.0337 Constraint 1100 1575 4.5625 5.7031 11.4062 0.0337 Constraint 1092 1587 5.9849 7.4811 14.9623 0.0337 Constraint 1046 1204 4.1883 5.2353 10.4707 0.0337 Constraint 1008 1125 3.9184 4.8980 9.7960 0.0337 Constraint 921 1204 4.6258 5.7823 11.5646 0.0337 Constraint 892 1220 4.7905 5.9882 11.9764 0.0337 Constraint 876 1100 3.8793 4.8491 9.6982 0.0337 Constraint 783 876 4.3977 5.4971 10.9943 0.0337 Constraint 769 930 4.8399 6.0499 12.0997 0.0337 Constraint 769 908 3.8664 4.8330 9.6661 0.0337 Constraint 769 899 4.5360 5.6700 11.3400 0.0337 Constraint 739 899 3.5923 4.4904 8.9809 0.0337 Constraint 739 892 3.1178 3.8973 7.7946 0.0337 Constraint 739 868 4.1288 5.1610 10.3219 0.0337 Constraint 690 1068 6.3894 7.9867 15.9735 0.0337 Constraint 681 1077 5.8525 7.3156 14.6312 0.0337 Constraint 681 1068 2.5469 3.1837 6.3673 0.0337 Constraint 681 955 5.3233 6.6542 13.3083 0.0337 Constraint 673 1068 4.3821 5.4776 10.9553 0.0337 Constraint 657 1046 6.0380 7.5475 15.0950 0.0337 Constraint 639 1030 3.9581 4.9476 9.8953 0.0337 Constraint 630 1494 6.3288 7.9110 15.8220 0.0337 Constraint 630 1054 3.5783 4.4729 8.9458 0.0337 Constraint 616 988 4.1876 5.2345 10.4690 0.0337 Constraint 579 783 4.1978 5.2472 10.4945 0.0337 Constraint 564 761 5.8886 7.3608 14.7216 0.0337 Constraint 557 761 4.4734 5.5918 11.1835 0.0337 Constraint 549 761 4.8046 6.0057 12.0115 0.0337 Constraint 493 1548 5.6557 7.0697 14.1393 0.0337 Constraint 443 739 6.1499 7.6874 15.3747 0.0337 Constraint 443 706 5.0330 6.2912 12.5825 0.0337 Constraint 421 739 4.8593 6.0742 12.1483 0.0337 Constraint 392 706 4.5131 5.6414 11.2828 0.0337 Constraint 375 521 4.9660 6.2075 12.4149 0.0337 Constraint 363 549 5.9795 7.4744 14.9487 0.0337 Constraint 294 706 5.0618 6.3272 12.6545 0.0337 Constraint 241 630 3.9809 4.9761 9.9522 0.0337 Constraint 241 623 4.9662 6.2078 12.4155 0.0337 Constraint 233 572 6.1513 7.6891 15.3783 0.0337 Constraint 227 868 5.0382 6.2978 12.5956 0.0337 Constraint 227 859 5.6758 7.0947 14.1895 0.0337 Constraint 227 829 4.6933 5.8666 11.7331 0.0337 Constraint 227 818 4.0168 5.0210 10.0420 0.0337 Constraint 227 657 5.6132 7.0164 14.0329 0.0337 Constraint 227 639 4.8450 6.0562 12.1124 0.0337 Constraint 222 616 4.3864 5.4830 10.9660 0.0337 Constraint 208 333 5.4811 6.8514 13.7029 0.0337 Constraint 164 673 5.5723 6.9653 13.9307 0.0337 Constraint 145 630 4.0746 5.0933 10.1865 0.0337 Constraint 145 597 4.8363 6.0454 12.0909 0.0337 Constraint 136 392 4.8585 6.0731 12.1461 0.0337 Constraint 136 368 3.6454 4.5567 9.1134 0.0337 Constraint 128 673 5.3942 6.7428 13.4856 0.0337 Constraint 121 549 3.7736 4.7171 9.4341 0.0337 Constraint 121 538 5.5827 6.9784 13.9569 0.0337 Constraint 121 363 6.1246 7.6558 15.3115 0.0337 Constraint 121 347 5.3825 6.7281 13.4561 0.0337 Constraint 121 333 4.7164 5.8954 11.7909 0.0337 Constraint 121 299 5.7674 7.2092 14.4184 0.0337 Constraint 112 530 6.0516 7.5645 15.1290 0.0337 Constraint 112 263 4.0646 5.0808 10.1615 0.0337 Constraint 91 913 5.9802 7.4753 14.9506 0.0337 Constraint 82 884 5.9707 7.4634 14.9269 0.0337 Constraint 82 294 5.8779 7.3473 14.6947 0.0337 Constraint 82 285 5.7079 7.1349 14.2698 0.0337 Constraint 77 1533 4.8581 6.0726 12.1453 0.0337 Constraint 77 1246 4.9735 6.2169 12.4337 0.0337 Constraint 77 285 5.5242 6.9053 13.8106 0.0337 Constraint 66 294 4.5567 5.6959 11.3918 0.0337 Constraint 59 294 5.4912 6.8640 13.7280 0.0337 Constraint 59 263 4.6408 5.8010 11.6021 0.0337 Constraint 11 681 4.8694 6.0868 12.1736 0.0337 Constraint 3 722 5.9894 7.4868 14.9736 0.0337 Constraint 3 713 6.0642 7.5803 15.1606 0.0337 Constraint 1014 1416 4.5263 5.6579 11.3158 0.0336 Constraint 1014 1391 5.2006 6.5008 13.0015 0.0336 Constraint 557 1260 4.6296 5.7869 11.5739 0.0336 Constraint 557 1239 6.3048 7.8810 15.7620 0.0336 Constraint 521 1293 6.3858 7.9823 15.9646 0.0336 Constraint 521 1284 5.8407 7.3008 14.6016 0.0336 Constraint 493 1317 5.8818 7.3523 14.7046 0.0336 Constraint 493 1293 5.6251 7.0313 14.0627 0.0336 Constraint 384 1634 3.3083 4.1354 8.2708 0.0336 Constraint 375 1634 5.6004 7.0005 14.0010 0.0336 Constraint 363 1575 4.3932 5.4915 10.9830 0.0336 Constraint 355 1587 4.4482 5.5603 11.1206 0.0336 Constraint 355 1575 2.9132 3.6414 7.2829 0.0336 Constraint 355 1567 6.0729 7.5912 15.1823 0.0336 Constraint 333 1634 6.2042 7.7553 15.5105 0.0336 Constraint 333 1575 3.9831 4.9789 9.9579 0.0336 Constraint 333 1541 5.9601 7.4501 14.9002 0.0336 Constraint 241 403 6.0044 7.5055 15.0110 0.0336 Constraint 216 1054 5.1762 6.4703 12.9405 0.0336 Constraint 196 884 5.4651 6.8314 13.6628 0.0336 Constraint 180 1077 5.0283 6.2854 12.5708 0.0336 Constraint 180 1054 5.5475 6.9344 13.8689 0.0336 Constraint 172 892 4.0843 5.1053 10.2107 0.0336 Constraint 172 884 5.4442 6.8053 13.6105 0.0336 Constraint 164 884 6.2846 7.8557 15.7115 0.0336 Constraint 164 868 4.8226 6.0282 12.0564 0.0336 Constraint 136 876 4.7367 5.9208 11.8416 0.0336 Constraint 121 1109 4.4631 5.5788 11.1577 0.0336 Constraint 1603 1748 6.0542 7.5677 15.1355 0.0335 Constraint 1511 1739 4.8930 6.1162 12.2324 0.0335 Constraint 1471 1739 4.9559 6.1948 12.3897 0.0335 Constraint 1351 1494 5.2619 6.5774 13.1547 0.0335 Constraint 1193 1455 5.6806 7.1007 14.2015 0.0335 Constraint 921 1158 4.7339 5.9174 11.8347 0.0335 Constraint 892 1077 5.0003 6.2504 12.5008 0.0335 Constraint 706 1391 3.9298 4.9123 9.8245 0.0335 Constraint 579 1416 5.7332 7.1666 14.3331 0.0335 Constraint 579 884 5.5509 6.9387 13.8773 0.0335 Constraint 549 1416 4.6702 5.8377 11.6754 0.0335 Constraint 457 756 5.0163 6.2703 12.5407 0.0335 Constraint 314 681 5.9993 7.4991 14.9983 0.0335 Constraint 285 579 5.4685 6.8356 13.6713 0.0335 Constraint 18 233 3.9249 4.9062 9.8123 0.0335 Constraint 1657 1772 5.8057 7.2572 14.5143 0.0334 Constraint 1358 1533 5.2345 6.5431 13.0863 0.0334 Constraint 1358 1519 5.6147 7.0184 14.0367 0.0334 Constraint 1149 1611 4.0974 5.1217 10.2434 0.0334 Constraint 1133 1351 4.9940 6.2425 12.4849 0.0334 Constraint 818 1455 4.2966 5.3708 10.7416 0.0334 Constraint 690 1587 6.0035 7.5044 15.0088 0.0334 Constraint 690 1541 5.5453 6.9316 13.8632 0.0334 Constraint 673 1548 5.3565 6.6956 13.3912 0.0334 Constraint 673 1526 5.2104 6.5130 13.0261 0.0334 Constraint 650 1100 5.9140 7.3925 14.7850 0.0334 Constraint 639 1046 4.3989 5.4987 10.9973 0.0334 Constraint 154 955 4.3368 5.4210 10.8419 0.0334 Constraint 112 375 4.5737 5.7171 11.4342 0.0334 Constraint 112 314 5.6297 7.0371 14.0742 0.0334 Constraint 104 1213 3.7262 4.6577 9.3154 0.0334 Constraint 104 988 4.0686 5.0857 10.1714 0.0334 Constraint 97 988 3.9523 4.9404 9.8809 0.0334 Constraint 97 955 3.9187 4.8984 9.7967 0.0334 Constraint 97 930 5.0276 6.2845 12.5691 0.0334 Constraint 91 899 5.6218 7.0273 14.0546 0.0334 Constraint 91 375 5.1884 6.4855 12.9711 0.0334 Constraint 82 355 4.1796 5.2245 10.4491 0.0334 Constraint 11 955 5.1790 6.4737 12.9475 0.0334 Constraint 1596 1683 3.8589 4.8237 9.6473 0.0333 Constraint 1548 1772 4.7950 5.9938 11.9876 0.0333 Constraint 1399 1662 4.4038 5.5048 11.0096 0.0333 Constraint 1239 1488 6.1210 7.6512 15.3024 0.0333 Constraint 1100 1374 4.6180 5.7726 11.5451 0.0333 Constraint 136 325 4.6956 5.8695 11.7391 0.0333 Constraint 97 256 5.6783 7.0978 14.1957 0.0333 Constraint 487 955 5.0783 6.3478 12.6957 0.0332 Constraint 1358 1772 4.3025 5.3781 10.7563 0.0332 Constraint 1358 1471 4.3131 5.3913 10.7827 0.0332 Constraint 1158 1703 5.7484 7.1856 14.3711 0.0332 Constraint 1149 1503 4.7280 5.9100 11.8200 0.0332 Constraint 1133 1670 6.0591 7.5738 15.1476 0.0332 Constraint 1100 1670 4.9876 6.2345 12.4690 0.0332 Constraint 1100 1611 5.6557 7.0696 14.1392 0.0332 Constraint 1092 1611 5.7739 7.2173 14.4347 0.0332 Constraint 1092 1596 5.8992 7.3740 14.7479 0.0332 Constraint 1084 1526 2.7304 3.4130 6.8261 0.0332 Constraint 988 1167 5.3653 6.7066 13.4132 0.0332 Constraint 988 1149 4.9531 6.1914 12.3828 0.0332 Constraint 913 1427 5.1508 6.4385 12.8770 0.0332 Constraint 908 1399 5.6603 7.0754 14.1508 0.0332 Constraint 769 868 6.1115 7.6393 15.2787 0.0332 Constraint 761 1193 4.5666 5.7083 11.4165 0.0332 Constraint 761 1167 6.3598 7.9497 15.8994 0.0332 Constraint 748 1731 4.0729 5.0912 10.1823 0.0332 Constraint 713 1731 6.0025 7.5031 15.0062 0.0332 Constraint 639 1447 5.4832 6.8540 13.7079 0.0332 Constraint 639 1251 5.6407 7.0509 14.1018 0.0332 Constraint 630 1251 6.0430 7.5537 15.1074 0.0332 Constraint 623 1251 6.3942 7.9927 15.9854 0.0332 Constraint 623 1239 6.3326 7.9157 15.8315 0.0332 Constraint 623 1213 5.7591 7.1988 14.3976 0.0332 Constraint 572 1251 5.0046 6.2558 12.5116 0.0332 Constraint 572 1246 3.6025 4.5032 9.0064 0.0332 Constraint 557 1246 5.4329 6.7911 13.5822 0.0332 Constraint 549 739 6.3934 7.9917 15.9835 0.0332 Constraint 530 1213 4.6701 5.8376 11.6752 0.0332 Constraint 521 1213 5.2130 6.5162 13.0325 0.0332 Constraint 493 1178 5.2220 6.5275 13.0549 0.0332 Constraint 487 1731 6.1611 7.7014 15.4029 0.0332 Constraint 487 1178 5.8558 7.3198 14.6396 0.0332 Constraint 487 1158 3.9977 4.9971 9.9941 0.0332 Constraint 479 1022 6.2170 7.7712 15.5424 0.0332 Constraint 466 1731 6.1231 7.6538 15.3076 0.0332 Constraint 466 1503 6.0695 7.5869 15.1737 0.0332 Constraint 466 836 3.7388 4.6734 9.3469 0.0332 Constraint 457 1756 6.0295 7.5369 15.0737 0.0332 Constraint 457 1731 4.2106 5.2632 10.5264 0.0332 Constraint 457 1703 5.8017 7.2521 14.5042 0.0332 Constraint 443 836 5.8531 7.3163 14.6327 0.0332 Constraint 435 1731 5.9633 7.4542 14.9083 0.0332 Constraint 435 1703 3.8618 4.8273 9.6546 0.0332 Constraint 435 1678 4.8640 6.0800 12.1599 0.0332 Constraint 435 1670 6.0740 7.5926 15.1851 0.0332 Constraint 435 673 5.1974 6.4967 12.9934 0.0332 Constraint 429 1479 3.9955 4.9944 9.9888 0.0332 Constraint 429 1447 6.3371 7.9214 15.8428 0.0332 Constraint 421 1503 4.0479 5.0599 10.1198 0.0332 Constraint 421 1479 4.0263 5.0329 10.0658 0.0332 Constraint 412 1678 5.2129 6.5161 13.0321 0.0332 Constraint 412 1670 5.6264 7.0330 14.0660 0.0332 Constraint 412 1649 4.6550 5.8187 11.6374 0.0332 Constraint 403 1678 6.3494 7.9367 15.8734 0.0332 Constraint 403 1634 4.3386 5.4232 10.8464 0.0332 Constraint 392 650 4.1950 5.2437 10.4875 0.0332 Constraint 384 650 5.8678 7.3348 14.6695 0.0332 Constraint 375 1488 4.5681 5.7102 11.4203 0.0332 Constraint 363 1541 6.1410 7.6762 15.3525 0.0332 Constraint 363 1533 4.5724 5.7155 11.4310 0.0332 Constraint 285 731 6.2905 7.8631 15.7263 0.0332 Constraint 274 1511 4.6898 5.8622 11.7245 0.0332 Constraint 274 1503 6.2444 7.8055 15.6110 0.0332 Constraint 274 1479 5.7325 7.1656 14.3313 0.0332 Constraint 263 1575 6.2698 7.8372 15.6745 0.0332 Constraint 256 392 6.1141 7.6426 15.2853 0.0332 Constraint 241 1575 6.1344 7.6681 15.3361 0.0332 Constraint 241 1541 3.8286 4.7858 9.5716 0.0332 Constraint 241 1511 4.3255 5.4069 10.8138 0.0332 Constraint 233 1603 6.0262 7.5327 15.0655 0.0332 Constraint 222 1511 6.2516 7.8145 15.6291 0.0332 Constraint 216 1541 3.9605 4.9506 9.9012 0.0332 Constraint 196 1649 4.3817 5.4771 10.9541 0.0332 Constraint 180 848 5.6034 7.0042 14.0084 0.0332 Constraint 154 1649 4.6000 5.7500 11.5000 0.0332 Constraint 154 1620 4.8926 6.1157 12.2315 0.0332 Constraint 154 739 5.1826 6.4782 12.9564 0.0332 Constraint 145 1657 5.0619 6.3274 12.6548 0.0332 Constraint 145 1649 4.3781 5.4726 10.9453 0.0332 Constraint 145 731 5.7005 7.1257 14.2513 0.0332 Constraint 128 731 4.1690 5.2112 10.4225 0.0332 Constraint 121 1030 4.6875 5.8594 11.7188 0.0332 Constraint 121 1014 3.9140 4.8925 9.7851 0.0332 Constraint 121 706 6.0551 7.5689 15.1377 0.0332 Constraint 112 955 6.0598 7.5747 15.1495 0.0332 Constraint 97 1054 6.0889 7.6111 15.2223 0.0332 Constraint 97 1035 3.8342 4.7927 9.5854 0.0332 Constraint 97 921 5.2437 6.5546 13.1093 0.0332 Constraint 97 196 4.3188 5.3984 10.7969 0.0332 Constraint 91 829 5.3864 6.7330 13.4660 0.0332 Constraint 66 829 4.2034 5.2542 10.5084 0.0332 Constraint 66 756 4.6412 5.8015 11.6031 0.0332 Constraint 66 731 5.9021 7.3777 14.7554 0.0332 Constraint 59 1149 5.3700 6.7125 13.4251 0.0332 Constraint 59 756 5.2820 6.6025 13.2049 0.0332 Constraint 59 706 6.1559 7.6949 15.3898 0.0332 Constraint 59 249 5.3930 6.7413 13.4826 0.0332 Constraint 39 1479 5.6736 7.0920 14.1839 0.0332 Constraint 39 1092 6.1039 7.6299 15.2598 0.0332 Constraint 39 921 5.6808 7.1010 14.2020 0.0332 Constraint 39 731 4.0722 5.0902 10.1804 0.0332 Constraint 39 722 5.1484 6.4355 12.8711 0.0332 Constraint 33 1220 5.0540 6.3175 12.6350 0.0332 Constraint 33 1204 4.4543 5.5679 11.1358 0.0332 Constraint 33 1125 5.0546 6.3182 12.6365 0.0332 Constraint 33 1092 5.7177 7.1471 14.2942 0.0332 Constraint 33 731 3.8308 4.7886 9.5771 0.0332 Constraint 33 722 5.8648 7.3311 14.6621 0.0332 Constraint 33 698 3.9653 4.9566 9.9132 0.0332 Constraint 33 249 4.4753 5.5941 11.1881 0.0332 Constraint 25 1125 5.9270 7.4087 14.8175 0.0332 Constraint 18 1035 4.6634 5.8293 11.6586 0.0332 Constraint 1178 1358 5.5431 6.9288 13.8577 0.0325 Constraint 1141 1325 4.7158 5.8948 11.7896 0.0325 Constraint 1100 1567 5.0486 6.3107 12.6215 0.0325 Constraint 997 1100 4.5844 5.7305 11.4610 0.0325 Constraint 868 1382 5.8695 7.3369 14.6738 0.0325 Constraint 698 1466 4.9215 6.1519 12.3038 0.0325 Constraint 698 1455 4.6174 5.7717 11.5435 0.0325 Constraint 657 1239 5.8742 7.3428 14.6855 0.0325 Constraint 189 761 4.6288 5.7859 11.5719 0.0325 Constraint 1213 1293 4.2255 5.2818 10.5637 0.0322 Constraint 913 1511 5.7501 7.1876 14.3752 0.0322 Constraint 859 1427 5.6865 7.1081 14.2161 0.0322 Constraint 698 1503 5.2665 6.5831 13.1662 0.0322 Constraint 616 868 4.6391 5.7989 11.5978 0.0322 Constraint 164 706 5.3835 6.7294 13.4588 0.0322 Constraint 154 1416 4.5765 5.7207 11.4414 0.0322 Constraint 97 216 4.0842 5.1053 10.2106 0.0322 Constraint 829 1587 4.9765 6.2206 12.4412 0.0321 Constraint 657 1657 5.9852 7.4815 14.9630 0.0321 Constraint 657 1649 6.2064 7.7580 15.5160 0.0321 Constraint 479 892 5.3182 6.6478 13.2956 0.0321 Constraint 172 487 6.2591 7.8239 15.6477 0.0321 Constraint 731 1125 5.5163 6.8954 13.7908 0.0320 Constraint 368 1008 4.7564 5.9454 11.8909 0.0320 Constraint 314 1008 4.8640 6.0799 12.1599 0.0320 Constraint 112 285 5.6201 7.0251 14.0502 0.0320 Constraint 59 222 4.3899 5.4874 10.9748 0.0320 Constraint 1351 1526 5.8095 7.2618 14.5237 0.0317 Constraint 1351 1519 4.8575 6.0718 12.1436 0.0317 Constraint 892 1343 4.1776 5.2221 10.4441 0.0317 Constraint 731 1092 5.3451 6.6813 13.3627 0.0317 Constraint 47 1035 4.4555 5.5694 11.1388 0.0317 Constraint 1293 1466 5.4200 6.7750 13.5500 0.0313 Constraint 1158 1541 5.6155 7.0194 14.0389 0.0313 Constraint 1158 1488 5.1320 6.4150 12.8301 0.0313 Constraint 1125 1596 5.3159 6.6449 13.2898 0.0313 Constraint 1068 1731 5.6031 7.0039 14.0079 0.0313 Constraint 690 1714 5.5083 6.8854 13.7708 0.0313 Constraint 665 1382 5.8441 7.3051 14.6102 0.0313 Constraint 665 1293 5.2219 6.5274 13.0547 0.0313 Constraint 589 1022 6.1756 7.7195 15.4391 0.0313 Constraint 479 800 4.5892 5.7365 11.4731 0.0313 Constraint 466 564 5.4587 6.8234 13.6469 0.0313 Constraint 375 1030 5.2339 6.5424 13.0848 0.0313 Constraint 314 698 5.7517 7.1897 14.3793 0.0313 Constraint 227 384 5.3521 6.6901 13.3802 0.0313 Constraint 208 963 5.8839 7.3548 14.7096 0.0313 Constraint 172 325 5.8150 7.2687 14.5375 0.0313 Constraint 77 955 5.4371 6.7963 13.5927 0.0313 Constraint 66 1268 5.6624 7.0780 14.1560 0.0313 Constraint 66 1246 5.6096 7.0121 14.0241 0.0313 Constraint 25 1014 3.0677 3.8346 7.6692 0.0313 Constraint 25 955 5.5713 6.9642 13.9284 0.0313 Constraint 1683 1777 6.1189 7.6487 15.2973 0.0312 Constraint 1649 1788 6.1539 7.6924 15.3847 0.0312 Constraint 1317 1777 4.5143 5.6428 11.2857 0.0312 Constraint 1220 1466 3.7643 4.7054 9.4108 0.0312 Constraint 1167 1251 4.4108 5.5136 11.0271 0.0312 Constraint 1035 1748 2.7825 3.4782 6.9564 0.0312 Constraint 1035 1739 3.8283 4.7853 9.5707 0.0312 Constraint 1030 1739 5.4830 6.8538 13.7076 0.0312 Constraint 1030 1714 5.8004 7.2505 14.5009 0.0312 Constraint 1030 1662 5.9533 7.4417 14.8833 0.0312 Constraint 1030 1334 5.9002 7.3753 14.7506 0.0312 Constraint 1022 1739 3.4756 4.3445 8.6890 0.0312 Constraint 1014 1541 6.2338 7.7923 15.5846 0.0312 Constraint 1014 1366 3.5620 4.4526 8.9051 0.0312 Constraint 1014 1204 5.3585 6.6982 13.3963 0.0312 Constraint 997 1683 4.7572 5.9465 11.8930 0.0312 Constraint 988 1391 6.1711 7.7139 15.4278 0.0312 Constraint 988 1366 3.4460 4.3075 8.6149 0.0312 Constraint 980 1526 3.4242 4.2802 8.5605 0.0312 Constraint 968 1683 3.4454 4.3068 8.6135 0.0312 Constraint 963 1683 6.3224 7.9030 15.8059 0.0312 Constraint 963 1077 5.9639 7.4549 14.9098 0.0312 Constraint 937 1657 3.2221 4.0276 8.0552 0.0312 Constraint 937 1567 6.1274 7.6592 15.3185 0.0312 Constraint 937 1358 5.7969 7.2462 14.4923 0.0312 Constraint 937 1030 5.1748 6.4685 12.9370 0.0312 Constraint 930 1022 5.3702 6.7128 13.4255 0.0312 Constraint 908 1022 5.3769 6.7211 13.4422 0.0312 Constraint 884 1035 5.3532 6.6915 13.3831 0.0312 Constraint 876 1657 5.6921 7.1152 14.2303 0.0312 Constraint 876 1455 4.8254 6.0317 12.0634 0.0312 Constraint 868 1634 5.7952 7.2441 14.4881 0.0312 Constraint 868 1603 4.1909 5.2386 10.4772 0.0312 Constraint 868 1567 4.6663 5.8328 11.6656 0.0312 Constraint 868 1416 5.4865 6.8582 13.7164 0.0312 Constraint 859 997 5.2385 6.5481 13.0962 0.0312 Constraint 848 1526 5.2961 6.6201 13.2403 0.0312 Constraint 848 1334 4.2003 5.2504 10.5007 0.0312 Constraint 818 1471 6.3354 7.9192 15.8385 0.0312 Constraint 792 884 5.8031 7.2539 14.5078 0.0312 Constraint 722 1692 4.8207 6.0259 12.0519 0.0312 Constraint 722 921 5.5358 6.9197 13.8394 0.0312 Constraint 690 1117 6.3448 7.9310 15.8619 0.0312 Constraint 681 1117 6.3636 7.9546 15.9091 0.0312 Constraint 657 1268 5.5473 6.9341 13.8681 0.0312 Constraint 650 1149 5.2757 6.5947 13.1893 0.0312 Constraint 650 1141 4.1689 5.2112 10.4223 0.0312 Constraint 639 1731 4.9916 6.2395 12.4790 0.0312 Constraint 616 1519 4.5152 5.6440 11.2881 0.0312 Constraint 597 1447 4.9664 6.2080 12.4159 0.0312 Constraint 589 1382 5.4842 6.8553 13.7106 0.0312 Constraint 530 1276 4.0321 5.0402 10.0803 0.0312 Constraint 521 1276 5.9658 7.4573 14.9146 0.0312 Constraint 510 1284 5.5657 6.9571 13.9142 0.0312 Constraint 510 1276 3.5005 4.3756 8.7513 0.0312 Constraint 510 1268 5.8346 7.2933 14.5866 0.0312 Constraint 501 1301 5.5394 6.9242 13.8484 0.0312 Constraint 501 1284 3.7224 4.6530 9.3060 0.0312 Constraint 501 1276 5.1307 6.4133 12.8267 0.0312 Constraint 493 589 6.3701 7.9626 15.9252 0.0312 Constraint 435 1246 5.7865 7.2331 14.4662 0.0312 Constraint 421 988 5.0759 6.3448 12.6897 0.0312 Constraint 375 748 4.3721 5.4651 10.9302 0.0312 Constraint 375 739 4.0316 5.0395 10.0790 0.0312 Constraint 375 681 3.5420 4.4276 8.8551 0.0312 Constraint 368 706 4.7161 5.8951 11.7902 0.0312 Constraint 355 739 5.0593 6.3241 12.6481 0.0312 Constraint 347 690 3.8479 4.8099 9.6197 0.0312 Constraint 299 761 4.7583 5.9479 11.8958 0.0312 Constraint 294 761 6.3960 7.9950 15.9900 0.0312 Constraint 216 429 5.1993 6.4992 12.9984 0.0312 Constraint 136 792 5.1949 6.4937 12.9873 0.0312 Constraint 136 783 5.4752 6.8440 13.6881 0.0312 Constraint 136 761 4.5471 5.6839 11.3678 0.0312 Constraint 128 792 6.2316 7.7895 15.5790 0.0312 Constraint 121 848 5.2249 6.5312 13.0623 0.0312 Constraint 104 818 5.7294 7.1617 14.3235 0.0312 Constraint 1519 1748 6.1246 7.6557 15.3115 0.0311 Constraint 136 233 4.9665 6.2082 12.4163 0.0311 Constraint 1158 1416 3.9098 4.8872 9.7744 0.0310 Constraint 299 899 5.5322 6.9153 13.8306 0.0310 Constraint 216 1526 4.0758 5.0947 10.1894 0.0310 Constraint 216 1416 5.7224 7.1531 14.3061 0.0310 Constraint 196 665 4.6966 5.8707 11.7414 0.0310 Constraint 97 899 5.3504 6.6880 13.3760 0.0310 Constraint 47 1014 5.0698 6.3372 12.6744 0.0310 Constraint 25 1084 5.3574 6.6968 13.3935 0.0310 Constraint 25 1054 5.6660 7.0826 14.1651 0.0310 Constraint 18 1603 4.1996 5.2494 10.4989 0.0310 Constraint 1284 1748 4.8630 6.0787 12.1575 0.0308 Constraint 1239 1334 5.6528 7.0660 14.1321 0.0308 Constraint 1149 1325 6.2878 7.8597 15.7195 0.0308 Constraint 944 1100 4.2747 5.3434 10.6868 0.0308 Constraint 899 1068 5.5513 6.9391 13.8783 0.0308 Constraint 884 1374 4.4875 5.6094 11.2188 0.0308 Constraint 884 1366 4.8951 6.1189 12.2377 0.0308 Constraint 884 1068 4.7819 5.9774 11.9548 0.0308 Constraint 673 748 5.6298 7.0372 14.0745 0.0308 Constraint 579 1382 4.8591 6.0739 12.1477 0.0308 Constraint 579 892 4.8179 6.0224 12.0448 0.0308 Constraint 479 589 4.9956 6.2444 12.4889 0.0308 Constraint 189 673 5.3870 6.7338 13.4676 0.0308 Constraint 1204 1309 5.6464 7.0580 14.1161 0.0307 Constraint 968 1293 5.4309 6.7886 13.5773 0.0307 Constraint 800 908 4.7812 5.9765 11.9530 0.0307 Constraint 39 172 5.8418 7.3022 14.6044 0.0307 Constraint 639 1777 5.8889 7.3611 14.7222 0.0306 Constraint 189 1100 6.2037 7.7546 15.5092 0.0306 Constraint 1399 1611 5.1925 6.4907 12.9813 0.0306 Constraint 1059 1438 3.8761 4.8452 9.6903 0.0306 Constraint 1035 1399 5.7915 7.2394 14.4788 0.0306 Constraint 761 1077 5.5501 6.9377 13.8753 0.0306 Constraint 616 1678 5.8006 7.2507 14.5014 0.0306 Constraint 608 1022 4.4968 5.6210 11.2419 0.0306 Constraint 521 829 4.9148 6.1435 12.2871 0.0306 Constraint 457 769 5.7598 7.1997 14.3995 0.0306 Constraint 314 713 5.0288 6.2860 12.5719 0.0306 Constraint 136 412 4.6347 5.7933 11.5867 0.0306 Constraint 128 325 5.1187 6.3984 12.7968 0.0306 Constraint 104 392 5.4234 6.7793 13.5585 0.0306 Constraint 77 314 5.2890 6.6112 13.2225 0.0306 Constraint 3 91 4.6256 5.7820 11.5641 0.0306 Constraint 579 937 5.4774 6.8467 13.6935 0.0305 Constraint 913 1503 5.3278 6.6598 13.3195 0.0303 Constraint 549 908 5.4409 6.8011 13.6022 0.0303 Constraint 510 876 5.1393 6.4241 12.8483 0.0303 Constraint 33 1649 6.0746 7.5932 15.1865 0.0303 Constraint 1567 1777 5.2416 6.5520 13.1040 0.0302 Constraint 1399 1772 4.7319 5.9148 11.8296 0.0302 Constraint 748 1178 6.3236 7.9045 15.8091 0.0302 Constraint 739 1178 4.8911 6.1139 12.2278 0.0302 Constraint 731 1178 2.6622 3.3277 6.6554 0.0302 Constraint 722 1178 5.5802 6.9753 13.9505 0.0302 Constraint 690 836 5.8123 7.2654 14.5308 0.0302 Constraint 657 899 5.3460 6.6826 13.3651 0.0302 Constraint 657 892 6.3733 7.9667 15.9333 0.0302 Constraint 333 1008 5.7695 7.2118 14.4237 0.0302 Constraint 325 980 5.5621 6.9526 13.9052 0.0302 Constraint 299 1046 5.9871 7.4839 14.9678 0.0302 Constraint 299 1035 4.9466 6.1833 12.3665 0.0302 Constraint 294 1014 5.4589 6.8236 13.6473 0.0302 Constraint 285 1030 5.6675 7.0843 14.1686 0.0302 Constraint 256 997 4.0776 5.0970 10.1940 0.0302 Constraint 233 1035 5.6112 7.0140 14.0280 0.0302 Constraint 233 457 4.5710 5.7137 11.4275 0.0302 Constraint 227 412 3.9974 4.9968 9.9936 0.0302 Constraint 216 1109 3.6078 4.5098 9.0195 0.0302 Constraint 180 1133 4.9748 6.2185 12.4369 0.0302 Constraint 180 1100 6.1106 7.6382 15.2764 0.0302 Constraint 91 216 5.2056 6.5069 13.0139 0.0302 Constraint 47 1204 5.1247 6.4059 12.8118 0.0302 Constraint 39 1220 4.8342 6.0427 12.0855 0.0302 Constraint 39 1022 4.7361 5.9201 11.8403 0.0302 Constraint 39 997 4.7609 5.9511 11.9022 0.0302 Constraint 18 1204 5.3834 6.7292 13.4585 0.0302 Constraint 18 145 4.1556 5.1946 10.3891 0.0302 Constraint 11 227 5.3473 6.6841 13.3682 0.0302 Constraint 11 222 5.8074 7.2592 14.5185 0.0302 Constraint 11 196 4.0553 5.0691 10.1383 0.0302 Constraint 1382 1670 6.0633 7.5791 15.1583 0.0300 Constraint 968 1092 5.7790 7.2238 14.4476 0.0300 Constraint 955 1511 5.2686 6.5858 13.1716 0.0300 Constraint 944 1325 4.7276 5.9094 11.8189 0.0300 Constraint 937 1714 5.3603 6.7004 13.4009 0.0300 Constraint 597 1133 6.0296 7.5371 15.0741 0.0300 Constraint 233 792 4.1762 5.2202 10.4404 0.0300 Constraint 1541 1657 5.3645 6.7057 13.4113 0.0295 Constraint 1503 1720 5.8954 7.3693 14.7386 0.0295 Constraint 1193 1399 4.4852 5.6066 11.2131 0.0295 Constraint 1109 1603 5.1497 6.4371 12.8742 0.0295 Constraint 921 1068 5.4156 6.7695 13.5390 0.0295 Constraint 713 1334 6.0130 7.5162 15.0324 0.0295 Constraint 698 1427 5.1403 6.4254 12.8509 0.0295 Constraint 681 1334 4.6184 5.7730 11.5459 0.0295 Constraint 681 1008 5.7952 7.2440 14.4879 0.0295 Constraint 650 968 4.8386 6.0482 12.0964 0.0295 Constraint 608 955 4.9014 6.1268 12.2535 0.0295 Constraint 572 1416 4.7023 5.8779 11.7557 0.0295 Constraint 412 510 4.3093 5.3867 10.7733 0.0295 Constraint 1494 1731 4.1886 5.2358 10.4716 0.0293 Constraint 921 1649 5.1971 6.4964 12.9928 0.0293 Constraint 836 1022 5.7781 7.2227 14.4454 0.0293 Constraint 783 1548 6.2179 7.7723 15.5447 0.0293 Constraint 665 1117 3.7541 4.6926 9.3851 0.0293 Constraint 630 1035 5.4887 6.8608 13.7216 0.0293 Constraint 597 1519 3.7757 4.7196 9.4391 0.0293 Constraint 597 1213 5.4681 6.8351 13.6703 0.0293 Constraint 589 1213 5.6897 7.1121 14.2242 0.0293 Constraint 263 1596 4.6688 5.8360 11.6719 0.0293 Constraint 104 501 4.3014 5.3767 10.7535 0.0293 Constraint 1374 1756 5.1795 6.4744 12.9488 0.0288 Constraint 1351 1548 5.8172 7.2715 14.5431 0.0288 Constraint 1334 1556 5.8164 7.2704 14.5409 0.0288 Constraint 1309 1657 5.1815 6.4768 12.9537 0.0288 Constraint 1228 1777 3.6676 4.5845 9.1690 0.0288 Constraint 1220 1343 5.0754 6.3443 12.6886 0.0288 Constraint 1125 1455 5.2050 6.5062 13.0125 0.0288 Constraint 1100 1657 5.3766 6.7208 13.4416 0.0288 Constraint 1092 1519 4.1995 5.2494 10.4988 0.0288 Constraint 1035 1158 4.2888 5.3609 10.7219 0.0288 Constraint 968 1466 5.8161 7.2701 14.5403 0.0288 Constraint 955 1317 5.2294 6.5367 13.0735 0.0288 Constraint 930 1494 5.0849 6.3561 12.7122 0.0288 Constraint 921 1714 3.8616 4.8270 9.6539 0.0288 Constraint 913 1670 4.9215 6.1519 12.3039 0.0288 Constraint 908 1466 4.5115 5.6394 11.2788 0.0288 Constraint 908 1427 5.8027 7.2533 14.5066 0.0288 Constraint 899 1466 5.4089 6.7611 13.5221 0.0288 Constraint 899 1293 5.3503 6.6879 13.3757 0.0288 Constraint 892 1293 3.3071 4.1339 8.2679 0.0288 Constraint 892 1014 5.6629 7.0787 14.1573 0.0288 Constraint 884 1519 4.9534 6.1917 12.3835 0.0288 Constraint 876 1748 5.9444 7.4304 14.8609 0.0288 Constraint 876 1427 4.8394 6.0492 12.0985 0.0288 Constraint 876 1391 6.3380 7.9225 15.8451 0.0288 Constraint 868 1772 4.8061 6.0076 12.0152 0.0288 Constraint 868 1748 4.3002 5.3752 10.7505 0.0288 Constraint 868 1714 4.8784 6.0980 12.1959 0.0288 Constraint 848 1772 4.0899 5.1124 10.2247 0.0288 Constraint 792 908 4.7234 5.9043 11.8085 0.0288 Constraint 783 1204 5.6787 7.0984 14.1967 0.0288 Constraint 761 1519 5.4711 6.8388 13.6777 0.0288 Constraint 761 1488 3.8073 4.7591 9.5182 0.0288 Constraint 761 1466 6.0668 7.5835 15.1669 0.0288 Constraint 756 1276 5.6730 7.0912 14.1825 0.0288 Constraint 739 1541 5.8299 7.2874 14.5747 0.0288 Constraint 731 1541 4.8086 6.0108 12.0215 0.0288 Constraint 731 1519 4.3481 5.4351 10.8702 0.0288 Constraint 731 1511 3.6574 4.5718 9.1436 0.0288 Constraint 731 1213 4.3444 5.4305 10.8611 0.0288 Constraint 713 1541 4.0931 5.1164 10.2328 0.0288 Constraint 713 1301 6.1342 7.6678 15.3356 0.0288 Constraint 713 1276 5.2011 6.5014 13.0028 0.0288 Constraint 706 1213 3.8501 4.8126 9.6251 0.0288 Constraint 706 1204 6.1116 7.6396 15.2791 0.0288 Constraint 706 1193 5.3364 6.6705 13.3410 0.0288 Constraint 706 1167 5.3549 6.6937 13.3873 0.0288 Constraint 690 1260 5.5777 6.9721 13.9441 0.0288 Constraint 579 1133 6.0810 7.6012 15.2024 0.0288 Constraint 572 1092 5.8449 7.3061 14.6122 0.0288 Constraint 549 1158 4.9438 6.1797 12.3594 0.0288 Constraint 538 1620 6.2870 7.8588 15.7175 0.0288 Constraint 538 1438 4.6667 5.8334 11.6668 0.0288 Constraint 538 1408 6.2870 7.8588 15.7175 0.0288 Constraint 521 1158 4.4476 5.5595 11.1190 0.0288 Constraint 510 1670 4.8608 6.0760 12.1521 0.0288 Constraint 510 1511 4.8482 6.0602 12.1205 0.0288 Constraint 510 1158 5.2853 6.6066 13.2133 0.0288 Constraint 479 1541 5.6883 7.1104 14.2209 0.0288 Constraint 466 1030 4.0038 5.0047 10.0094 0.0288 Constraint 457 1193 5.8879 7.3598 14.7197 0.0288 Constraint 443 1268 5.7287 7.1609 14.3218 0.0288 Constraint 443 1246 5.9096 7.3870 14.7741 0.0288 Constraint 435 1239 4.4026 5.5032 11.0065 0.0288 Constraint 435 1193 5.6633 7.0791 14.1583 0.0288 Constraint 435 1167 3.6810 4.6012 9.2024 0.0288 Constraint 421 1268 5.8050 7.2562 14.5125 0.0288 Constraint 412 1268 4.9918 6.2398 12.4795 0.0288 Constraint 412 1260 4.6023 5.7528 11.5057 0.0288 Constraint 412 1239 4.1433 5.1791 10.3582 0.0288 Constraint 412 1228 4.8004 6.0005 12.0010 0.0288 Constraint 412 1167 4.8317 6.0396 12.0793 0.0288 Constraint 403 1167 4.5954 5.7443 11.4886 0.0288 Constraint 403 1149 5.8613 7.3266 14.6533 0.0288 Constraint 403 1141 5.6934 7.1168 14.2336 0.0288 Constraint 403 955 5.6831 7.1039 14.2078 0.0288 Constraint 384 1772 3.3020 4.1275 8.2549 0.0288 Constraint 384 1739 5.5885 6.9856 13.9712 0.0288 Constraint 384 1293 5.1519 6.4398 12.8797 0.0288 Constraint 384 955 5.5721 6.9651 13.9301 0.0288 Constraint 375 1772 4.3131 5.3914 10.7828 0.0288 Constraint 375 1251 4.6773 5.8466 11.6931 0.0288 Constraint 375 1228 6.2222 7.7778 15.5556 0.0288 Constraint 375 1117 3.8033 4.7542 9.5083 0.0288 Constraint 375 1109 5.7650 7.2063 14.4126 0.0288 Constraint 375 963 5.0761 6.3451 12.6902 0.0288 Constraint 368 930 6.3686 7.9607 15.9214 0.0288 Constraint 363 1772 6.2929 7.8661 15.7321 0.0288 Constraint 363 1739 4.3465 5.4332 10.8664 0.0288 Constraint 363 665 5.6214 7.0267 14.0535 0.0288 Constraint 355 1714 6.3291 7.9114 15.8227 0.0288 Constraint 355 1284 4.9054 6.1318 12.2635 0.0288 Constraint 355 1117 5.9646 7.4557 14.9114 0.0288 Constraint 355 1109 4.7870 5.9837 11.9674 0.0288 Constraint 355 1084 5.1214 6.4017 12.8035 0.0288 Constraint 347 1117 5.5893 6.9867 13.9733 0.0288 Constraint 347 1046 5.9681 7.4602 14.9204 0.0288 Constraint 347 930 5.5023 6.8779 13.7558 0.0288 Constraint 325 1714 4.1978 5.2472 10.4945 0.0288 Constraint 314 1046 4.6183 5.7729 11.5458 0.0288 Constraint 314 1022 6.0360 7.5449 15.0899 0.0288 Constraint 299 1556 5.8179 7.2723 14.5447 0.0288 Constraint 294 731 3.5570 4.4463 8.8926 0.0288 Constraint 274 1657 4.9742 6.2177 12.4354 0.0288 Constraint 274 1587 4.8593 6.0741 12.1483 0.0288 Constraint 249 1533 6.3327 7.9158 15.8317 0.0288 Constraint 233 487 5.3808 6.7260 13.4520 0.0288 Constraint 208 1526 5.4696 6.8370 13.6740 0.0288 Constraint 208 1416 5.4911 6.8639 13.7278 0.0288 Constraint 208 1193 5.3894 6.7368 13.4735 0.0288 Constraint 208 673 5.5746 6.9682 13.9364 0.0288 Constraint 196 1471 4.2981 5.3727 10.7453 0.0288 Constraint 180 1503 4.3215 5.4018 10.8037 0.0288 Constraint 180 673 6.3733 7.9667 15.9333 0.0288 Constraint 172 1374 5.8463 7.3079 14.6158 0.0288 Constraint 172 1351 3.7101 4.6376 9.2752 0.0288 Constraint 164 1503 6.2607 7.8259 15.6519 0.0288 Constraint 164 1494 6.3862 7.9828 15.9655 0.0288 Constraint 164 1068 6.1396 7.6745 15.3491 0.0288 Constraint 145 1503 4.3376 5.4220 10.8439 0.0288 Constraint 145 1167 6.0240 7.5300 15.0600 0.0288 Constraint 136 1351 6.2081 7.7601 15.5202 0.0288 Constraint 128 1447 4.2432 5.3040 10.6080 0.0288 Constraint 128 1374 6.3768 7.9710 15.9421 0.0288 Constraint 128 1343 3.8887 4.8608 9.7217 0.0288 Constraint 121 1494 6.1722 7.7152 15.4305 0.0288 Constraint 121 1438 5.9915 7.4894 14.9788 0.0288 Constraint 121 1408 5.0400 6.3000 12.6000 0.0288 Constraint 121 1351 5.9265 7.4082 14.8164 0.0288 Constraint 121 1317 4.8769 6.0962 12.1924 0.0288 Constraint 121 1167 6.0363 7.5454 15.0908 0.0288 Constraint 121 306 4.3769 5.4712 10.9423 0.0288 Constraint 121 285 3.0591 3.8239 7.6478 0.0288 Constraint 104 1657 5.0960 6.3700 12.7401 0.0288 Constraint 97 1447 4.2749 5.3436 10.6872 0.0288 Constraint 97 1408 5.0027 6.2533 12.5066 0.0288 Constraint 97 1399 5.5185 6.8981 13.7962 0.0288 Constraint 97 1343 6.0600 7.5750 15.1500 0.0288 Constraint 91 1447 4.5947 5.7434 11.4867 0.0288 Constraint 91 1438 6.1974 7.7467 15.4935 0.0288 Constraint 91 1408 5.1908 6.4885 12.9769 0.0288 Constraint 91 1374 6.2810 7.8513 15.7026 0.0288 Constraint 91 1301 5.3855 6.7319 13.4638 0.0288 Constraint 77 1325 5.9606 7.4508 14.9015 0.0288 Constraint 77 1293 4.3859 5.4824 10.9647 0.0288 Constraint 66 1678 4.4511 5.5639 11.1278 0.0288 Constraint 66 1408 4.8835 6.1043 12.2087 0.0288 Constraint 66 1374 6.3725 7.9656 15.9313 0.0288 Constraint 66 1325 2.8656 3.5820 7.1640 0.0288 Constraint 59 1374 6.3408 7.9260 15.8520 0.0288 Constraint 47 1325 6.0060 7.5075 15.0150 0.0288 Constraint 47 1301 4.7694 5.9618 11.9235 0.0288 Constraint 47 1293 4.4468 5.5585 11.1170 0.0288 Constraint 39 1548 6.3675 7.9594 15.9189 0.0288 Constraint 39 1374 6.3923 7.9904 15.9807 0.0288 Constraint 39 1325 2.8577 3.5721 7.1442 0.0288 Constraint 39 1301 3.8101 4.7626 9.5253 0.0288 Constraint 39 1251 5.8152 7.2690 14.5380 0.0288 Constraint 39 1246 5.3118 6.6397 13.2794 0.0288 Constraint 33 1756 6.3516 7.9395 15.8789 0.0288 Constraint 33 1479 5.2983 6.6228 13.2457 0.0288 Constraint 25 1455 5.8953 7.3691 14.7383 0.0288 Constraint 25 1276 5.5283 6.9103 13.8206 0.0288 Constraint 25 1268 4.7159 5.8948 11.7897 0.0288 Constraint 18 1683 4.7095 5.8869 11.7738 0.0288 Constraint 18 1678 4.3859 5.4824 10.9647 0.0288 Constraint 18 1548 6.0454 7.5568 15.1136 0.0288 Constraint 18 1526 4.7002 5.8753 11.7506 0.0288 Constraint 18 1519 4.3591 5.4489 10.8979 0.0288 Constraint 18 1309 6.2860 7.8575 15.7151 0.0288 Constraint 18 1276 4.8299 6.0373 12.0747 0.0288 Constraint 18 1268 5.2436 6.5545 13.1090 0.0288 Constraint 18 1092 4.8299 6.0373 12.0747 0.0288 Constraint 11 1683 4.1391 5.1738 10.3476 0.0288 Constraint 11 1678 4.9367 6.1709 12.3418 0.0288 Constraint 11 1603 6.0664 7.5830 15.1660 0.0288 Constraint 11 1548 3.0372 3.7965 7.5929 0.0288 Constraint 11 1526 3.9282 4.9103 9.8206 0.0288 Constraint 11 1519 4.9629 6.2036 12.4072 0.0288 Constraint 11 1268 5.5924 6.9905 13.9810 0.0288 Constraint 11 1246 5.0323 6.2904 12.5807 0.0288 Constraint 3 1683 4.5716 5.7145 11.4290 0.0288 Constraint 3 1526 4.3491 5.4364 10.8728 0.0288 Constraint 3 1268 4.3984 5.4979 10.9959 0.0288 Constraint 3 1246 4.3205 5.4007 10.8013 0.0288 Constraint 3 1239 4.0653 5.0817 10.1634 0.0288 Constraint 3 1213 5.6501 7.0627 14.1253 0.0288 Constraint 196 1158 3.8426 4.8032 9.6064 0.0288 Constraint 180 876 5.4131 6.7663 13.5327 0.0288 Constraint 97 314 5.1843 6.4804 12.9608 0.0288 Constraint 1149 1382 4.0807 5.1008 10.2017 0.0283 Constraint 937 1488 4.6719 5.8398 11.6796 0.0283 Constraint 937 1479 5.0916 6.3645 12.7290 0.0283 Constraint 769 1301 5.4809 6.8511 13.7022 0.0283 Constraint 665 1334 5.1327 6.4158 12.8317 0.0283 Constraint 657 1309 5.5947 6.9934 13.9868 0.0283 Constraint 630 1334 4.9054 6.1317 12.2635 0.0283 Constraint 172 665 4.6954 5.8692 11.7384 0.0283 Constraint 104 1634 4.4683 5.5854 11.1708 0.0283 Constraint 104 1603 4.1923 5.2403 10.4807 0.0283 Constraint 104 1575 5.2879 6.6099 13.2198 0.0283 Constraint 77 1657 4.5399 5.6748 11.3496 0.0283 Constraint 77 1634 4.5994 5.7492 11.4985 0.0283 Constraint 47 1657 4.7224 5.9030 11.8061 0.0283 Constraint 608 899 5.7447 7.1809 14.3618 0.0283 Constraint 466 616 5.2480 6.5600 13.1199 0.0283 Constraint 77 623 3.9775 4.9719 9.9439 0.0283 Constraint 77 333 4.3547 5.4434 10.8869 0.0283 Constraint 1251 1374 5.3519 6.6899 13.3798 0.0281 Constraint 769 1109 5.0983 6.3729 12.7458 0.0281 Constraint 579 848 4.9332 6.1665 12.3331 0.0281 Constraint 435 538 6.1516 7.6895 15.3790 0.0281 Constraint 59 1662 4.5463 5.6829 11.3658 0.0281 Constraint 33 1634 4.9877 6.2346 12.4692 0.0281 Constraint 25 1634 5.9045 7.3806 14.7612 0.0281 Constraint 630 1391 6.0325 7.5406 15.0813 0.0281 Constraint 112 241 5.0468 6.3085 12.6169 0.0281 Constraint 1479 1788 4.1730 5.2163 10.4325 0.0279 Constraint 1479 1703 4.1730 5.2163 10.4325 0.0279 Constraint 1471 1670 6.3564 7.9455 15.8910 0.0279 Constraint 1447 1788 5.1928 6.4910 12.9819 0.0279 Constraint 1284 1662 5.5365 6.9207 13.8413 0.0279 Constraint 1213 1399 3.7095 4.6368 9.2736 0.0279 Constraint 1213 1391 5.4518 6.8147 13.6294 0.0279 Constraint 1178 1301 5.7917 7.2397 14.4794 0.0279 Constraint 1149 1374 4.0739 5.0924 10.1849 0.0279 Constraint 1125 1351 5.0431 6.3039 12.6078 0.0279 Constraint 792 1756 4.9710 6.2138 12.4276 0.0279 Constraint 792 1068 6.2676 7.8345 15.6689 0.0279 Constraint 778 1720 5.5165 6.8956 13.7912 0.0279 Constraint 739 921 3.9730 4.9662 9.9325 0.0279 Constraint 681 913 6.0873 7.6091 15.2182 0.0279 Constraint 608 884 4.7054 5.8818 11.7636 0.0279 Constraint 557 698 4.6614 5.8267 11.6535 0.0279 Constraint 435 657 6.0644 7.5805 15.1609 0.0279 Constraint 368 487 3.2720 4.0901 8.1801 0.0279 Constraint 363 657 5.8712 7.3390 14.6779 0.0279 Constraint 347 769 4.2894 5.3618 10.7235 0.0279 Constraint 333 761 6.3435 7.9294 15.8587 0.0279 Constraint 325 630 6.1069 7.6336 15.2673 0.0279 Constraint 294 616 3.9255 4.9069 9.8138 0.0279 Constraint 274 579 4.5890 5.7363 11.4726 0.0279 Constraint 249 579 5.0521 6.3151 12.6303 0.0279 Constraint 241 572 6.1781 7.7226 15.4451 0.0279 Constraint 233 589 4.7779 5.9723 11.9447 0.0279 Constraint 189 557 5.9347 7.4184 14.8367 0.0279 Constraint 66 333 3.9695 4.9619 9.9238 0.0279 Constraint 1447 1748 5.4842 6.8552 13.7104 0.0277 Constraint 501 1788 4.9547 6.1934 12.3867 0.0277 Constraint 172 479 6.0529 7.5661 15.1322 0.0277 Constraint 25 294 4.8447 6.0559 12.1119 0.0277 Constraint 25 285 5.6913 7.1141 14.2282 0.0277 Constraint 1548 1764 4.4371 5.5464 11.0928 0.0275 Constraint 1479 1649 4.4547 5.5684 11.1368 0.0275 Constraint 1466 1739 4.3375 5.4219 10.8439 0.0275 Constraint 1447 1720 5.5113 6.8891 13.7782 0.0275 Constraint 1284 1503 4.5160 5.6450 11.2899 0.0275 Constraint 1268 1611 5.9218 7.4022 14.8045 0.0275 Constraint 1251 1596 5.4183 6.7729 13.5458 0.0275 Constraint 1246 1587 4.5235 5.6543 11.3087 0.0275 Constraint 1220 1657 5.7647 7.2059 14.4118 0.0275 Constraint 1220 1438 5.0872 6.3591 12.7181 0.0275 Constraint 1213 1427 5.3328 6.6660 13.3320 0.0275 Constraint 1204 1596 6.0133 7.5166 15.0332 0.0275 Constraint 1158 1788 5.9627 7.4534 14.9068 0.0275 Constraint 1133 1575 5.7439 7.1798 14.3597 0.0275 Constraint 1125 1788 5.0770 6.3463 12.6925 0.0275 Constraint 1100 1488 5.8471 7.3088 14.6177 0.0275 Constraint 1068 1488 6.2352 7.7940 15.5881 0.0275 Constraint 1014 1092 5.6627 7.0784 14.1568 0.0275 Constraint 913 1587 4.6940 5.8675 11.7351 0.0275 Constraint 876 1587 5.3926 6.7408 13.4815 0.0275 Constraint 868 1141 6.0067 7.5084 15.0167 0.0275 Constraint 808 1399 6.3083 7.8853 15.7707 0.0275 Constraint 673 997 5.4407 6.8008 13.6016 0.0275 Constraint 639 1068 6.3903 7.9879 15.9757 0.0275 Constraint 608 783 3.7934 4.7417 9.4835 0.0275 Constraint 579 1519 3.4816 4.3520 8.7039 0.0275 Constraint 564 1268 5.6286 7.0357 14.0714 0.0275 Constraint 557 1526 5.3200 6.6500 13.3001 0.0275 Constraint 501 800 5.1176 6.3970 12.7940 0.0275 Constraint 233 1678 5.0804 6.3505 12.7009 0.0275 Constraint 233 1596 4.4444 5.5555 11.1109 0.0275 Constraint 208 1596 4.9415 6.1769 12.3537 0.0275 Constraint 189 868 3.6903 4.6129 9.2258 0.0275 Constraint 172 557 6.1470 7.6837 15.3674 0.0275 Constraint 172 521 4.5906 5.7382 11.4764 0.0275 Constraint 145 876 5.8883 7.3604 14.7208 0.0275 Constraint 145 868 5.6022 7.0027 14.0054 0.0275 Constraint 145 859 4.2666 5.3333 10.6665 0.0275 Constraint 97 868 5.3472 6.6840 13.3681 0.0275 Constraint 97 859 3.2508 4.0635 8.1270 0.0275 Constraint 97 836 3.8110 4.7638 9.5276 0.0275 Constraint 91 363 5.4040 6.7550 13.5101 0.0275 Constraint 82 868 6.3977 7.9972 15.9943 0.0275 Constraint 82 859 6.2894 7.8618 15.7236 0.0275 Constraint 66 375 5.3868 6.7335 13.4670 0.0275 Constraint 66 363 5.5102 6.8877 13.7754 0.0275 Constraint 59 1670 4.7591 5.9489 11.8978 0.0275 Constraint 59 1649 4.3223 5.4029 10.8059 0.0275 Constraint 47 355 4.6559 5.8198 11.6396 0.0275 Constraint 39 384 3.6778 4.5973 9.1945 0.0275 Constraint 39 363 5.5696 6.9620 13.9240 0.0275 Constraint 39 299 4.9455 6.1819 12.3637 0.0275 Constraint 33 1678 5.1958 6.4947 12.9895 0.0275 Constraint 33 384 6.1577 7.6971 15.3942 0.0275 Constraint 33 299 6.3741 7.9676 15.9352 0.0275 Constraint 33 233 5.0922 6.3652 12.7304 0.0275 Constraint 25 1678 6.0517 7.5646 15.1293 0.0275 Constraint 25 299 6.2991 7.8738 15.7477 0.0275 Constraint 11 384 3.7583 4.6979 9.3957 0.0275 Constraint 11 363 5.8282 7.2853 14.5705 0.0275 Constraint 11 355 4.3884 5.4855 10.9710 0.0275 Constraint 3 1678 5.1908 6.4885 12.9771 0.0275 Constraint 3 1657 6.2156 7.7695 15.5389 0.0275 Constraint 3 363 5.4618 6.8272 13.6544 0.0275 Constraint 3 325 5.9067 7.3834 14.7668 0.0275 Constraint 1309 1494 4.7325 5.9156 11.8312 0.0271 Constraint 589 1455 5.6310 7.0387 14.0774 0.0271 Constraint 589 1416 4.3759 5.4698 10.9397 0.0271 Constraint 325 1603 4.4511 5.5639 11.1278 0.0271 Constraint 285 1603 5.5133 6.8916 13.7833 0.0271 Constraint 136 227 4.6060 5.7575 11.5150 0.0271 Constraint 731 1109 5.1926 6.4908 12.9815 0.0266 Constraint 33 136 5.4985 6.8732 13.7464 0.0266 Constraint 274 1739 4.8604 6.0754 12.1509 0.0259 Constraint 274 1683 5.1005 6.3756 12.7513 0.0259 Constraint 274 1455 5.4252 6.7815 13.5630 0.0259 Constraint 1334 1455 5.7238 7.1547 14.3094 0.0254 Constraint 597 1455 5.9524 7.4405 14.8809 0.0254 Constraint 180 1575 6.1242 7.6553 15.3106 0.0254 Constraint 164 1575 6.1195 7.6493 15.2986 0.0254 Constraint 1059 1596 6.0290 7.5362 15.0724 0.0252 Constraint 884 1587 5.2882 6.6102 13.2205 0.0252 Constraint 97 233 5.6179 7.0223 14.0446 0.0252 Constraint 47 325 5.2641 6.5801 13.1602 0.0252 Constraint 25 325 5.1627 6.4534 12.9068 0.0252 Constraint 1620 1739 2.9584 3.6980 7.3959 0.0249 Constraint 1611 1756 5.3236 6.6545 13.3089 0.0249 Constraint 1596 1777 4.4123 5.5154 11.0308 0.0249 Constraint 1587 1772 3.2704 4.0880 8.1759 0.0249 Constraint 1494 1634 4.3833 5.4792 10.9583 0.0249 Constraint 1488 1731 4.3780 5.4726 10.9451 0.0249 Constraint 1471 1657 5.1424 6.4280 12.8560 0.0249 Constraint 1466 1649 3.2133 4.0166 8.0333 0.0249 Constraint 1358 1438 5.9673 7.4591 14.9183 0.0249 Constraint 1317 1756 4.0453 5.0566 10.1132 0.0249 Constraint 1301 1503 5.1386 6.4233 12.8465 0.0249 Constraint 1293 1494 6.1841 7.7301 15.4602 0.0249 Constraint 1284 1649 5.2136 6.5171 13.0341 0.0249 Constraint 1260 1692 5.7077 7.1346 14.2693 0.0249 Constraint 1260 1587 5.6500 7.0625 14.1250 0.0249 Constraint 1228 1556 4.1855 5.2319 10.4637 0.0249 Constraint 1228 1548 3.9308 4.9135 9.8270 0.0249 Constraint 1228 1526 5.9503 7.4378 14.8757 0.0249 Constraint 1193 1683 5.8144 7.2680 14.5359 0.0249 Constraint 1193 1309 3.2721 4.0901 8.1802 0.0249 Constraint 1178 1756 5.6518 7.0648 14.1295 0.0249 Constraint 1178 1374 6.0404 7.5505 15.1010 0.0249 Constraint 1178 1366 4.2508 5.3135 10.6269 0.0249 Constraint 1167 1366 6.1659 7.7074 15.4148 0.0249 Constraint 1158 1374 6.1207 7.6508 15.3017 0.0249 Constraint 1158 1366 3.9939 4.9924 9.9847 0.0249 Constraint 1149 1366 4.9844 6.2305 12.4609 0.0249 Constraint 1125 1575 4.4052 5.5065 11.0130 0.0249 Constraint 1125 1548 4.0996 5.1244 10.2489 0.0249 Constraint 1125 1541 5.3754 6.7192 13.4384 0.0249 Constraint 1117 1541 6.0232 7.5289 15.0579 0.0249 Constraint 1059 1739 6.2357 7.7946 15.5892 0.0249 Constraint 1054 1251 6.2419 7.8023 15.6047 0.0249 Constraint 980 1662 3.8669 4.8336 9.6673 0.0249 Constraint 980 1455 4.4278 5.5347 11.0695 0.0249 Constraint 968 1427 3.3282 4.1603 8.3206 0.0249 Constraint 968 1366 5.9235 7.4043 14.8086 0.0249 Constraint 963 1662 3.8564 4.8205 9.6410 0.0249 Constraint 963 1575 3.7687 4.7108 9.4216 0.0249 Constraint 944 1662 3.2157 4.0196 8.0392 0.0249 Constraint 892 1178 5.0228 6.2785 12.5569 0.0249 Constraint 884 1178 6.3925 7.9906 15.9812 0.0249 Constraint 876 1366 5.7345 7.1681 14.3362 0.0249 Constraint 876 1213 3.2925 4.1156 8.2313 0.0249 Constraint 876 1193 4.2106 5.2632 10.5265 0.0249 Constraint 868 1193 4.7350 5.9187 11.8374 0.0249 Constraint 859 1391 6.2264 7.7830 15.5660 0.0249 Constraint 859 1046 6.0740 7.5925 15.1851 0.0249 Constraint 836 1548 4.0682 5.0853 10.1705 0.0249 Constraint 836 1092 5.0112 6.2640 12.5279 0.0249 Constraint 818 1678 6.0013 7.5017 15.0033 0.0249 Constraint 818 1548 6.1810 7.7262 15.4524 0.0249 Constraint 800 1519 5.5543 6.9429 13.8858 0.0249 Constraint 792 1662 2.9844 3.7305 7.4610 0.0249 Constraint 783 1662 4.1741 5.2176 10.4352 0.0249 Constraint 778 1548 6.3846 7.9807 15.9615 0.0249 Constraint 769 1416 5.7586 7.1983 14.3965 0.0249 Constraint 761 1548 6.0305 7.5381 15.0763 0.0249 Constraint 748 1391 5.2427 6.5533 13.1067 0.0249 Constraint 748 899 4.6921 5.8651 11.7303 0.0249 Constraint 739 1657 3.2654 4.0818 8.1636 0.0249 Constraint 739 1391 6.2520 7.8150 15.6300 0.0249 Constraint 739 997 6.3258 7.9072 15.8145 0.0249 Constraint 739 944 6.2176 7.7720 15.5440 0.0249 Constraint 731 1657 3.6624 4.5780 9.1561 0.0249 Constraint 713 1391 5.3535 6.6919 13.3837 0.0249 Constraint 713 1046 5.6146 7.0182 14.0364 0.0249 Constraint 706 1575 5.7020 7.1275 14.2549 0.0249 Constraint 706 1541 5.1700 6.4625 12.9250 0.0249 Constraint 706 1511 4.7135 5.8918 11.7837 0.0249 Constraint 706 1046 5.9031 7.3789 14.7578 0.0249 Constraint 681 1533 6.2631 7.8289 15.6579 0.0249 Constraint 681 1526 3.1420 3.9275 7.8549 0.0249 Constraint 681 1054 3.3815 4.2269 8.4538 0.0249 Constraint 681 1046 3.7756 4.7195 9.4389 0.0249 Constraint 681 980 3.3815 4.2269 8.4538 0.0249 Constraint 665 1503 6.3318 7.9147 15.8294 0.0249 Constraint 650 1548 6.0094 7.5118 15.0235 0.0249 Constraint 650 1526 3.4802 4.3502 8.7005 0.0249 Constraint 650 1519 4.7671 5.9589 11.9177 0.0249 Constraint 650 1511 2.7016 3.3770 6.7540 0.0249 Constraint 650 1503 5.9549 7.4436 14.8872 0.0249 Constraint 650 1416 4.2409 5.3011 10.6022 0.0249 Constraint 650 1408 5.7432 7.1790 14.3580 0.0249 Constraint 639 1526 5.3142 6.6427 13.2854 0.0249 Constraint 639 1416 5.5149 6.8936 13.7872 0.0249 Constraint 630 1662 4.2350 5.2938 10.5875 0.0249 Constraint 630 1657 3.5399 4.4249 8.8498 0.0249 Constraint 630 1649 5.1095 6.3868 12.7736 0.0249 Constraint 630 1541 5.7874 7.2343 14.4686 0.0249 Constraint 630 1416 6.0494 7.5617 15.1234 0.0249 Constraint 623 1657 5.2736 6.5920 13.1840 0.0249 Constraint 623 1649 3.3696 4.2119 8.4239 0.0249 Constraint 623 1125 5.4050 6.7562 13.5125 0.0249 Constraint 616 1657 6.1506 7.6883 15.3766 0.0249 Constraint 616 1575 5.8187 7.2734 14.5467 0.0249 Constraint 616 1533 3.0227 3.7783 7.5567 0.0249 Constraint 616 1494 5.3925 6.7406 13.4812 0.0249 Constraint 616 1466 4.8221 6.0276 12.0552 0.0249 Constraint 616 1117 3.5130 4.3912 8.7825 0.0249 Constraint 608 1670 4.1356 5.1695 10.3390 0.0249 Constraint 608 1662 5.5687 6.9608 13.9216 0.0249 Constraint 608 1511 4.9603 6.2004 12.4008 0.0249 Constraint 608 1488 4.3331 5.4163 10.8327 0.0249 Constraint 608 1466 4.9611 6.2014 12.4027 0.0249 Constraint 608 1084 4.5937 5.7421 11.4843 0.0249 Constraint 608 1008 5.6604 7.0755 14.1510 0.0249 Constraint 608 921 5.8900 7.3625 14.7251 0.0249 Constraint 608 818 4.2050 5.2562 10.5124 0.0249 Constraint 597 1662 3.2157 4.0196 8.0392 0.0249 Constraint 589 1678 5.8289 7.2861 14.5721 0.0249 Constraint 589 1488 6.3248 7.9060 15.8119 0.0249 Constraint 589 829 5.7274 7.1592 14.3184 0.0249 Constraint 579 1479 5.2919 6.6148 13.2297 0.0249 Constraint 579 1447 4.8608 6.0760 12.1519 0.0249 Constraint 579 1276 4.5129 5.6412 11.2823 0.0249 Constraint 579 731 5.7717 7.2146 14.4292 0.0249 Constraint 572 1447 5.4058 6.7573 13.5145 0.0249 Constraint 572 706 3.4157 4.2697 8.5393 0.0249 Constraint 564 1479 5.0055 6.2568 12.5136 0.0249 Constraint 564 1416 4.3507 5.4384 10.8768 0.0249 Constraint 557 1035 6.3533 7.9416 15.8833 0.0249 Constraint 557 1014 5.5316 6.9144 13.8289 0.0249 Constraint 557 1008 6.0794 7.5993 15.1986 0.0249 Constraint 557 980 6.3490 7.9363 15.8725 0.0249 Constraint 557 739 5.9358 7.4197 14.8394 0.0249 Constraint 549 1068 3.7494 4.6868 9.3736 0.0249 Constraint 549 988 5.1756 6.4695 12.9390 0.0249 Constraint 521 1059 5.1014 6.3768 12.7536 0.0249 Constraint 510 1035 5.5135 6.8919 13.7838 0.0249 Constraint 501 876 6.3079 7.8849 15.7698 0.0249 Constraint 501 848 4.8140 6.0175 12.0351 0.0249 Constraint 487 1059 5.8445 7.3057 14.6114 0.0249 Constraint 466 1059 5.5362 6.9203 13.8406 0.0249 Constraint 466 980 4.8270 6.0338 12.0676 0.0249 Constraint 448 1030 4.9128 6.1410 12.2820 0.0249 Constraint 448 673 4.6135 5.7669 11.5338 0.0249 Constraint 443 955 6.1426 7.6783 15.3565 0.0249 Constraint 443 921 3.1612 3.9515 7.9029 0.0249 Constraint 443 913 5.8790 7.3488 14.6975 0.0249 Constraint 435 968 4.8741 6.0927 12.1854 0.0249 Constraint 403 1587 5.1618 6.4522 12.9044 0.0249 Constraint 403 589 6.1327 7.6658 15.3317 0.0249 Constraint 392 1603 3.5100 4.3875 8.7749 0.0249 Constraint 392 1596 5.4480 6.8100 13.6200 0.0249 Constraint 392 616 3.1055 3.8819 7.7638 0.0249 Constraint 384 1587 4.3022 5.3777 10.7554 0.0249 Constraint 384 1575 4.7070 5.8838 11.7675 0.0249 Constraint 384 1567 3.3137 4.1422 8.2844 0.0249 Constraint 375 1567 5.7423 7.1778 14.3557 0.0249 Constraint 368 1603 5.4724 6.8405 13.6810 0.0249 Constraint 368 1596 6.0465 7.5582 15.1163 0.0249 Constraint 368 1587 6.3421 7.9276 15.8553 0.0249 Constraint 347 1596 5.5503 6.9379 13.8758 0.0249 Constraint 347 1526 5.5331 6.9163 13.8327 0.0249 Constraint 347 1092 5.4960 6.8700 13.7400 0.0249 Constraint 333 1567 5.1321 6.4152 12.8303 0.0249 Constraint 333 1548 6.1588 7.6986 15.3971 0.0249 Constraint 314 1548 5.2240 6.5300 13.0600 0.0249 Constraint 314 1533 5.8132 7.2665 14.5331 0.0249 Constraint 314 1526 4.5394 5.6742 11.3484 0.0249 Constraint 314 1092 4.4981 5.6226 11.2452 0.0249 Constraint 314 448 4.7372 5.9215 11.8430 0.0249 Constraint 314 435 5.2431 6.5538 13.1077 0.0249 Constraint 306 1548 5.6415 7.0518 14.1037 0.0249 Constraint 285 1548 5.6030 7.0037 14.0074 0.0249 Constraint 285 1533 6.0431 7.5539 15.1078 0.0249 Constraint 285 783 6.0851 7.6064 15.2129 0.0249 Constraint 274 908 5.9842 7.4802 14.9604 0.0249 Constraint 263 639 3.6482 4.5603 9.1206 0.0249 Constraint 256 778 6.0298 7.5373 15.0746 0.0249 Constraint 256 665 5.7787 7.2234 14.4467 0.0249 Constraint 249 1479 5.4077 6.7596 13.5193 0.0249 Constraint 249 1092 3.4893 4.3617 8.7233 0.0249 Constraint 241 1777 3.6211 4.5263 9.0527 0.0249 Constraint 241 1178 5.9290 7.4112 14.8225 0.0249 Constraint 241 1084 4.9253 6.1567 12.3134 0.0249 Constraint 241 876 5.3743 6.7179 13.4357 0.0249 Constraint 241 639 3.7148 4.6436 9.2871 0.0249 Constraint 241 608 5.9728 7.4661 14.9321 0.0249 Constraint 233 1014 5.7449 7.1811 14.3622 0.0249 Constraint 233 884 4.5464 5.6831 11.3661 0.0249 Constraint 233 876 5.2286 6.5358 13.0715 0.0249 Constraint 227 698 6.3029 7.8786 15.7572 0.0249 Constraint 222 1092 5.7812 7.2265 14.4530 0.0249 Constraint 216 1117 5.2053 6.5067 13.0133 0.0249 Constraint 216 1092 5.2073 6.5092 13.0184 0.0249 Constraint 216 1068 5.4893 6.8616 13.7233 0.0249 Constraint 216 706 5.9020 7.3774 14.7549 0.0249 Constraint 208 1100 5.5516 6.9395 13.8790 0.0249 Constraint 208 1084 6.2879 7.8599 15.7198 0.0249 Constraint 208 1068 5.7877 7.2346 14.4693 0.0249 Constraint 208 706 5.9022 7.3778 14.7556 0.0249 Constraint 189 1117 3.5096 4.3870 8.7740 0.0249 Constraint 189 892 4.8466 6.0582 12.1165 0.0249 Constraint 189 884 3.9800 4.9751 9.9501 0.0249 Constraint 180 1382 5.7628 7.2035 14.4071 0.0249 Constraint 180 1117 5.9263 7.4078 14.8157 0.0249 Constraint 164 521 5.8029 7.2536 14.5072 0.0249 Constraint 154 1117 5.6928 7.1160 14.2319 0.0249 Constraint 154 1014 5.5815 6.9769 13.9537 0.0249 Constraint 145 1014 4.3671 5.4589 10.9178 0.0249 Constraint 136 1046 5.7652 7.2065 14.4129 0.0249 Constraint 128 876 4.6615 5.8269 11.6538 0.0249 Constraint 121 997 6.2028 7.7535 15.5070 0.0249 Constraint 121 980 6.0107 7.5134 15.0268 0.0249 Constraint 112 1117 6.3396 7.9245 15.8489 0.0249 Constraint 112 848 6.2887 7.8609 15.7217 0.0249 Constraint 112 487 4.5445 5.6807 11.3613 0.0249 Constraint 104 1077 3.3491 4.1864 8.3727 0.0249 Constraint 104 997 4.3550 5.4437 10.8874 0.0249 Constraint 91 1109 5.7782 7.2227 14.4454 0.0249 Constraint 91 1100 6.1111 7.6389 15.2778 0.0249 Constraint 91 968 5.8097 7.2621 14.5241 0.0249 Constraint 82 222 5.6914 7.1143 14.2285 0.0249 Constraint 77 1059 5.1839 6.4798 12.9597 0.0249 Constraint 77 1046 5.5993 6.9991 13.9982 0.0249 Constraint 77 241 4.0730 5.0913 10.1826 0.0249 Constraint 66 1059 5.6565 7.0706 14.1412 0.0249 Constraint 47 706 5.7333 7.1667 14.3333 0.0249 Constraint 39 1720 4.7844 5.9805 11.9609 0.0249 Constraint 39 274 4.3422 5.4278 10.8556 0.0249 Constraint 39 263 6.0225 7.5281 15.0562 0.0249 Constraint 33 1054 5.8641 7.3301 14.6602 0.0249 Constraint 33 1022 5.1157 6.3946 12.7892 0.0249 Constraint 33 256 4.4243 5.5304 11.0608 0.0249 Constraint 18 1720 4.9174 6.1468 12.2936 0.0249 Constraint 18 1714 5.5772 6.9715 13.9430 0.0249 Constraint 18 1703 4.9429 6.1786 12.3573 0.0249 Constraint 18 1692 5.5569 6.9461 13.8922 0.0249 Constraint 11 1059 5.6169 7.0211 14.0423 0.0249 Constraint 3 1301 4.7814 5.9768 11.9535 0.0249 Constraint 1117 1438 4.5097 5.6372 11.2743 0.0230 Constraint 980 1541 6.3744 7.9680 15.9361 0.0230 Constraint 698 1649 6.1437 7.6796 15.3591 0.0230 Constraint 650 1556 6.2516 7.8145 15.6291 0.0230 Constraint 650 818 5.3248 6.6561 13.3121 0.0230 Constraint 510 1657 5.6626 7.0782 14.1564 0.0230 Constraint 487 1657 5.7273 7.1591 14.3182 0.0230 Constraint 466 1575 6.1356 7.6695 15.3391 0.0230 Constraint 466 1567 6.1988 7.7485 15.4969 0.0230 Constraint 448 1603 4.9489 6.1862 12.3724 0.0230 Constraint 448 1575 6.1563 7.6954 15.3907 0.0230 Constraint 443 1603 4.4214 5.5267 11.0535 0.0230 Constraint 443 1567 5.9895 7.4868 14.9736 0.0230 Constraint 435 756 4.2195 5.2744 10.5488 0.0230 Constraint 435 722 5.5244 6.9055 13.8111 0.0230 Constraint 421 1603 5.8748 7.3435 14.6871 0.0230 Constraint 392 1714 4.3768 5.4709 10.9419 0.0230 Constraint 392 1683 5.6434 7.0543 14.1085 0.0230 Constraint 384 731 5.6132 7.0165 14.0330 0.0230 Constraint 375 530 4.1816 5.2270 10.4539 0.0230 Constraint 368 1714 3.9493 4.9366 9.8732 0.0230 Constraint 368 630 5.5110 6.8888 13.7776 0.0230 Constraint 347 630 5.6179 7.0224 14.0447 0.0230 Constraint 347 510 4.6537 5.8171 11.6342 0.0230 Constraint 325 623 4.5445 5.6806 11.3612 0.0230 Constraint 274 630 5.8812 7.3514 14.7029 0.0230 Constraint 256 623 4.9124 6.1405 12.2810 0.0230 Constraint 256 616 4.0494 5.0618 10.1236 0.0230 Constraint 249 1692 3.7746 4.7183 9.4366 0.0230 Constraint 249 1519 4.6326 5.7907 11.5815 0.0230 Constraint 249 616 5.5089 6.8861 13.7722 0.0230 Constraint 227 1541 3.9229 4.9036 9.8073 0.0230 Constraint 227 1533 4.5611 5.7014 11.4028 0.0230 Constraint 222 1526 4.7286 5.9108 11.8215 0.0230 Constraint 208 363 4.1990 5.2487 10.4975 0.0230 Constraint 196 1739 5.0110 6.2637 12.5275 0.0230 Constraint 180 479 4.6056 5.7570 11.5139 0.0230 Constraint 172 623 4.2819 5.3523 10.7047 0.0230 Constraint 172 616 5.3021 6.6276 13.2552 0.0230 Constraint 154 457 5.3961 6.7451 13.4901 0.0230 Constraint 112 616 5.3882 6.7353 13.4706 0.0230 Constraint 82 623 4.7459 5.9324 11.8647 0.0230 Constraint 33 616 5.3945 6.7431 13.4862 0.0230 Constraint 3 121 4.8820 6.1025 12.2051 0.0230 Constraint 3 112 5.5944 6.9931 13.9861 0.0230 Constraint 1662 1764 4.6934 5.8667 11.7334 0.0226 Constraint 1662 1756 5.8379 7.2974 14.5949 0.0226 Constraint 1657 1756 4.5813 5.7266 11.4532 0.0226 Constraint 1438 1777 5.7851 7.2314 14.4629 0.0226 Constraint 1427 1748 5.6525 7.0657 14.1314 0.0226 Constraint 1399 1777 6.2360 7.7951 15.5901 0.0226 Constraint 1399 1720 5.5819 6.9774 13.9547 0.0226 Constraint 997 1158 5.9121 7.3902 14.7803 0.0226 Constraint 963 1158 3.7821 4.7276 9.4552 0.0226 Constraint 963 1068 5.2180 6.5225 13.0450 0.0226 Constraint 955 1351 5.3243 6.6554 13.3109 0.0226 Constraint 930 1204 5.5183 6.8979 13.7958 0.0226 Constraint 913 1455 6.1950 7.7438 15.4875 0.0226 Constraint 899 1391 4.6815 5.8518 11.7037 0.0226 Constraint 899 1246 5.3369 6.6711 13.3423 0.0226 Constraint 892 1455 4.6909 5.8636 11.7271 0.0226 Constraint 892 1301 5.7967 7.2459 14.4918 0.0226 Constraint 892 1276 6.3654 7.9567 15.9135 0.0226 Constraint 892 1246 6.2541 7.8177 15.6353 0.0226 Constraint 818 1479 6.1576 7.6970 15.3941 0.0226 Constraint 808 1670 4.2819 5.3523 10.7047 0.0226 Constraint 808 1494 6.3256 7.9070 15.8140 0.0226 Constraint 808 1471 2.0512 2.5641 5.1281 0.0226 Constraint 800 1479 5.4972 6.8715 13.7430 0.0226 Constraint 792 1479 6.1181 7.6477 15.2953 0.0226 Constraint 783 1494 6.2952 7.8690 15.7380 0.0226 Constraint 783 1479 4.9497 6.1871 12.3743 0.0226 Constraint 783 1471 4.0243 5.0304 10.0608 0.0226 Constraint 783 1358 5.1989 6.4986 12.9973 0.0226 Constraint 778 1611 6.2577 7.8222 15.6444 0.0226 Constraint 778 1471 5.6559 7.0699 14.1397 0.0226 Constraint 778 1399 6.3187 7.8984 15.7968 0.0226 Constraint 769 1343 5.9603 7.4504 14.9008 0.0226 Constraint 769 1334 4.4494 5.5617 11.1234 0.0226 Constraint 748 1662 4.7618 5.9523 11.9046 0.0226 Constraint 739 1479 4.9603 6.2004 12.4008 0.0226 Constraint 739 1455 5.9114 7.3893 14.7786 0.0226 Constraint 731 1603 5.5740 6.9675 13.9351 0.0226 Constraint 731 1575 6.3029 7.8786 15.7572 0.0226 Constraint 731 1567 5.6565 7.0707 14.1413 0.0226 Constraint 731 1427 6.0124 7.5155 15.0309 0.0226 Constraint 706 1447 4.0630 5.0787 10.1574 0.0226 Constraint 639 1657 5.2071 6.5088 13.0177 0.0226 Constraint 564 1471 5.7346 7.1682 14.3364 0.0226 Constraint 564 1382 6.1760 7.7200 15.4401 0.0226 Constraint 557 1471 4.5949 5.7436 11.4873 0.0226 Constraint 538 1471 5.7123 7.1404 14.2807 0.0226 Constraint 538 1466 6.3353 7.9191 15.8382 0.0226 Constraint 510 1117 5.9049 7.3812 14.7623 0.0226 Constraint 510 1109 6.2066 7.7582 15.5164 0.0226 Constraint 510 988 4.4288 5.5359 11.0719 0.0226 Constraint 510 980 3.8277 4.7846 9.5693 0.0226 Constraint 501 1503 5.8087 7.2609 14.5218 0.0226 Constraint 501 1494 5.2734 6.5917 13.1834 0.0226 Constraint 501 1471 5.4150 6.7688 13.5375 0.0226 Constraint 493 1533 6.3137 7.8921 15.7843 0.0226 Constraint 493 1455 4.4572 5.5715 11.1431 0.0226 Constraint 487 1479 6.1306 7.6633 15.3266 0.0226 Constraint 479 988 4.8684 6.0855 12.1710 0.0226 Constraint 448 1657 5.7646 7.2057 14.4115 0.0226 Constraint 448 1059 5.4395 6.7993 13.5987 0.0226 Constraint 443 1117 5.7779 7.2223 14.4447 0.0226 Constraint 443 1092 6.3159 7.8949 15.7899 0.0226 Constraint 429 1657 3.2317 4.0396 8.0793 0.0226 Constraint 429 1649 5.0606 6.3258 12.6516 0.0226 Constraint 421 1657 5.2061 6.5076 13.0151 0.0226 Constraint 392 1657 4.8724 6.0905 12.1811 0.0226 Constraint 392 1649 3.1126 3.8907 7.7814 0.0226 Constraint 392 1634 5.1312 6.4141 12.8281 0.0226 Constraint 392 1620 6.2763 7.8454 15.6908 0.0226 Constraint 368 1649 5.2338 6.5422 13.0845 0.0226 Constraint 363 1649 6.0046 7.5058 15.0115 0.0226 Constraint 333 448 4.2486 5.3107 10.6215 0.0226 Constraint 314 1084 5.9444 7.4305 14.8609 0.0226 Constraint 314 930 4.4374 5.5468 11.0936 0.0226 Constraint 314 908 5.8734 7.3418 14.6835 0.0226 Constraint 314 466 6.2080 7.7600 15.5200 0.0226 Constraint 306 1471 5.6826 7.1033 14.2065 0.0226 Constraint 299 1479 6.3407 7.9258 15.8517 0.0226 Constraint 299 1471 5.6666 7.0833 14.1666 0.0226 Constraint 299 1008 6.2896 7.8619 15.7239 0.0226 Constraint 299 457 5.9327 7.4159 14.8317 0.0226 Constraint 299 435 4.3913 5.4891 10.9782 0.0226 Constraint 294 1471 4.5528 5.6909 11.3819 0.0226 Constraint 294 937 5.4083 6.7603 13.5206 0.0226 Constraint 294 487 5.8575 7.3218 14.6436 0.0226 Constraint 294 479 5.0555 6.3194 12.6388 0.0226 Constraint 294 457 4.7030 5.8788 11.7575 0.0226 Constraint 285 1068 3.6761 4.5951 9.1902 0.0226 Constraint 285 1046 4.3688 5.4610 10.9220 0.0226 Constraint 274 1092 5.6782 7.0978 14.1956 0.0226 Constraint 263 980 4.4150 5.5187 11.0374 0.0226 Constraint 263 930 5.8923 7.3654 14.7308 0.0226 Constraint 256 963 5.7314 7.1642 14.3285 0.0226 Constraint 249 1596 5.8148 7.2685 14.5370 0.0226 Constraint 249 1068 4.7536 5.9420 11.8840 0.0226 Constraint 249 1046 6.1579 7.6973 15.3947 0.0226 Constraint 241 1556 3.8498 4.8123 9.6246 0.0226 Constraint 241 1494 4.8931 6.1164 12.2329 0.0226 Constraint 241 1471 4.6084 5.7605 11.5211 0.0226 Constraint 233 1533 3.6247 4.5309 9.0618 0.0226 Constraint 233 1526 4.6380 5.7974 11.5949 0.0226 Constraint 233 1008 4.7283 5.9104 11.8208 0.0226 Constraint 233 314 4.5880 5.7350 11.4701 0.0226 Constraint 227 1149 6.3300 7.9125 15.8249 0.0226 Constraint 227 1141 3.5888 4.4860 8.9720 0.0226 Constraint 227 1117 5.8691 7.3363 14.6726 0.0226 Constraint 227 429 5.9443 7.4303 14.8607 0.0226 Constraint 222 1567 5.2295 6.5369 13.0738 0.0226 Constraint 222 1556 6.2569 7.8211 15.6423 0.0226 Constraint 222 1100 5.7504 7.1880 14.3761 0.0226 Constraint 222 572 5.6244 7.0305 14.0609 0.0226 Constraint 216 572 3.0699 3.8373 7.6746 0.0226 Constraint 208 1149 5.6227 7.0283 14.0567 0.0226 Constraint 208 1141 4.6974 5.8718 11.7435 0.0226 Constraint 208 549 5.3808 6.7260 13.4519 0.0226 Constraint 208 457 5.8337 7.2921 14.5842 0.0226 Constraint 196 1596 4.2507 5.3133 10.6267 0.0226 Constraint 196 1587 6.3905 7.9882 15.9763 0.0226 Constraint 196 1567 4.8633 6.0791 12.1583 0.0226 Constraint 196 1556 3.8407 4.8009 9.6017 0.0226 Constraint 196 579 6.2654 7.8318 15.6636 0.0226 Constraint 180 1141 4.5959 5.7449 11.4899 0.0226 Constraint 172 1556 5.9771 7.4714 14.9428 0.0226 Constraint 164 1587 4.8113 6.0142 12.0283 0.0226 Constraint 164 1548 5.8117 7.2646 14.5293 0.0226 Constraint 164 1141 5.6963 7.1203 14.2407 0.0226 Constraint 145 1260 6.1130 7.6413 15.2826 0.0226 Constraint 145 1228 5.7883 7.2353 14.4707 0.0226 Constraint 145 1035 6.0845 7.6056 15.2112 0.0226 Constraint 136 1556 6.3251 7.9064 15.8128 0.0226 Constraint 128 1620 6.0731 7.5914 15.1828 0.0226 Constraint 128 1596 5.4138 6.7673 13.5346 0.0226 Constraint 128 1556 5.0854 6.3568 12.7135 0.0226 Constraint 128 1141 5.3885 6.7356 13.4713 0.0226 Constraint 121 1556 6.0612 7.5765 15.1529 0.0226 Constraint 121 1526 5.6659 7.0824 14.1648 0.0226 Constraint 121 1193 4.7244 5.9054 11.8109 0.0226 Constraint 121 1008 5.9291 7.4113 14.8227 0.0226 Constraint 112 630 5.6400 7.0500 14.1000 0.0226 Constraint 112 623 4.7214 5.9018 11.8035 0.0226 Constraint 104 1239 4.6910 5.8637 11.7274 0.0226 Constraint 104 657 5.1738 6.4672 12.9344 0.0226 Constraint 97 1220 5.8471 7.3089 14.6177 0.0226 Constraint 97 1204 3.5022 4.3777 8.7555 0.0226 Constraint 97 241 5.1504 6.4380 12.8760 0.0226 Constraint 91 1193 5.8355 7.2944 14.5888 0.0226 Constraint 82 1228 6.0148 7.5185 15.0371 0.0226 Constraint 82 657 5.1696 6.4620 12.9241 0.0226 Constraint 82 650 3.8383 4.7978 9.5957 0.0226 Constraint 77 1251 4.8034 6.0043 12.0086 0.0226 Constraint 77 1228 3.0477 3.8096 7.6191 0.0226 Constraint 77 1193 6.2755 7.8443 15.6887 0.0226 Constraint 77 208 6.1491 7.6864 15.3728 0.0226 Constraint 77 172 6.0159 7.5198 15.0396 0.0226 Constraint 66 1284 6.0596 7.5745 15.1491 0.0226 Constraint 66 1260 5.5098 6.8872 13.7745 0.0226 Constraint 66 1251 4.5716 5.7145 11.4291 0.0226 Constraint 66 1193 5.8392 7.2990 14.5979 0.0226 Constraint 66 1035 6.2710 7.8388 15.6776 0.0226 Constraint 66 650 4.5734 5.7168 11.4336 0.0226 Constraint 47 1399 6.0750 7.5937 15.1874 0.0226 Constraint 47 1260 5.4682 6.8353 13.6706 0.0226 Constraint 47 1251 4.5204 5.6505 11.3010 0.0226 Constraint 47 1228 5.1073 6.3842 12.7683 0.0226 Constraint 47 650 4.5995 5.7493 11.4986 0.0226 Constraint 18 1030 6.0271 7.5339 15.0678 0.0226 Constraint 1541 1788 6.0829 7.6036 15.2072 0.0217 Constraint 1374 1788 4.7215 5.9019 11.8038 0.0217 Constraint 1239 1720 3.8272 4.7841 9.5681 0.0217 Constraint 1228 1587 6.1717 7.7147 15.4293 0.0217 Constraint 1204 1678 4.4781 5.5977 11.1954 0.0217 Constraint 1204 1567 2.8931 3.6163 7.2327 0.0217 Constraint 1178 1748 4.7032 5.8790 11.7579 0.0217 Constraint 1178 1657 4.2580 5.3225 10.6451 0.0217 Constraint 1167 1748 3.5885 4.4856 8.9712 0.0217 Constraint 1167 1739 5.2151 6.5189 13.0378 0.0217 Constraint 1149 1657 5.6829 7.1036 14.2072 0.0217 Constraint 1149 1455 4.9056 6.1320 12.2640 0.0217 Constraint 1141 1587 4.4819 5.6024 11.2048 0.0217 Constraint 1141 1466 4.8425 6.0531 12.1062 0.0217 Constraint 1125 1748 4.7481 5.9351 11.8701 0.0217 Constraint 1117 1739 5.2188 6.5235 13.0471 0.0217 Constraint 1117 1587 5.0902 6.3628 12.7255 0.0217 Constraint 1092 1756 3.7898 4.7373 9.4746 0.0217 Constraint 1092 1466 5.3319 6.6649 13.3298 0.0217 Constraint 1068 1748 5.8402 7.3003 14.6006 0.0217 Constraint 1046 1748 4.5156 5.6445 11.2891 0.0217 Constraint 1035 1611 4.2053 5.2566 10.5133 0.0217 Constraint 1022 1788 4.9989 6.2487 12.4974 0.0217 Constraint 1022 1772 5.0027 6.2534 12.5068 0.0217 Constraint 1022 1764 4.0190 5.0238 10.0476 0.0217 Constraint 1014 1519 4.8005 6.0007 12.0013 0.0217 Constraint 1008 1788 5.7649 7.2061 14.4122 0.0217 Constraint 988 1519 6.2504 7.8130 15.6261 0.0217 Constraint 980 1756 5.1393 6.4241 12.8481 0.0217 Constraint 963 1720 4.8019 6.0023 12.0047 0.0217 Constraint 963 1309 6.0390 7.5488 15.0975 0.0217 Constraint 930 1301 5.0751 6.3439 12.6878 0.0217 Constraint 921 1301 6.1139 7.6423 15.2846 0.0217 Constraint 913 1014 4.3017 5.3771 10.7542 0.0217 Constraint 908 1620 6.3033 7.8791 15.7582 0.0217 Constraint 899 1358 5.9678 7.4597 14.9194 0.0217 Constraint 899 1343 3.4551 4.3188 8.6376 0.0217 Constraint 899 1301 3.4550 4.3188 8.6376 0.0217 Constraint 876 1358 6.0991 7.6239 15.2478 0.0217 Constraint 876 1325 5.4136 6.7670 13.5339 0.0217 Constraint 868 1358 3.9981 4.9976 9.9952 0.0217 Constraint 868 1343 6.3148 7.8935 15.7869 0.0217 Constraint 868 1309 6.2407 7.8009 15.6017 0.0217 Constraint 748 1125 6.0474 7.5593 15.1186 0.0217 Constraint 748 988 5.9356 7.4195 14.8391 0.0217 Constraint 690 955 5.8312 7.2889 14.5779 0.0217 Constraint 681 1084 4.5590 5.6988 11.3975 0.0217 Constraint 657 921 4.7602 5.9503 11.9006 0.0217 Constraint 650 921 5.0507 6.3133 12.6267 0.0217 Constraint 630 1325 5.1363 6.4204 12.8407 0.0217 Constraint 630 955 6.1124 7.6405 15.2810 0.0217 Constraint 616 1141 6.3428 7.9285 15.8570 0.0217 Constraint 608 1634 6.3796 7.9745 15.9490 0.0217 Constraint 608 1325 3.2396 4.0494 8.0989 0.0217 Constraint 597 1351 5.6201 7.0251 14.0501 0.0217 Constraint 597 1325 5.1011 6.3763 12.7527 0.0217 Constraint 597 1059 4.4803 5.6003 11.2007 0.0217 Constraint 597 800 4.4439 5.5549 11.1097 0.0217 Constraint 597 778 5.2219 6.5274 13.0548 0.0217 Constraint 589 980 4.8284 6.0355 12.0711 0.0217 Constraint 589 944 4.8459 6.0574 12.1147 0.0217 Constraint 579 1777 6.3120 7.8900 15.7800 0.0217 Constraint 579 1748 6.3004 7.8755 15.7509 0.0217 Constraint 579 1351 5.9448 7.4309 14.8619 0.0217 Constraint 572 1788 6.3045 7.8806 15.7612 0.0217 Constraint 572 1777 3.8227 4.7784 9.5568 0.0217 Constraint 572 1756 6.2435 7.8043 15.6087 0.0217 Constraint 572 955 5.0564 6.3206 12.6411 0.0217 Constraint 557 1657 3.7089 4.6361 9.2722 0.0217 Constraint 557 1634 5.4044 6.7555 13.5110 0.0217 Constraint 557 1366 5.6029 7.0036 14.0072 0.0217 Constraint 549 1788 5.1446 6.4307 12.8614 0.0217 Constraint 549 1777 4.9752 6.2190 12.4380 0.0217 Constraint 549 1764 4.3898 5.4872 10.9744 0.0217 Constraint 549 1756 4.9042 6.1303 12.2606 0.0217 Constraint 549 1748 4.9842 6.2302 12.4605 0.0217 Constraint 549 1366 5.1613 6.4516 12.9033 0.0217 Constraint 538 1788 4.7536 5.9420 11.8840 0.0217 Constraint 538 1777 6.0345 7.5431 15.0862 0.0217 Constraint 538 1756 4.9794 6.2242 12.4485 0.0217 Constraint 538 955 6.3143 7.8928 15.7856 0.0217 Constraint 530 1149 5.7877 7.2346 14.4693 0.0217 Constraint 521 1649 4.2224 5.2780 10.5561 0.0217 Constraint 510 1756 4.5340 5.6674 11.3349 0.0217 Constraint 487 1204 4.4176 5.5220 11.0439 0.0217 Constraint 487 1193 5.6133 7.0166 14.0333 0.0217 Constraint 479 1059 5.9964 7.4955 14.9910 0.0217 Constraint 479 818 5.9795 7.4743 14.9487 0.0217 Constraint 466 808 3.2011 4.0014 8.0028 0.0217 Constraint 457 1059 3.7360 4.6700 9.3399 0.0217 Constraint 435 800 4.4781 5.5976 11.1953 0.0217 Constraint 403 1343 6.0658 7.5822 15.1644 0.0217 Constraint 392 1374 6.3126 7.8907 15.7814 0.0217 Constraint 392 1343 6.1610 7.7013 15.4026 0.0217 Constraint 384 1399 6.2495 7.8119 15.6238 0.0217 Constraint 384 1366 5.3211 6.6514 13.3027 0.0217 Constraint 384 1343 5.5668 6.9585 13.9170 0.0217 Constraint 375 1408 5.3521 6.6902 13.3804 0.0217 Constraint 375 1399 5.1765 6.4707 12.9413 0.0217 Constraint 375 1374 3.7919 4.7399 9.4797 0.0217 Constraint 375 836 4.4630 5.5787 11.1574 0.0217 Constraint 375 808 5.6103 7.0128 14.0257 0.0217 Constraint 368 1399 4.9299 6.1624 12.3248 0.0217 Constraint 363 1408 5.2474 6.5592 13.1184 0.0217 Constraint 363 1374 3.9288 4.9110 9.8220 0.0217 Constraint 355 1438 6.1799 7.7248 15.4497 0.0217 Constraint 355 1399 4.9396 6.1744 12.3489 0.0217 Constraint 325 1408 5.8692 7.3365 14.6730 0.0217 Constraint 294 769 3.1458 3.9323 7.8645 0.0217 Constraint 263 1260 4.9511 6.1889 12.3778 0.0217 Constraint 263 1239 5.6705 7.0881 14.1762 0.0217 Constraint 256 739 6.1513 7.6891 15.3782 0.0217 Constraint 233 1109 3.9492 4.9366 9.8731 0.0217 Constraint 216 1317 5.5995 6.9994 13.9988 0.0217 Constraint 216 1293 3.9567 4.9459 9.8919 0.0217 Constraint 216 930 5.0346 6.2932 12.5864 0.0217 Constraint 208 1035 5.5301 6.9126 13.8252 0.0217 Constraint 208 1014 4.0934 5.1167 10.2334 0.0217 Constraint 208 876 5.3220 6.6525 13.3050 0.0217 Constraint 208 848 4.8987 6.1233 12.2466 0.0217 Constraint 208 818 4.6876 5.8595 11.7191 0.0217 Constraint 196 848 4.4854 5.6068 11.2135 0.0217 Constraint 196 836 4.4875 5.6094 11.2189 0.0217 Constraint 189 639 5.0617 6.3271 12.6542 0.0217 Constraint 180 1399 4.9672 6.2090 12.4180 0.0217 Constraint 180 1351 6.1009 7.6262 15.2523 0.0217 Constraint 180 1317 4.5990 5.7487 11.4975 0.0217 Constraint 180 980 6.1213 7.6517 15.3033 0.0217 Constraint 172 963 4.7071 5.8838 11.7676 0.0217 Constraint 172 818 3.8810 4.8512 9.7024 0.0217 Constraint 172 808 3.8133 4.7667 9.5333 0.0217 Constraint 154 1351 4.9999 6.2499 12.4998 0.0217 Constraint 145 848 6.2550 7.8187 15.6375 0.0217 Constraint 145 808 5.9189 7.3986 14.7972 0.0217 Constraint 136 848 4.2906 5.3632 10.7264 0.0217 Constraint 136 808 3.8471 4.8089 9.6179 0.0217 Constraint 112 818 4.9736 6.2170 12.4340 0.0217 Constraint 97 1358 6.0311 7.5389 15.0779 0.0217 Constraint 97 1125 6.0311 7.5389 15.0779 0.0217 Constraint 82 800 3.7409 4.6761 9.3522 0.0217 Constraint 77 1503 6.2828 7.8535 15.7069 0.0217 Constraint 77 808 5.1156 6.3945 12.7890 0.0217 Constraint 77 778 5.1234 6.4042 12.8084 0.0217 Constraint 77 769 3.1164 3.8956 7.7911 0.0217 Constraint 66 1358 5.5653 6.9567 13.9134 0.0217 Constraint 66 1125 5.5654 6.9567 13.9134 0.0217 Constraint 66 800 6.3146 7.8933 15.7866 0.0217 Constraint 66 769 6.3095 7.8869 15.7738 0.0217 Constraint 59 572 6.1742 7.7178 15.4356 0.0217 Constraint 47 1471 5.8555 7.3194 14.6388 0.0217 Constraint 47 1358 5.8521 7.3151 14.6302 0.0217 Constraint 47 1125 5.8521 7.3151 14.6302 0.0217 Constraint 47 572 4.6979 5.8724 11.7448 0.0217 Constraint 39 1556 6.3316 7.9146 15.8291 0.0217 Constraint 33 937 3.9905 4.9881 9.9763 0.0217 Constraint 33 572 5.4911 6.8639 13.7278 0.0217 Constraint 25 908 4.5197 5.6496 11.2991 0.0217 Constraint 25 808 5.5414 6.9268 13.8536 0.0217 Constraint 25 778 5.5091 6.8864 13.7728 0.0217 Constraint 25 713 4.0515 5.0644 10.1288 0.0217 Constraint 25 706 2.7544 3.4430 6.8860 0.0217 Constraint 25 557 6.2946 7.8683 15.7365 0.0217 Constraint 18 1358 5.7459 7.1824 14.3647 0.0217 Constraint 18 1351 5.2787 6.5984 13.1967 0.0217 Constraint 18 1158 5.2930 6.6163 13.2326 0.0217 Constraint 18 997 4.1259 5.1573 10.3147 0.0217 Constraint 18 968 4.1346 5.1682 10.3364 0.0217 Constraint 18 706 5.5029 6.8786 13.7572 0.0217 Constraint 18 698 5.8235 7.2794 14.5588 0.0217 Constraint 11 921 5.8482 7.3102 14.6204 0.0217 Constraint 11 908 5.7604 7.2005 14.4009 0.0217 Constraint 1620 1714 6.2995 7.8744 15.7488 0.0206 Constraint 1587 1683 4.6347 5.7934 11.5868 0.0206 Constraint 1494 1714 5.8470 7.3088 14.6175 0.0206 Constraint 1301 1692 6.2133 7.7666 15.5332 0.0206 Constraint 1284 1567 4.5983 5.7479 11.4957 0.0206 Constraint 1268 1575 4.7784 5.9730 11.9461 0.0206 Constraint 1246 1692 5.6291 7.0364 14.0728 0.0206 Constraint 1239 1683 5.7702 7.2127 14.4254 0.0206 Constraint 1204 1777 5.2596 6.5744 13.1489 0.0206 Constraint 1125 1703 6.1290 7.6613 15.3225 0.0206 Constraint 1077 1777 3.5943 4.4929 8.9858 0.0206 Constraint 1059 1488 5.4172 6.7715 13.5431 0.0206 Constraint 1046 1788 5.7283 7.1604 14.3208 0.0206 Constraint 1014 1764 5.4372 6.7965 13.5931 0.0206 Constraint 997 1714 5.7068 7.1336 14.2671 0.0206 Constraint 988 1777 4.1596 5.1995 10.3991 0.0206 Constraint 988 1649 4.1636 5.2045 10.4089 0.0206 Constraint 963 1788 4.6624 5.8280 11.6559 0.0206 Constraint 963 1777 3.7336 4.6670 9.3339 0.0206 Constraint 963 1703 4.2828 5.3534 10.7069 0.0206 Constraint 963 1239 5.1219 6.4023 12.8047 0.0206 Constraint 963 1059 5.2718 6.5897 13.1794 0.0206 Constraint 955 1739 5.7084 7.1355 14.2709 0.0206 Constraint 944 1788 5.7283 7.1604 14.3208 0.0206 Constraint 944 1772 5.8944 7.3680 14.7359 0.0206 Constraint 937 1228 5.3199 6.6499 13.2999 0.0206 Constraint 930 1603 4.7269 5.9087 11.8174 0.0206 Constraint 930 1575 6.1558 7.6947 15.3894 0.0206 Constraint 930 1503 5.1007 6.3759 12.7518 0.0206 Constraint 908 1488 4.9601 6.2001 12.4001 0.0206 Constraint 908 1351 4.1381 5.1726 10.3452 0.0206 Constraint 908 1317 6.0459 7.5574 15.1149 0.0206 Constraint 899 1228 4.8776 6.0970 12.1939 0.0206 Constraint 884 1670 5.1863 6.4829 12.9658 0.0206 Constraint 876 1260 4.3481 5.4352 10.8703 0.0206 Constraint 868 1756 5.2585 6.5731 13.1462 0.0206 Constraint 868 1720 3.1638 3.9547 7.9094 0.0206 Constraint 868 1260 5.4346 6.7932 13.5864 0.0206 Constraint 859 1756 4.1555 5.1944 10.3888 0.0206 Constraint 848 1059 3.3322 4.1653 8.3306 0.0206 Constraint 836 1703 4.1122 5.1402 10.2804 0.0206 Constraint 836 1494 5.7268 7.1584 14.3169 0.0206 Constraint 836 1358 6.2825 7.8531 15.7062 0.0206 Constraint 829 1511 6.0619 7.5774 15.1547 0.0206 Constraint 818 1117 5.1058 6.3822 12.7645 0.0206 Constraint 818 1092 3.6026 4.5032 9.0064 0.0206 Constraint 808 1703 4.3121 5.3902 10.7803 0.0206 Constraint 800 1117 4.9324 6.1655 12.3310 0.0206 Constraint 792 1408 5.5583 6.9479 13.8958 0.0206 Constraint 792 1399 5.4622 6.8278 13.6556 0.0206 Constraint 792 1276 6.2672 7.8340 15.6680 0.0206 Constraint 792 1117 3.0688 3.8360 7.6720 0.0206 Constraint 769 1276 4.3423 5.4279 10.8558 0.0206 Constraint 769 1149 4.5898 5.7372 11.4744 0.0206 Constraint 769 1117 4.9448 6.1810 12.3620 0.0206 Constraint 761 1438 4.4086 5.5107 11.0214 0.0206 Constraint 761 1284 5.4493 6.8116 13.6232 0.0206 Constraint 761 1276 4.4087 5.5109 11.0217 0.0206 Constraint 756 1519 6.1612 7.7014 15.4029 0.0206 Constraint 756 1479 4.7353 5.9191 11.8383 0.0206 Constraint 756 1284 5.4025 6.7531 13.5062 0.0206 Constraint 748 1141 5.0635 6.3293 12.6586 0.0206 Constraint 739 1276 4.2489 5.3111 10.6223 0.0206 Constraint 731 1301 4.8878 6.1097 12.2195 0.0206 Constraint 713 1620 5.2199 6.5249 13.0497 0.0206 Constraint 713 1511 4.6061 5.7576 11.5152 0.0206 Constraint 713 1178 6.3024 7.8780 15.7559 0.0206 Constraint 713 1149 5.9445 7.4306 14.8612 0.0206 Constraint 706 1678 5.9365 7.4207 14.8413 0.0206 Constraint 706 1620 5.8539 7.3173 14.6346 0.0206 Constraint 706 1567 6.2534 7.8167 15.6334 0.0206 Constraint 706 1351 6.3012 7.8764 15.7529 0.0206 Constraint 706 1301 4.8678 6.0847 12.1695 0.0206 Constraint 706 1260 4.7158 5.8947 11.7894 0.0206 Constraint 698 1541 6.2756 7.8445 15.6891 0.0206 Constraint 698 1494 5.1305 6.4132 12.8263 0.0206 Constraint 698 1204 4.5982 5.7478 11.4956 0.0206 Constraint 681 1620 3.7569 4.6961 9.3923 0.0206 Constraint 681 1611 6.2768 7.8460 15.6920 0.0206 Constraint 681 1325 5.9834 7.4793 14.9586 0.0206 Constraint 681 1293 4.9812 6.2265 12.4530 0.0206 Constraint 673 1533 5.8582 7.3228 14.6455 0.0206 Constraint 673 1317 6.2990 7.8737 15.7475 0.0206 Constraint 665 1596 6.1330 7.6662 15.3324 0.0206 Constraint 665 1526 5.8897 7.3621 14.7242 0.0206 Constraint 665 1511 5.9375 7.4219 14.8438 0.0206 Constraint 657 1678 4.0979 5.1223 10.2447 0.0206 Constraint 657 1556 4.9472 6.1840 12.3679 0.0206 Constraint 650 1683 6.3980 7.9975 15.9949 0.0206 Constraint 639 1748 6.0476 7.5595 15.1190 0.0206 Constraint 639 1720 4.1425 5.1781 10.3563 0.0206 Constraint 639 1714 3.8385 4.7981 9.5961 0.0206 Constraint 639 1692 4.3518 5.4397 10.8795 0.0206 Constraint 639 1092 5.9468 7.4335 14.8670 0.0206 Constraint 630 1703 4.2646 5.3308 10.6616 0.0206 Constraint 630 1692 3.8716 4.8395 9.6791 0.0206 Constraint 630 1678 4.1745 5.2181 10.4363 0.0206 Constraint 630 1596 6.1622 7.7028 15.4056 0.0206 Constraint 623 1692 3.8513 4.8141 9.6282 0.0206 Constraint 623 1634 5.7655 7.2069 14.4138 0.0206 Constraint 623 1575 5.9998 7.4997 14.9995 0.0206 Constraint 623 1548 5.9622 7.4528 14.9056 0.0206 Constraint 623 1541 4.7388 5.9235 11.8471 0.0206 Constraint 616 1692 4.3802 5.4752 10.9505 0.0206 Constraint 616 1556 4.8927 6.1159 12.2319 0.0206 Constraint 608 1748 6.0613 7.5766 15.1532 0.0206 Constraint 608 1714 3.9150 4.8938 9.7875 0.0206 Constraint 608 1109 4.4161 5.5201 11.0403 0.0206 Constraint 597 1692 4.8770 6.0963 12.1926 0.0206 Constraint 589 1720 3.9557 4.9447 9.8893 0.0206 Constraint 589 1714 3.9781 4.9726 9.9453 0.0206 Constraint 589 1703 6.3069 7.8836 15.7673 0.0206 Constraint 589 1670 6.1729 7.7162 15.4323 0.0206 Constraint 579 1683 5.5222 6.9027 13.8054 0.0206 Constraint 579 1662 6.2920 7.8650 15.7300 0.0206 Constraint 579 1343 5.8727 7.3408 14.6816 0.0206 Constraint 579 1284 4.3989 5.4986 10.9972 0.0206 Constraint 572 1720 4.3844 5.4805 10.9609 0.0206 Constraint 572 1109 6.0820 7.6025 15.2049 0.0206 Constraint 572 1068 5.0748 6.3435 12.6869 0.0206 Constraint 564 1678 6.2385 7.7981 15.5963 0.0206 Constraint 564 1670 5.3082 6.6352 13.2704 0.0206 Constraint 564 1634 5.8969 7.3712 14.7424 0.0206 Constraint 564 1620 5.2536 6.5670 13.1341 0.0206 Constraint 564 1239 5.2055 6.5069 13.0137 0.0206 Constraint 564 1228 5.1958 6.4947 12.9895 0.0206 Constraint 557 1772 4.7313 5.9142 11.8283 0.0206 Constraint 557 1692 3.8514 4.8142 9.6285 0.0206 Constraint 557 1683 5.3836 6.7295 13.4590 0.0206 Constraint 557 1620 5.8538 7.3173 14.6346 0.0206 Constraint 557 1084 5.0520 6.3150 12.6301 0.0206 Constraint 557 955 4.1621 5.2026 10.4051 0.0206 Constraint 549 1692 4.0847 5.1058 10.2117 0.0206 Constraint 549 955 4.0145 5.0182 10.0364 0.0206 Constraint 538 1678 5.1612 6.4515 12.9030 0.0206 Constraint 538 1077 4.2247 5.2809 10.5617 0.0206 Constraint 530 1720 5.6000 7.0000 14.0000 0.0206 Constraint 530 1692 4.3347 5.4183 10.8366 0.0206 Constraint 530 1683 5.5131 6.8914 13.7828 0.0206 Constraint 530 1678 4.3928 5.4910 10.9820 0.0206 Constraint 530 1670 4.0583 5.0729 10.1458 0.0206 Constraint 530 1611 6.2952 7.8690 15.7380 0.0206 Constraint 521 1260 6.3495 7.9369 15.8737 0.0206 Constraint 521 1030 5.4856 6.8570 13.7140 0.0206 Constraint 521 980 4.8718 6.0897 12.1794 0.0206 Constraint 521 955 4.3239 5.4049 10.8099 0.0206 Constraint 521 921 5.2658 6.5823 13.1645 0.0206 Constraint 510 1748 6.0561 7.5701 15.1402 0.0206 Constraint 510 1720 3.9544 4.9430 9.8860 0.0206 Constraint 510 1714 3.9754 4.9693 9.9385 0.0206 Constraint 510 1703 6.2912 7.8640 15.7280 0.0206 Constraint 501 1683 5.3709 6.7136 13.4272 0.0206 Constraint 501 1678 4.1069 5.1336 10.2672 0.0206 Constraint 501 1649 4.3249 5.4061 10.8122 0.0206 Constraint 501 1634 4.1953 5.2441 10.4883 0.0206 Constraint 501 921 4.3809 5.4761 10.9522 0.0206 Constraint 493 1692 4.0578 5.0723 10.1445 0.0206 Constraint 493 1228 6.2256 7.7820 15.5639 0.0206 Constraint 487 892 4.1331 5.1664 10.3328 0.0206 Constraint 479 1692 4.1720 5.2150 10.4300 0.0206 Constraint 479 1228 5.7344 7.1680 14.3360 0.0206 Constraint 479 1204 5.4905 6.8631 13.7262 0.0206 Constraint 479 1068 5.3120 6.6401 13.2801 0.0206 Constraint 479 884 5.6345 7.0431 14.0862 0.0206 Constraint 479 859 5.5326 6.9157 13.8314 0.0206 Constraint 466 1714 3.9272 4.9090 9.8181 0.0206 Constraint 466 1692 4.2854 5.3568 10.7135 0.0206 Constraint 466 1662 3.9316 4.9145 9.8290 0.0206 Constraint 466 1649 6.2505 7.8131 15.6263 0.0206 Constraint 466 650 6.3967 7.9959 15.9917 0.0206 Constraint 466 639 4.4174 5.5218 11.0435 0.0206 Constraint 457 1022 5.5381 6.9226 13.8452 0.0206 Constraint 457 892 5.5809 6.9762 13.9523 0.0206 Constraint 448 1541 5.4481 6.8102 13.6203 0.0206 Constraint 448 1092 6.2239 7.7799 15.5598 0.0206 Constraint 443 1541 4.5329 5.6662 11.3323 0.0206 Constraint 443 868 4.4068 5.5085 11.0169 0.0206 Constraint 443 639 4.6150 5.7687 11.5375 0.0206 Constraint 435 1228 6.1831 7.7289 15.4577 0.0206 Constraint 435 1213 4.2720 5.3400 10.6800 0.0206 Constraint 435 1204 6.1963 7.7453 15.4906 0.0206 Constraint 435 1030 5.5047 6.8809 13.7617 0.0206 Constraint 435 937 6.1612 7.7015 15.4029 0.0206 Constraint 435 892 4.8731 6.0914 12.1828 0.0206 Constraint 429 1213 6.0721 7.5901 15.1802 0.0206 Constraint 429 921 6.3910 7.9887 15.9775 0.0206 Constraint 429 892 4.1331 5.1664 10.3328 0.0206 Constraint 429 673 6.0240 7.5300 15.0601 0.0206 Constraint 421 1777 5.3982 6.7477 13.4955 0.0206 Constraint 412 1788 6.1922 7.7403 15.4805 0.0206 Constraint 412 937 3.4665 4.3332 8.6664 0.0206 Constraint 412 921 5.9586 7.4483 14.8965 0.0206 Constraint 403 1228 5.7421 7.1776 14.3551 0.0206 Constraint 403 892 6.1326 7.6657 15.3315 0.0206 Constraint 392 1220 6.3326 7.9157 15.8314 0.0206 Constraint 392 884 5.4486 6.8107 13.6214 0.0206 Constraint 392 876 6.3157 7.8947 15.7893 0.0206 Constraint 384 1788 4.8798 6.0998 12.1995 0.0206 Constraint 384 1251 5.1895 6.4869 12.9738 0.0206 Constraint 384 1246 6.2981 7.8726 15.7453 0.0206 Constraint 384 1228 5.4209 6.7762 13.5523 0.0206 Constraint 384 1220 3.5604 4.4505 8.9010 0.0206 Constraint 375 1788 4.7438 5.9297 11.8595 0.0206 Constraint 375 1343 4.8561 6.0701 12.1402 0.0206 Constraint 375 1125 6.2608 7.8260 15.6519 0.0206 Constraint 368 1343 4.3319 5.4149 10.8299 0.0206 Constraint 368 1220 5.3171 6.6464 13.2927 0.0206 Constraint 363 963 6.1481 7.6851 15.3703 0.0206 Constraint 355 1788 5.0196 6.2745 12.5489 0.0206 Constraint 355 1158 3.9014 4.8768 9.7535 0.0206 Constraint 355 1149 5.4478 6.8097 13.6194 0.0206 Constraint 347 1149 6.3919 7.9899 15.9797 0.0206 Constraint 325 876 3.0593 3.8242 7.6484 0.0206 Constraint 325 778 4.6679 5.8349 11.6698 0.0206 Constraint 325 589 5.5800 6.9750 13.9500 0.0206 Constraint 314 1178 3.9762 4.9702 9.9404 0.0206 Constraint 314 549 6.0248 7.5309 15.0619 0.0206 Constraint 294 1408 6.1172 7.6465 15.2929 0.0206 Constraint 285 549 3.4437 4.3046 8.6091 0.0206 Constraint 263 1447 4.9316 6.1645 12.3290 0.0206 Constraint 256 1447 4.4226 5.5282 11.0564 0.0206 Constraint 256 876 6.2754 7.8442 15.6884 0.0206 Constraint 256 713 4.7226 5.9032 11.8065 0.0206 Constraint 249 876 4.9311 6.1639 12.3278 0.0206 Constraint 249 681 5.9839 7.4798 14.9596 0.0206 Constraint 249 665 5.9256 7.4070 14.8141 0.0206 Constraint 249 657 4.5165 5.6457 11.2913 0.0206 Constraint 227 876 5.7790 7.2238 14.4476 0.0206 Constraint 222 1382 4.8952 6.1189 12.2379 0.0206 Constraint 208 1022 5.9721 7.4651 14.9303 0.0206 Constraint 180 1366 6.3106 7.8882 15.7764 0.0206 Constraint 180 487 4.5222 5.6528 11.3055 0.0206 Constraint 180 368 5.0910 6.3637 12.7275 0.0206 Constraint 172 1220 5.1197 6.3996 12.7991 0.0206 Constraint 154 1488 4.4986 5.6232 11.2464 0.0206 Constraint 121 1125 5.1341 6.4176 12.8352 0.0206 Constraint 112 429 6.2163 7.7703 15.5407 0.0206 Constraint 104 930 3.5590 4.4488 8.8976 0.0206 Constraint 104 429 4.8765 6.0956 12.1912 0.0206 Constraint 82 778 6.2822 7.8528 15.7056 0.0206 Constraint 82 429 5.7436 7.1794 14.3589 0.0206 Constraint 66 448 5.1749 6.4686 12.9372 0.0206 Constraint 59 778 5.1813 6.4766 12.9532 0.0206 Constraint 39 347 5.2988 6.6234 13.2469 0.0206 Constraint 1678 1764 3.4749 4.3437 8.6873 0.0196 Constraint 1620 1692 4.8671 6.0839 12.1678 0.0196 Constraint 1587 1748 4.7947 5.9933 11.9867 0.0196 Constraint 1575 1772 5.0891 6.3614 12.7228 0.0196 Constraint 1575 1748 3.0527 3.8159 7.6317 0.0196 Constraint 1567 1683 6.2984 7.8730 15.7460 0.0196 Constraint 1556 1714 3.6408 4.5510 9.1020 0.0196 Constraint 1548 1692 4.2738 5.3423 10.6845 0.0196 Constraint 1541 1714 5.8344 7.2929 14.5859 0.0196 Constraint 1541 1662 3.6551 4.5689 9.1379 0.0196 Constraint 1533 1739 3.6423 4.5529 9.1057 0.0196 Constraint 1533 1714 3.9961 4.9951 9.9901 0.0196 Constraint 1533 1670 5.1208 6.4010 12.8020 0.0196 Constraint 1526 1670 2.6906 3.3633 6.7265 0.0196 Constraint 1503 1620 5.5923 6.9903 13.9807 0.0196 Constraint 1494 1678 2.8449 3.5561 7.1123 0.0196 Constraint 1494 1657 5.9937 7.4921 14.9841 0.0196 Constraint 1479 1662 4.6873 5.8591 11.7182 0.0196 Constraint 1471 1748 6.0085 7.5107 15.0213 0.0196 Constraint 1471 1714 5.0228 6.2785 12.5570 0.0196 Constraint 1471 1692 5.7957 7.2446 14.4891 0.0196 Constraint 1447 1714 6.3393 7.9242 15.8483 0.0196 Constraint 1447 1692 6.2194 7.7742 15.5484 0.0196 Constraint 1438 1703 6.3060 7.8825 15.7650 0.0196 Constraint 1427 1670 5.4109 6.7636 13.5272 0.0196 Constraint 1416 1748 6.3709 7.9636 15.9272 0.0196 Constraint 1416 1714 5.6492 7.0616 14.1231 0.0196 Constraint 1391 1714 4.0687 5.0859 10.1718 0.0196 Constraint 1382 1714 5.0850 6.3562 12.7124 0.0196 Constraint 1374 1511 5.5092 6.8865 13.7731 0.0196 Constraint 1343 1511 4.8675 6.0844 12.1687 0.0196 Constraint 1343 1479 5.5179 6.8974 13.7948 0.0196 Constraint 1343 1438 6.3841 7.9801 15.9602 0.0196 Constraint 1325 1519 6.0664 7.5831 15.1661 0.0196 Constraint 1325 1511 4.6439 5.8049 11.6098 0.0196 Constraint 1301 1548 4.9995 6.2494 12.4988 0.0196 Constraint 1301 1541 3.0791 3.8489 7.6977 0.0196 Constraint 1301 1533 3.4956 4.3695 8.7389 0.0196 Constraint 1301 1526 5.2805 6.6006 13.2012 0.0196 Constraint 1301 1519 6.3339 7.9174 15.8348 0.0196 Constraint 1301 1511 5.3585 6.6982 13.3963 0.0196 Constraint 1301 1488 4.8820 6.1025 12.2050 0.0196 Constraint 1284 1533 5.9374 7.4217 14.8434 0.0196 Constraint 1276 1548 5.6411 7.0514 14.1027 0.0196 Constraint 1276 1533 5.7454 7.1818 14.3635 0.0196 Constraint 1276 1519 4.1382 5.1728 10.3456 0.0196 Constraint 1268 1596 5.4487 6.8109 13.6218 0.0196 Constraint 1251 1466 5.9815 7.4768 14.9537 0.0196 Constraint 1246 1596 3.8640 4.8300 9.6600 0.0196 Constraint 1167 1293 4.9211 6.1513 12.3026 0.0196 Constraint 1149 1479 6.2126 7.7657 15.5314 0.0196 Constraint 1149 1399 5.8634 7.3293 14.6586 0.0196 Constraint 1149 1284 3.1747 3.9684 7.9368 0.0196 Constraint 1141 1366 4.8810 6.1013 12.2025 0.0196 Constraint 1141 1309 4.8634 6.0793 12.1586 0.0196 Constraint 1133 1391 5.2964 6.6205 13.2410 0.0196 Constraint 1125 1556 6.1814 7.7268 15.4536 0.0196 Constraint 1125 1317 5.9869 7.4836 14.9672 0.0196 Constraint 1125 1309 4.0049 5.0061 10.0121 0.0196 Constraint 1092 1556 5.6555 7.0694 14.1387 0.0196 Constraint 1092 1526 4.1324 5.1655 10.3311 0.0196 Constraint 1092 1399 5.0007 6.2509 12.5017 0.0196 Constraint 1068 1526 6.2946 7.8682 15.7365 0.0196 Constraint 1068 1511 4.7270 5.9088 11.8176 0.0196 Constraint 1035 1125 6.1402 7.6753 15.3506 0.0196 Constraint 1014 1309 4.9281 6.1602 12.3204 0.0196 Constraint 988 1220 3.5753 4.4692 8.9384 0.0196 Constraint 968 1220 6.2870 7.8587 15.7174 0.0196 Constraint 944 1035 6.1161 7.6451 15.2902 0.0196 Constraint 913 1077 3.1466 3.9333 7.8666 0.0196 Constraint 913 1068 3.2829 4.1036 8.2072 0.0196 Constraint 848 1117 4.8723 6.0903 12.1806 0.0196 Constraint 706 1587 4.8558 6.0697 12.1394 0.0196 Constraint 706 1427 4.8914 6.1143 12.2286 0.0196 Constraint 706 1399 3.1607 3.9508 7.9017 0.0196 Constraint 706 944 5.8071 7.2589 14.5178 0.0196 Constraint 698 1399 6.2511 7.8138 15.6277 0.0196 Constraint 698 908 2.6894 3.3618 6.7236 0.0196 Constraint 698 899 5.9707 7.4634 14.9268 0.0196 Constraint 690 1391 5.9531 7.4414 14.8827 0.0196 Constraint 690 908 4.4849 5.6061 11.2123 0.0196 Constraint 690 876 4.4904 5.6130 11.2261 0.0196 Constraint 665 1391 6.2998 7.8748 15.7496 0.0196 Constraint 650 1455 5.7204 7.1505 14.3011 0.0196 Constraint 579 1455 6.2601 7.8252 15.6504 0.0196 Constraint 572 892 6.3335 7.9169 15.8337 0.0196 Constraint 564 739 6.0721 7.5902 15.1804 0.0196 Constraint 521 1366 4.2610 5.3263 10.6526 0.0196 Constraint 510 1391 5.3337 6.6672 13.3344 0.0196 Constraint 510 1366 5.6101 7.0126 14.0253 0.0196 Constraint 493 1366 5.1350 6.4187 12.8374 0.0196 Constraint 487 1391 5.5027 6.8784 13.7568 0.0196 Constraint 487 1366 2.9168 3.6460 7.2921 0.0196 Constraint 487 884 2.8615 3.5769 7.1537 0.0196 Constraint 487 769 5.9622 7.4527 14.9054 0.0196 Constraint 487 681 4.2268 5.2834 10.5669 0.0196 Constraint 466 713 3.8101 4.7626 9.5253 0.0196 Constraint 421 639 4.6170 5.7713 11.5426 0.0196 Constraint 412 1541 5.9843 7.4804 14.9607 0.0196 Constraint 412 1466 4.3472 5.4339 10.8679 0.0196 Constraint 403 1541 5.6997 7.1246 14.2492 0.0196 Constraint 403 1479 5.0322 6.2902 12.5805 0.0196 Constraint 403 1471 4.4409 5.5512 11.1024 0.0196 Constraint 403 1466 5.7482 7.1853 14.3705 0.0196 Constraint 403 657 6.2915 7.8644 15.7288 0.0196 Constraint 403 650 5.6547 7.0684 14.1368 0.0196 Constraint 392 1471 4.9292 6.1615 12.3231 0.0196 Constraint 392 657 4.0140 5.0175 10.0350 0.0196 Constraint 384 1541 6.2144 7.7680 15.5360 0.0196 Constraint 384 1466 5.1153 6.3942 12.7883 0.0196 Constraint 368 892 4.6986 5.8732 11.7465 0.0196 Constraint 347 589 4.3064 5.3830 10.7660 0.0196 Constraint 306 579 4.0613 5.0767 10.1533 0.0196 Constraint 306 435 5.1096 6.3870 12.7740 0.0196 Constraint 285 466 4.9788 6.2235 12.4470 0.0196 Constraint 274 435 3.6362 4.5453 9.0906 0.0196 Constraint 249 713 2.8591 3.5738 7.1477 0.0196 Constraint 241 510 4.8409 6.0511 12.1022 0.0196 Constraint 227 748 3.3322 4.1652 8.3304 0.0196 Constraint 227 722 4.9515 6.1894 12.3789 0.0196 Constraint 227 713 5.5622 6.9528 13.9056 0.0196 Constraint 196 713 4.8705 6.0881 12.1761 0.0196 Constraint 189 325 5.8572 7.3214 14.6429 0.0196 Constraint 189 314 5.9096 7.3870 14.7740 0.0196 Constraint 164 681 5.7955 7.2444 14.4888 0.0196 Constraint 154 306 5.5946 6.9933 13.9865 0.0196 Constraint 128 681 5.5251 6.9064 13.8128 0.0196 Constraint 128 479 3.7842 4.7303 9.4606 0.0196 Constraint 128 457 4.5386 5.6732 11.3464 0.0196 Constraint 121 630 5.5626 6.9532 13.9064 0.0196 Constraint 104 457 5.0590 6.3237 12.6474 0.0196 Constraint 97 479 5.5491 6.9364 13.8728 0.0196 Constraint 59 227 6.0492 7.5615 15.1230 0.0196 Constraint 59 180 3.8139 4.7674 9.5347 0.0196 Constraint 33 189 3.5555 4.4443 8.8886 0.0196 Constraint 33 180 2.6140 3.2675 6.5350 0.0196 Constraint 33 164 5.8651 7.3313 14.6627 0.0196 Constraint 25 249 5.2332 6.5415 13.0831 0.0196 Constraint 25 189 6.2805 7.8506 15.7012 0.0196 Constraint 25 180 3.8561 4.8201 9.6403 0.0196 Constraint 18 189 4.1186 5.1482 10.2965 0.0196 Constraint 11 1670 5.3659 6.7074 13.4148 0.0196 Constraint 11 1620 5.6837 7.1046 14.2093 0.0196 Constraint 11 1596 4.4473 5.5592 11.1183 0.0196 Constraint 11 1587 4.5257 5.6572 11.3143 0.0196 Constraint 1670 1764 4.7377 5.9221 11.8443 0.0169 Constraint 1649 1764 4.9676 6.2095 12.4190 0.0169 Constraint 1567 1772 4.0421 5.0526 10.1053 0.0169 Constraint 1556 1772 4.9009 6.1262 12.2523 0.0169 Constraint 1511 1764 5.2433 6.5542 13.1084 0.0169 Constraint 1511 1714 5.7724 7.2154 14.4309 0.0169 Constraint 1511 1620 4.2788 5.3485 10.6969 0.0169 Constraint 1503 1714 4.7569 5.9461 11.8922 0.0169 Constraint 1488 1764 6.2013 7.7516 15.5032 0.0169 Constraint 1471 1772 5.3057 6.6321 13.2642 0.0169 Constraint 1416 1777 4.9191 6.1488 12.2977 0.0169 Constraint 1391 1611 4.5871 5.7339 11.4679 0.0169 Constraint 1374 1494 5.5421 6.9276 13.8552 0.0169 Constraint 1366 1494 3.9389 4.9236 9.8472 0.0169 Constraint 1358 1494 5.8211 7.2764 14.5528 0.0169 Constraint 1343 1466 3.7923 4.7404 9.4808 0.0169 Constraint 1276 1556 6.2717 7.8397 15.6793 0.0169 Constraint 1268 1548 4.5491 5.6863 11.3726 0.0169 Constraint 1260 1603 6.3418 7.9273 15.8546 0.0169 Constraint 1260 1427 5.9457 7.4321 14.8641 0.0169 Constraint 1246 1556 6.0812 7.6014 15.2029 0.0169 Constraint 1246 1541 4.0743 5.0928 10.1857 0.0169 Constraint 1246 1533 4.7563 5.9454 11.8908 0.0169 Constraint 1228 1391 4.5834 5.7292 11.4585 0.0169 Constraint 1213 1662 5.2068 6.5085 13.0171 0.0169 Constraint 1204 1455 5.1784 6.4730 12.9459 0.0169 Constraint 1204 1427 3.9911 4.9889 9.9777 0.0169 Constraint 1193 1662 3.5560 4.4451 8.8901 0.0169 Constraint 1178 1416 5.4663 6.8329 13.6658 0.0169 Constraint 1178 1293 5.5088 6.8860 13.7720 0.0169 Constraint 1167 1309 4.1093 5.1366 10.2733 0.0169 Constraint 1158 1720 5.0025 6.2531 12.5063 0.0169 Constraint 1158 1714 5.0008 6.2510 12.5021 0.0169 Constraint 1149 1541 4.1467 5.1834 10.3668 0.0169 Constraint 1149 1447 5.3661 6.7076 13.4152 0.0169 Constraint 1149 1317 3.5632 4.4540 8.9080 0.0169 Constraint 1141 1358 6.0309 7.5386 15.0771 0.0169 Constraint 1141 1301 6.0309 7.5386 15.0771 0.0169 Constraint 1125 1466 3.2415 4.0519 8.1038 0.0169 Constraint 1117 1777 4.6679 5.8348 11.6696 0.0169 Constraint 1100 1427 4.5989 5.7487 11.4974 0.0169 Constraint 1092 1438 6.0106 7.5132 15.0265 0.0169 Constraint 1092 1408 6.0373 7.5466 15.0932 0.0169 Constraint 1084 1374 5.4674 6.8342 13.6684 0.0169 Constraint 1077 1366 5.0556 6.3195 12.6391 0.0169 Constraint 1014 1575 5.0938 6.3673 12.7346 0.0169 Constraint 1008 1117 6.1015 7.6269 15.2537 0.0169 Constraint 997 1301 3.3911 4.2389 8.4777 0.0169 Constraint 997 1268 3.6899 4.6124 9.2248 0.0169 Constraint 968 1309 5.2005 6.5007 13.0014 0.0169 Constraint 963 1317 5.0532 6.3165 12.6330 0.0169 Constraint 944 1125 3.7305 4.6631 9.3263 0.0169 Constraint 908 1117 6.3893 7.9866 15.9731 0.0169 Constraint 908 1068 3.2722 4.0902 8.1805 0.0169 Constraint 892 1084 5.4587 6.8234 13.6468 0.0169 Constraint 892 1059 6.3470 7.9338 15.8675 0.0169 Constraint 892 1054 4.2581 5.3227 10.6454 0.0169 Constraint 884 1611 5.5933 6.9917 13.9834 0.0169 Constraint 884 1117 6.1155 7.6444 15.2888 0.0169 Constraint 876 1068 4.3994 5.4993 10.9985 0.0169 Constraint 868 1059 6.3872 7.9840 15.9679 0.0169 Constraint 859 1092 6.1307 7.6634 15.3267 0.0169 Constraint 859 1084 3.8661 4.8327 9.6653 0.0169 Constraint 859 1068 4.9174 6.1467 12.2934 0.0169 Constraint 859 963 5.5324 6.9155 13.8309 0.0169 Constraint 848 1670 3.1930 3.9912 7.9824 0.0169 Constraint 848 1657 5.7841 7.2302 14.4604 0.0169 Constraint 848 1455 4.6691 5.8363 11.6727 0.0169 Constraint 848 1246 3.8265 4.7832 9.5664 0.0169 Constraint 848 1068 5.8723 7.3404 14.6807 0.0169 Constraint 836 1084 3.7700 4.7125 9.4250 0.0169 Constraint 836 1068 5.8543 7.3179 14.6357 0.0169 Constraint 829 1662 4.2704 5.3380 10.6761 0.0169 Constraint 829 1657 6.2689 7.8361 15.6723 0.0169 Constraint 818 1125 5.4167 6.7709 13.5417 0.0169 Constraint 818 1100 5.6978 7.1223 14.2446 0.0169 Constraint 800 930 6.1737 7.7171 15.4342 0.0169 Constraint 792 1133 4.5625 5.7031 11.4063 0.0169 Constraint 761 1611 5.6714 7.0892 14.1784 0.0169 Constraint 761 930 5.3971 6.7464 13.4929 0.0169 Constraint 761 913 4.1414 5.1768 10.3536 0.0169 Constraint 761 908 6.3004 7.8755 15.7509 0.0169 Constraint 756 930 6.0441 7.5551 15.1102 0.0169 Constraint 748 1366 4.7636 5.9545 11.9089 0.0169 Constraint 748 930 3.8705 4.8382 9.6763 0.0169 Constraint 748 908 4.8853 6.1066 12.2131 0.0169 Constraint 739 930 3.2451 4.0564 8.1128 0.0169 Constraint 731 1503 5.4919 6.8649 13.7298 0.0169 Constraint 731 1479 4.6245 5.7806 11.5612 0.0169 Constraint 731 1251 5.3680 6.7100 13.4199 0.0169 Constraint 731 884 4.7392 5.9240 11.8480 0.0169 Constraint 722 1479 3.2997 4.1247 8.2493 0.0169 Constraint 713 1366 5.3261 6.6576 13.3151 0.0169 Constraint 713 955 3.8886 4.8608 9.7216 0.0169 Constraint 706 930 6.3996 7.9995 15.9989 0.0169 Constraint 698 1596 4.0925 5.1156 10.2312 0.0169 Constraint 698 1587 4.3698 5.4623 10.9246 0.0169 Constraint 698 1479 4.4723 5.5904 11.1809 0.0169 Constraint 698 1268 6.3447 7.9309 15.8617 0.0169 Constraint 690 1268 4.3309 5.4136 10.8273 0.0169 Constraint 690 1251 5.5258 6.9073 13.8146 0.0169 Constraint 690 1228 4.0957 5.1197 10.2393 0.0169 Constraint 681 1587 4.5265 5.6582 11.3163 0.0169 Constraint 681 1268 5.3279 6.6599 13.3199 0.0169 Constraint 673 1662 3.8424 4.8030 9.6061 0.0169 Constraint 673 1657 4.8713 6.0891 12.1783 0.0169 Constraint 673 1596 5.9949 7.4936 14.9871 0.0169 Constraint 673 1587 3.3613 4.2016 8.4033 0.0169 Constraint 673 1575 6.2983 7.8729 15.7459 0.0169 Constraint 673 1556 3.3702 4.2127 8.4254 0.0169 Constraint 673 1447 5.9930 7.4912 14.9824 0.0169 Constraint 673 1438 3.3307 4.1634 8.3268 0.0169 Constraint 673 1382 5.1378 6.4222 12.8444 0.0169 Constraint 673 761 5.6646 7.0808 14.1616 0.0169 Constraint 665 1662 5.6285 7.0356 14.0712 0.0169 Constraint 665 921 5.5587 6.9484 13.8968 0.0169 Constraint 657 1662 5.4971 6.8714 13.7429 0.0169 Constraint 657 1260 6.2616 7.8270 15.6540 0.0169 Constraint 657 1228 4.7580 5.9475 11.8951 0.0169 Constraint 657 1204 4.9146 6.1432 12.2864 0.0169 Constraint 650 1228 5.5218 6.9022 13.8044 0.0169 Constraint 650 1133 5.7249 7.1561 14.3121 0.0169 Constraint 630 1068 4.4872 5.6090 11.2181 0.0169 Constraint 630 1046 3.2047 4.0059 8.0118 0.0169 Constraint 616 829 5.3016 6.6270 13.2539 0.0169 Constraint 597 792 6.3254 7.9068 15.8135 0.0169 Constraint 597 769 3.8881 4.8601 9.7202 0.0169 Constraint 589 988 6.0967 7.6209 15.2417 0.0169 Constraint 579 1068 5.8549 7.3186 14.6372 0.0169 Constraint 572 1391 4.5963 5.7453 11.4906 0.0169 Constraint 572 1317 4.7242 5.9052 11.8105 0.0169 Constraint 572 1268 5.2434 6.5543 13.1086 0.0169 Constraint 564 930 4.9401 6.1752 12.3503 0.0169 Constraint 564 892 5.5157 6.8947 13.7894 0.0169 Constraint 557 848 6.0792 7.5990 15.1980 0.0169 Constraint 557 836 5.4835 6.8544 13.7088 0.0169 Constraint 557 829 3.6583 4.5729 9.1458 0.0169 Constraint 549 1317 5.8148 7.2685 14.5370 0.0169 Constraint 549 1109 6.2830 7.8537 15.7074 0.0169 Constraint 549 1030 5.7893 7.2366 14.4732 0.0169 Constraint 549 997 5.1123 6.3904 12.7808 0.0169 Constraint 549 829 5.7068 7.1335 14.2669 0.0169 Constraint 538 1391 4.5083 5.6353 11.2707 0.0169 Constraint 538 1382 4.8270 6.0338 12.0676 0.0169 Constraint 538 1374 4.0392 5.0490 10.0981 0.0169 Constraint 538 1351 5.7203 7.1504 14.3008 0.0169 Constraint 538 1317 4.7970 5.9963 11.9926 0.0169 Constraint 538 1301 4.7385 5.9231 11.8463 0.0169 Constraint 538 1059 5.2942 6.6177 13.2354 0.0169 Constraint 538 1054 3.8853 4.8566 9.7132 0.0169 Constraint 521 778 3.9681 4.9601 9.9202 0.0169 Constraint 521 608 5.9269 7.4086 14.8171 0.0169 Constraint 521 597 3.6202 4.5253 9.0505 0.0169 Constraint 510 1548 3.4487 4.3109 8.6218 0.0169 Constraint 510 1541 5.7877 7.2346 14.4693 0.0169 Constraint 510 1519 5.3707 6.7133 13.4267 0.0169 Constraint 510 1334 4.7887 5.9859 11.9718 0.0169 Constraint 510 1301 5.4759 6.8449 13.6898 0.0169 Constraint 510 597 2.9969 3.7461 7.4921 0.0169 Constraint 510 589 2.9072 3.6340 7.2680 0.0169 Constraint 501 1519 6.2618 7.8272 15.6544 0.0169 Constraint 501 1382 5.6586 7.0732 14.1464 0.0169 Constraint 501 761 4.6863 5.8579 11.7158 0.0169 Constraint 493 1541 5.1242 6.4052 12.8104 0.0169 Constraint 493 1519 5.3065 6.6331 13.2663 0.0169 Constraint 493 1511 5.2866 6.6082 13.2164 0.0169 Constraint 493 1488 6.1232 7.6540 15.3080 0.0169 Constraint 493 1479 6.0007 7.5008 15.0016 0.0169 Constraint 493 1471 4.7545 5.9431 11.8863 0.0169 Constraint 493 1334 5.2170 6.5213 13.0425 0.0169 Constraint 493 597 6.2075 7.7594 15.5188 0.0169 Constraint 487 1548 3.2818 4.1023 8.2046 0.0169 Constraint 487 1541 5.7042 7.1303 14.2605 0.0169 Constraint 487 1519 5.1649 6.4561 12.9123 0.0169 Constraint 487 1488 5.1501 6.4376 12.8753 0.0169 Constraint 487 1125 6.0910 7.6137 15.2274 0.0169 Constraint 479 1519 6.0469 7.5586 15.1172 0.0169 Constraint 479 1125 5.8354 7.2942 14.5884 0.0169 Constraint 479 808 5.4895 6.8619 13.7237 0.0169 Constraint 466 1596 5.0646 6.3308 12.6615 0.0169 Constraint 466 1587 5.0648 6.3310 12.6619 0.0169 Constraint 466 1556 5.9336 7.4170 14.8340 0.0169 Constraint 466 1494 6.0358 7.5448 15.0895 0.0169 Constraint 466 1488 5.1653 6.4567 12.9133 0.0169 Constraint 466 597 5.4734 6.8418 13.6836 0.0169 Constraint 466 579 6.2357 7.7947 15.5894 0.0169 Constraint 457 1158 4.0363 5.0454 10.0908 0.0169 Constraint 457 706 5.7143 7.1429 14.2858 0.0169 Constraint 457 650 5.2616 6.5770 13.1540 0.0169 Constraint 457 589 4.0197 5.0246 10.0493 0.0169 Constraint 448 792 4.4564 5.5705 11.1410 0.0169 Constraint 448 608 4.1185 5.1481 10.2962 0.0169 Constraint 443 1494 4.4481 5.5601 11.1202 0.0169 Constraint 443 1479 6.3424 7.9281 15.8561 0.0169 Constraint 443 1366 4.5213 5.6516 11.3032 0.0169 Constraint 443 1351 5.3457 6.6821 13.3642 0.0169 Constraint 443 748 4.6111 5.7639 11.5278 0.0169 Constraint 443 713 4.9014 6.1268 12.2536 0.0169 Constraint 443 681 5.8462 7.3077 14.6154 0.0169 Constraint 435 1494 4.7828 5.9785 11.9569 0.0169 Constraint 435 792 6.2717 7.8396 15.6793 0.0169 Constraint 435 769 5.7779 7.2223 14.4446 0.0169 Constraint 435 706 5.0845 6.3557 12.7113 0.0169 Constraint 435 579 3.5872 4.4840 8.9681 0.0169 Constraint 429 980 5.7635 7.2043 14.4087 0.0169 Constraint 429 792 6.3057 7.8821 15.7642 0.0169 Constraint 429 761 5.8959 7.3699 14.7397 0.0169 Constraint 421 1494 4.4893 5.6116 11.2232 0.0169 Constraint 421 1366 4.4577 5.5721 11.1442 0.0169 Constraint 412 1511 3.9360 4.9200 9.8399 0.0169 Constraint 412 1494 4.1261 5.1576 10.3151 0.0169 Constraint 403 1511 5.7215 7.1519 14.3038 0.0169 Constraint 392 1526 4.0857 5.1071 10.2142 0.0169 Constraint 392 1519 6.0416 7.5520 15.1040 0.0169 Constraint 392 1511 4.9175 6.1468 12.2937 0.0169 Constraint 384 1519 6.0662 7.5828 15.1656 0.0169 Constraint 384 1511 5.3250 6.6562 13.3125 0.0169 Constraint 384 1503 6.3566 7.9457 15.8914 0.0169 Constraint 384 510 6.1043 7.6304 15.2607 0.0169 Constraint 375 1519 6.2107 7.7634 15.5268 0.0169 Constraint 375 1511 6.3896 7.9870 15.9740 0.0169 Constraint 375 1503 4.1410 5.1763 10.3526 0.0169 Constraint 375 1494 6.2871 7.8589 15.7177 0.0169 Constraint 375 1035 4.8577 6.0721 12.1443 0.0169 Constraint 375 706 5.2394 6.5492 13.0984 0.0169 Constraint 375 510 5.0492 6.3114 12.6229 0.0169 Constraint 368 1683 5.6692 7.0865 14.1731 0.0169 Constraint 368 1678 6.2623 7.8278 15.6557 0.0169 Constraint 368 1662 4.7268 5.9085 11.8170 0.0169 Constraint 368 1503 5.8455 7.3069 14.6137 0.0169 Constraint 368 1494 3.6756 4.5945 9.1889 0.0169 Constraint 368 1488 5.7545 7.1931 14.3863 0.0169 Constraint 368 1014 6.3304 7.9130 15.8260 0.0169 Constraint 368 657 5.6811 7.1013 14.2027 0.0169 Constraint 363 1503 5.2839 6.6049 13.2098 0.0169 Constraint 363 1488 4.4542 5.5678 11.1355 0.0169 Constraint 363 1008 4.9268 6.1585 12.3170 0.0169 Constraint 363 608 4.9853 6.2316 12.4632 0.0169 Constraint 355 1488 5.7695 7.2119 14.4238 0.0169 Constraint 355 1479 3.4522 4.3152 8.6304 0.0169 Constraint 355 1471 5.1783 6.4729 12.9457 0.0169 Constraint 355 1030 6.2749 7.8437 15.6873 0.0169 Constraint 355 657 5.8335 7.2919 14.5838 0.0169 Constraint 355 538 6.0497 7.5622 15.1244 0.0169 Constraint 347 1488 4.8447 6.0559 12.1118 0.0169 Constraint 347 1479 5.6820 7.1025 14.2049 0.0169 Constraint 347 1471 5.5074 6.8843 13.7685 0.0169 Constraint 347 1466 3.8598 4.8247 9.6495 0.0169 Constraint 347 1455 4.0172 5.0215 10.0429 0.0169 Constraint 347 1030 2.9236 3.6545 7.3089 0.0169 Constraint 347 1022 4.1385 5.1732 10.3463 0.0169 Constraint 347 1014 5.8557 7.3196 14.6392 0.0169 Constraint 347 997 4.2984 5.3730 10.7460 0.0169 Constraint 347 549 4.5681 5.7101 11.4202 0.0169 Constraint 347 538 5.0594 6.3243 12.6485 0.0169 Constraint 347 530 5.7416 7.1770 14.3540 0.0169 Constraint 347 443 6.0512 7.5640 15.1280 0.0169 Constraint 333 1455 4.6970 5.8712 11.7424 0.0169 Constraint 333 997 5.9003 7.3754 14.7508 0.0169 Constraint 325 1455 5.5713 6.9641 13.9283 0.0169 Constraint 325 988 6.3281 7.9101 15.8202 0.0169 Constraint 314 997 3.3197 4.1496 8.2992 0.0169 Constraint 314 963 4.3944 5.4930 10.9860 0.0169 Constraint 314 722 6.0222 7.5277 15.0554 0.0169 Constraint 299 549 6.0228 7.5285 15.0569 0.0169 Constraint 299 493 5.9681 7.4602 14.9204 0.0169 Constraint 294 572 4.6743 5.8429 11.6857 0.0169 Constraint 274 1703 6.0391 7.5489 15.0978 0.0169 Constraint 274 1692 6.3827 7.9783 15.9567 0.0169 Constraint 274 466 6.3297 7.9121 15.8242 0.0169 Constraint 256 1692 4.7674 5.9592 11.9184 0.0169 Constraint 256 579 5.6703 7.0879 14.1758 0.0169 Constraint 256 572 3.5080 4.3850 8.7701 0.0169 Constraint 241 955 4.2928 5.3660 10.7319 0.0169 Constraint 241 487 5.4532 6.8165 13.6330 0.0169 Constraint 233 955 3.8026 4.7533 9.5066 0.0169 Constraint 227 403 3.2560 4.0700 8.1401 0.0169 Constraint 222 597 6.3179 7.8974 15.7949 0.0169 Constraint 222 355 3.7431 4.6788 9.3576 0.0169 Constraint 222 347 5.6929 7.1161 14.2322 0.0169 Constraint 222 299 6.0818 7.6023 15.2045 0.0169 Constraint 216 1351 6.0448 7.5560 15.1120 0.0169 Constraint 216 963 5.9934 7.4917 14.9834 0.0169 Constraint 216 955 5.1388 6.4235 12.8470 0.0169 Constraint 216 347 3.2069 4.0086 8.0172 0.0169 Constraint 208 1351 6.2487 7.8109 15.6218 0.0169 Constraint 208 955 6.2840 7.8551 15.7101 0.0169 Constraint 208 944 4.4473 5.5591 11.1183 0.0169 Constraint 208 403 3.0961 3.8701 7.7403 0.0169 Constraint 208 347 4.4804 5.6004 11.2009 0.0169 Constraint 208 325 5.5982 6.9978 13.9955 0.0169 Constraint 189 1416 5.5686 6.9608 13.9216 0.0169 Constraint 189 836 5.9379 7.4224 14.8448 0.0169 Constraint 172 848 6.3890 7.9863 15.9726 0.0169 Constraint 172 836 6.1739 7.7174 15.4348 0.0169 Constraint 172 384 6.2119 7.7648 15.5297 0.0169 Constraint 164 1466 3.9260 4.9075 9.8150 0.0169 Constraint 164 1455 4.4435 5.5544 11.1087 0.0169 Constraint 164 392 5.9770 7.4712 14.9425 0.0169 Constraint 154 1466 6.0943 7.6178 15.2357 0.0169 Constraint 154 921 3.6018 4.5022 9.0044 0.0169 Constraint 154 913 6.0944 7.6180 15.2361 0.0169 Constraint 145 1494 4.9541 6.1927 12.3854 0.0169 Constraint 145 1488 6.3562 7.9452 15.8904 0.0169 Constraint 145 1466 4.4182 5.5228 11.0455 0.0169 Constraint 145 299 4.4267 5.5333 11.0666 0.0169 Constraint 136 673 4.8531 6.0664 12.1328 0.0169 Constraint 136 403 6.0427 7.5534 15.1068 0.0169 Constraint 136 216 2.9202 3.6503 7.3006 0.0169 Constraint 128 1511 6.3306 7.9132 15.8265 0.0169 Constraint 128 1494 4.4686 5.5857 11.1715 0.0169 Constraint 128 1488 5.5845 6.9806 13.9612 0.0169 Constraint 121 937 4.9791 6.2238 12.4477 0.0169 Constraint 121 294 5.8035 7.2544 14.5089 0.0169 Constraint 112 1519 4.7990 5.9988 11.9976 0.0169 Constraint 112 1511 4.8025 6.0031 12.0062 0.0169 Constraint 112 1503 4.4500 5.5625 11.1250 0.0169 Constraint 112 1213 5.9302 7.4128 14.8256 0.0169 Constraint 112 1193 4.7338 5.9173 11.8345 0.0169 Constraint 112 466 6.2917 7.8647 15.7293 0.0169 Constraint 112 435 5.8348 7.2935 14.5871 0.0169 Constraint 112 392 3.7741 4.7177 9.4354 0.0169 Constraint 104 1519 4.5405 5.6756 11.3511 0.0169 Constraint 104 1511 6.3835 7.9794 15.9588 0.0169 Constraint 104 1503 3.3571 4.1964 8.3928 0.0169 Constraint 104 1488 4.4388 5.5485 11.0970 0.0169 Constraint 104 968 4.5031 5.6288 11.2576 0.0169 Constraint 104 673 5.3621 6.7026 13.4051 0.0169 Constraint 104 180 3.4403 4.3003 8.6007 0.0169 Constraint 91 1533 5.9325 7.4156 14.8312 0.0169 Constraint 91 1526 4.9373 6.1717 12.3433 0.0169 Constraint 91 1519 4.0405 5.0506 10.1012 0.0169 Constraint 91 1511 5.7356 7.1696 14.3391 0.0169 Constraint 91 1220 4.8476 6.0595 12.1189 0.0169 Constraint 91 1213 4.7440 5.9299 11.8599 0.0169 Constraint 91 1204 4.9628 6.2035 12.4070 0.0169 Constraint 91 988 6.0319 7.5399 15.0798 0.0169 Constraint 91 955 5.5818 6.9773 13.9546 0.0169 Constraint 91 937 5.8965 7.3707 14.7414 0.0169 Constraint 91 921 3.6101 4.5126 9.0251 0.0169 Constraint 91 908 6.0128 7.5160 15.0320 0.0169 Constraint 91 892 3.1825 3.9781 7.9562 0.0169 Constraint 91 249 5.8032 7.2540 14.5081 0.0169 Constraint 82 1503 5.7969 7.2461 14.4922 0.0169 Constraint 82 988 5.2531 6.5664 13.1328 0.0169 Constraint 82 968 4.1754 5.2192 10.4385 0.0169 Constraint 82 955 4.7704 5.9630 11.9260 0.0169 Constraint 82 937 6.1780 7.7225 15.4450 0.0169 Constraint 82 913 4.4484 5.5605 11.1210 0.0169 Constraint 82 876 5.5908 6.9885 13.9770 0.0169 Constraint 82 690 4.5106 5.6383 11.2766 0.0169 Constraint 82 597 4.5450 5.6812 11.3624 0.0169 Constraint 82 384 5.3795 6.7244 13.4488 0.0169 Constraint 82 363 5.0578 6.3223 12.6446 0.0169 Constraint 82 306 6.1348 7.6685 15.3369 0.0169 Constraint 82 263 5.9793 7.4742 14.9483 0.0169 Constraint 77 1541 4.9227 6.1534 12.3068 0.0169 Constraint 77 1526 4.5404 5.6755 11.3510 0.0169 Constraint 77 1092 4.9608 6.2010 12.4019 0.0169 Constraint 77 997 4.7554 5.9442 11.8885 0.0169 Constraint 77 988 5.1962 6.4953 12.9906 0.0169 Constraint 77 980 6.0301 7.5377 15.0754 0.0169 Constraint 77 899 4.7590 5.9487 11.8974 0.0169 Constraint 77 884 3.8368 4.7960 9.5920 0.0169 Constraint 77 589 4.6472 5.8090 11.6179 0.0169 Constraint 77 256 5.2455 6.5568 13.1136 0.0169 Constraint 66 1567 5.6821 7.1026 14.2052 0.0169 Constraint 66 1556 5.9390 7.4238 14.8475 0.0169 Constraint 66 1533 6.2490 7.8113 15.6225 0.0169 Constraint 66 1526 3.7207 4.6509 9.3018 0.0169 Constraint 66 1276 5.7078 7.1347 14.2694 0.0169 Constraint 59 256 6.0832 7.6040 15.2080 0.0169 Constraint 59 233 6.1282 7.6602 15.3204 0.0169 Constraint 47 1149 5.6816 7.1020 14.2040 0.0169 Constraint 47 1141 5.9671 7.4588 14.9176 0.0169 Constraint 47 1117 6.2880 7.8600 15.7201 0.0169 Constraint 47 963 5.8100 7.2625 14.5251 0.0169 Constraint 47 412 5.0664 6.3330 12.6661 0.0169 Constraint 47 392 4.0727 5.0909 10.1818 0.0169 Constraint 47 363 5.1766 6.4708 12.9416 0.0169 Constraint 33 1167 5.5098 6.8872 13.7744 0.0169 Constraint 25 1503 5.9706 7.4633 14.9266 0.0169 Constraint 25 1030 6.3352 7.9190 15.8379 0.0169 Constraint 25 968 4.5068 5.6336 11.2671 0.0169 Constraint 25 963 6.2338 7.7922 15.5844 0.0169 Constraint 25 208 4.9781 6.2226 12.4453 0.0169 Constraint 18 1533 6.1545 7.6932 15.3864 0.0169 Constraint 18 1239 6.0740 7.5925 15.1851 0.0169 Constraint 18 1228 6.1672 7.7090 15.4179 0.0169 Constraint 18 1213 3.2254 4.0318 8.0636 0.0169 Constraint 18 963 6.0716 7.5895 15.1789 0.0169 Constraint 18 913 5.9374 7.4218 14.8435 0.0169 Constraint 18 908 6.0596 7.5744 15.1489 0.0169 Constraint 18 892 3.2739 4.0924 8.1848 0.0169 Constraint 18 616 5.0311 6.2889 12.5778 0.0169 Constraint 11 1556 5.8355 7.2943 14.5887 0.0169 Constraint 11 1008 6.0931 7.6164 15.2327 0.0169 Constraint 11 963 6.1394 7.6743 15.3486 0.0169 Constraint 11 944 4.1495 5.1869 10.3738 0.0169 Constraint 11 937 6.0815 7.6019 15.2039 0.0169 Constraint 11 892 5.6597 7.0746 14.1492 0.0169 Constraint 11 876 5.8768 7.3460 14.6920 0.0169 Constraint 3 1022 3.0839 3.8549 7.7098 0.0169 Constraint 3 944 6.0638 7.5798 15.1595 0.0169 Constraint 3 937 3.6523 4.5654 9.1309 0.0169 Constraint 3 930 5.6869 7.1086 14.2172 0.0169 Constraint 3 921 5.0606 6.3257 12.6514 0.0169 Constraint 3 616 5.2538 6.5673 13.1346 0.0169 Constraint 1366 1471 5.2708 6.5885 13.1769 0.0166 Constraint 1366 1447 4.3326 5.4157 10.8315 0.0166 Constraint 1358 1447 5.3159 6.6449 13.2898 0.0166 Constraint 1351 1511 5.8754 7.3442 14.6884 0.0166 Constraint 1334 1488 4.8448 6.0559 12.1119 0.0166 Constraint 1325 1494 4.7948 5.9935 11.9870 0.0166 Constraint 1158 1455 6.2830 7.8538 15.7075 0.0166 Constraint 1158 1427 5.8320 7.2901 14.5801 0.0166 Constraint 1149 1427 4.9166 6.1457 12.2915 0.0166 Constraint 1141 1611 5.9165 7.3956 14.7913 0.0166 Constraint 1141 1575 3.6438 4.5547 9.1094 0.0166 Constraint 968 1149 4.3175 5.3968 10.7937 0.0166 Constraint 921 1343 6.3026 7.8783 15.7565 0.0166 Constraint 908 1391 4.8127 6.0159 12.0317 0.0166 Constraint 908 1382 4.3123 5.3904 10.7809 0.0166 Constraint 892 1366 6.3407 7.9259 15.8519 0.0166 Constraint 884 1511 5.6186 7.0232 14.0464 0.0166 Constraint 876 1284 4.5364 5.6705 11.3409 0.0166 Constraint 868 1284 5.4644 6.8306 13.6611 0.0166 Constraint 859 1533 5.1552 6.4440 12.8881 0.0166 Constraint 829 1603 6.1023 7.6279 15.2558 0.0166 Constraint 829 1503 5.9026 7.3783 14.7565 0.0166 Constraint 829 1488 6.1998 7.7498 15.4996 0.0166 Constraint 808 1204 4.5601 5.7001 11.4003 0.0166 Constraint 800 1149 5.0660 6.3325 12.6649 0.0166 Constraint 756 1526 6.3473 7.9342 15.8684 0.0166 Constraint 748 1611 6.2016 7.7519 15.5039 0.0166 Constraint 748 1603 5.3463 6.6829 13.3657 0.0166 Constraint 748 1503 6.1329 7.6661 15.3323 0.0166 Constraint 748 876 3.4521 4.3152 8.6304 0.0166 Constraint 739 1141 6.2048 7.7559 15.5119 0.0166 Constraint 731 1141 3.0965 3.8706 7.7413 0.0166 Constraint 722 1611 6.1125 7.6406 15.2813 0.0166 Constraint 722 1575 4.7153 5.8941 11.7882 0.0166 Constraint 722 1548 6.2699 7.8374 15.6749 0.0166 Constraint 722 1526 4.3831 5.4789 10.9579 0.0166 Constraint 713 1611 4.2110 5.2637 10.5274 0.0166 Constraint 713 1575 5.9670 7.4587 14.9175 0.0166 Constraint 706 1503 5.5376 6.9220 13.8441 0.0166 Constraint 706 1494 5.0069 6.2586 12.5172 0.0166 Constraint 690 1611 6.0189 7.5236 15.0473 0.0166 Constraint 690 1575 3.9035 4.8794 9.7588 0.0166 Constraint 665 1100 4.3676 5.4595 10.9190 0.0166 Constraint 657 1548 6.2854 7.8567 15.7135 0.0166 Constraint 657 1526 6.1222 7.6528 15.3055 0.0166 Constraint 657 1494 4.8136 6.0169 12.0339 0.0166 Constraint 657 1447 5.8640 7.3300 14.6600 0.0166 Constraint 650 1471 5.5797 6.9746 13.9493 0.0166 Constraint 650 1068 5.0098 6.2622 12.5244 0.0166 Constraint 639 1541 4.9106 6.1383 12.2766 0.0166 Constraint 639 1519 4.7283 5.9104 11.8208 0.0166 Constraint 639 1471 4.9452 6.1815 12.3629 0.0166 Constraint 630 1382 5.7386 7.1733 14.3465 0.0166 Constraint 630 1030 6.1045 7.6306 15.2612 0.0166 Constraint 630 1022 4.6499 5.8124 11.6248 0.0166 Constraint 597 899 5.0951 6.3689 12.7378 0.0166 Constraint 589 1325 5.9393 7.4242 14.8483 0.0166 Constraint 579 968 4.6040 5.7550 11.5100 0.0166 Constraint 579 944 3.6134 4.5167 9.0334 0.0166 Constraint 564 1220 5.4807 6.8509 13.7018 0.0166 Constraint 549 1228 4.6677 5.8347 11.6693 0.0166 Constraint 549 1193 5.4474 6.8093 13.6186 0.0166 Constraint 549 937 4.2944 5.3680 10.7360 0.0166 Constraint 549 748 6.3475 7.9344 15.8688 0.0166 Constraint 501 1220 4.2963 5.3704 10.7408 0.0166 Constraint 501 899 4.6145 5.7681 11.5362 0.0166 Constraint 493 1141 6.3775 7.9718 15.9437 0.0166 Constraint 479 876 4.5553 5.6941 11.3882 0.0166 Constraint 466 908 6.2389 7.7987 15.5973 0.0166 Constraint 435 930 4.6210 5.7762 11.5524 0.0166 Constraint 435 908 3.0560 3.8200 7.6400 0.0166 Constraint 429 1611 6.1106 7.6383 15.2765 0.0166 Constraint 429 1603 5.3621 6.7026 13.4051 0.0166 Constraint 429 1575 4.7260 5.9076 11.8151 0.0166 Constraint 429 908 5.9312 7.4140 14.8281 0.0166 Constraint 421 1611 4.2108 5.2635 10.5271 0.0166 Constraint 421 1575 5.9540 7.4426 14.8851 0.0166 Constraint 403 899 5.1479 6.4349 12.8698 0.0166 Constraint 403 868 5.8694 7.3367 14.6735 0.0166 Constraint 392 1575 3.8407 4.8009 9.6018 0.0166 Constraint 368 1541 5.9040 7.3801 14.7601 0.0166 Constraint 368 1519 4.7893 5.9867 11.9733 0.0166 Constraint 347 1399 3.6322 4.5403 9.0805 0.0166 Constraint 325 1399 5.6407 7.0509 14.1017 0.0166 Constraint 299 1084 5.9147 7.3934 14.7867 0.0166 Constraint 285 1054 5.1749 6.4686 12.9373 0.0166 Constraint 274 1325 4.6829 5.8536 11.7072 0.0166 Constraint 274 1317 6.3087 7.8858 15.7716 0.0166 Constraint 263 1054 5.2538 6.5673 13.1346 0.0166 Constraint 263 988 5.2653 6.5816 13.1632 0.0166 Constraint 263 955 5.8348 7.2935 14.5870 0.0166 Constraint 256 673 3.3282 4.1602 8.3205 0.0166 Constraint 256 650 6.2741 7.8426 15.6852 0.0166 Constraint 256 639 4.7746 5.9683 11.9366 0.0166 Constraint 249 1325 5.3172 6.6465 13.2929 0.0166 Constraint 249 997 4.5295 5.6618 11.3236 0.0166 Constraint 241 1548 4.7144 5.8930 11.7860 0.0166 Constraint 241 1382 6.0845 7.6056 15.2112 0.0166 Constraint 241 1358 3.7958 4.7448 9.4895 0.0166 Constraint 241 1325 4.3249 5.4062 10.8123 0.0166 Constraint 233 1548 5.9812 7.4764 14.9529 0.0166 Constraint 233 988 5.5395 6.9243 13.8486 0.0166 Constraint 227 650 5.2069 6.5086 13.0172 0.0166 Constraint 227 608 4.3261 5.4077 10.8153 0.0166 Constraint 222 1358 3.9771 4.9714 9.9428 0.0166 Constraint 222 1325 6.2399 7.7999 15.5998 0.0166 Constraint 222 589 5.5059 6.8824 13.7648 0.0166 Constraint 216 1603 5.6763 7.0954 14.1908 0.0166 Constraint 216 1596 5.7911 7.2388 14.4777 0.0166 Constraint 216 1548 3.7263 4.6578 9.3156 0.0166 Constraint 216 1519 6.1970 7.7462 15.4925 0.0166 Constraint 216 1488 5.9788 7.4736 14.9471 0.0166 Constraint 216 1358 3.8913 4.8642 9.7283 0.0166 Constraint 208 616 6.3019 7.8774 15.7548 0.0166 Constraint 196 650 5.6315 7.0394 14.0788 0.0166 Constraint 189 1519 5.7921 7.2402 14.4803 0.0166 Constraint 189 1455 5.3058 6.6322 13.2644 0.0166 Constraint 180 1455 6.3666 7.9583 15.9165 0.0166 Constraint 180 963 5.6302 7.0378 14.0755 0.0166 Constraint 180 829 5.6437 7.0546 14.1092 0.0166 Constraint 180 761 5.6480 7.0601 14.1201 0.0166 Constraint 164 930 5.8456 7.3070 14.6140 0.0166 Constraint 164 761 4.0506 5.0633 10.1265 0.0166 Constraint 154 1611 6.1126 7.6408 15.2816 0.0166 Constraint 154 1596 4.5863 5.7329 11.4658 0.0166 Constraint 154 1519 4.4811 5.6014 11.2028 0.0166 Constraint 154 1511 5.4260 6.7825 13.5650 0.0166 Constraint 154 1427 6.0972 7.6215 15.2429 0.0166 Constraint 154 930 2.5618 3.2023 6.4046 0.0166 Constraint 154 761 4.0955 5.1193 10.2386 0.0166 Constraint 145 1519 4.1999 5.2499 10.4997 0.0166 Constraint 145 1511 4.4228 5.5285 11.0571 0.0166 Constraint 145 955 5.0978 6.3723 12.7446 0.0166 Constraint 145 412 4.0962 5.1202 10.2404 0.0166 Constraint 136 1488 4.5681 5.7102 11.4203 0.0166 Constraint 136 1054 6.1038 7.6297 15.2595 0.0166 Constraint 136 988 3.8167 4.7709 9.5418 0.0166 Constraint 136 980 4.1243 5.1554 10.3109 0.0166 Constraint 136 955 4.0723 5.0904 10.1809 0.0166 Constraint 136 698 4.8271 6.0338 12.0677 0.0166 Constraint 128 930 4.1833 5.2292 10.4584 0.0166 Constraint 128 808 3.9680 4.9600 9.9200 0.0166 Constraint 128 756 3.9577 4.9472 9.8943 0.0166 Constraint 121 1246 5.3346 6.6682 13.3365 0.0166 Constraint 121 1213 4.7546 5.9433 11.8865 0.0166 Constraint 121 1059 4.1350 5.1688 10.3375 0.0166 Constraint 121 1054 4.1434 5.1793 10.3586 0.0166 Constraint 121 930 3.8304 4.7880 9.5761 0.0166 Constraint 121 921 5.8532 7.3165 14.6330 0.0166 Constraint 121 908 6.1181 7.6476 15.2951 0.0166 Constraint 121 899 4.0516 5.0645 10.1290 0.0166 Constraint 121 731 3.8187 4.7734 9.5468 0.0166 Constraint 121 403 4.5088 5.6360 11.2719 0.0166 Constraint 121 375 5.7538 7.1923 14.3846 0.0166 Constraint 112 988 4.0007 5.0008 10.0017 0.0166 Constraint 112 921 5.4399 6.7998 13.5997 0.0166 Constraint 104 1408 4.3838 5.4797 10.9594 0.0166 Constraint 104 1399 3.6394 4.5492 9.0984 0.0166 Constraint 104 1054 4.0739 5.0924 10.1848 0.0166 Constraint 97 1117 3.7369 4.6711 9.3422 0.0166 Constraint 97 1109 4.1770 5.2212 10.4424 0.0166 Constraint 97 1014 6.0889 7.6111 15.2223 0.0166 Constraint 91 1399 5.6145 7.0181 14.0362 0.0166 Constraint 91 808 3.4059 4.2573 8.5146 0.0166 Constraint 91 761 3.4779 4.3473 8.6947 0.0166 Constraint 91 403 4.0631 5.0788 10.1576 0.0166 Constraint 91 368 5.7781 7.2226 14.4452 0.0166 Constraint 91 227 5.2337 6.5422 13.0844 0.0166 Constraint 91 208 6.3763 7.9703 15.9406 0.0166 Constraint 82 808 5.6120 7.0150 14.0301 0.0166 Constraint 82 761 5.6538 7.0672 14.1344 0.0166 Constraint 82 375 5.1812 6.4765 12.9531 0.0166 Constraint 82 314 4.4109 5.5136 11.0273 0.0166 Constraint 77 1117 3.9771 4.9714 9.9427 0.0166 Constraint 77 1084 6.1044 7.6305 15.2610 0.0166 Constraint 66 1133 4.9055 6.1319 12.2638 0.0166 Constraint 66 1109 4.9055 6.1319 12.2638 0.0166 Constraint 66 808 3.9459 4.9324 9.8648 0.0166 Constraint 66 761 4.0321 5.0401 10.0803 0.0166 Constraint 59 808 4.1684 5.2105 10.4210 0.0166 Constraint 59 761 4.1687 5.2109 10.4217 0.0166 Constraint 47 1092 5.0071 6.2589 12.5178 0.0166 Constraint 39 1519 4.4553 5.5691 11.1382 0.0166 Constraint 39 1466 4.8981 6.1226 12.2452 0.0166 Constraint 39 1438 6.1321 7.6651 15.3302 0.0166 Constraint 39 1427 4.5599 5.6998 11.3997 0.0166 Constraint 39 1117 4.8845 6.1057 12.2113 0.0166 Constraint 39 1068 5.7595 7.1994 14.3987 0.0166 Constraint 33 1526 5.1074 6.3843 12.7686 0.0166 Constraint 33 1519 4.1663 5.2079 10.4158 0.0166 Constraint 33 1511 4.3530 5.4413 10.8825 0.0166 Constraint 33 1141 4.4421 5.5526 11.1053 0.0166 Constraint 33 944 5.4531 6.8164 13.6328 0.0166 Constraint 33 930 4.5653 5.7067 11.4133 0.0166 Constraint 25 1149 5.9251 7.4064 14.8127 0.0166 Constraint 25 1141 5.5838 6.9797 13.9594 0.0166 Constraint 25 1035 4.9208 6.1510 12.3020 0.0166 Constraint 25 172 6.1201 7.6502 15.3003 0.0166 Constraint 25 164 4.8440 6.0550 12.1100 0.0166 Constraint 18 1649 4.5814 5.7268 11.4536 0.0166 Constraint 18 1620 4.8666 6.0833 12.1665 0.0166 Constraint 18 1014 4.7799 5.9749 11.9498 0.0166 Constraint 18 944 4.9803 6.2253 12.4507 0.0166 Constraint 18 921 4.9805 6.2256 12.4513 0.0166 Constraint 18 848 5.0064 6.2580 12.5161 0.0166 Constraint 18 808 5.6893 7.1116 14.2233 0.0166 Constraint 11 1657 5.0285 6.2857 12.5713 0.0166 Constraint 11 988 3.7747 4.7184 9.4369 0.0166 Constraint 11 980 4.2323 5.2903 10.5807 0.0166 Constraint 11 722 5.3403 6.6754 13.3508 0.0166 Constraint 3 1634 5.6248 7.0310 14.0620 0.0166 Constraint 3 1141 4.0088 5.0109 10.0219 0.0166 Constraint 3 848 5.6278 7.0347 14.0694 0.0166 Constraint 3 222 4.0356 5.0445 10.0889 0.0166 Constraint 3 196 4.6031 5.7539 11.5078 0.0166 Constraint 1703 1772 6.0319 7.5398 15.0797 0.0156 Constraint 1692 1788 5.9307 7.4133 14.8266 0.0156 Constraint 1670 1788 3.7437 4.6796 9.3592 0.0156 Constraint 1662 1788 5.4389 6.7987 13.5974 0.0156 Constraint 1657 1777 6.2634 7.8293 15.6586 0.0156 Constraint 1634 1788 5.5597 6.9497 13.8994 0.0156 Constraint 1634 1777 6.2990 7.8737 15.7474 0.0156 Constraint 1533 1620 6.3418 7.9272 15.8544 0.0156 Constraint 1399 1788 5.8513 7.3141 14.6283 0.0156 Constraint 1374 1533 6.2018 7.7522 15.5044 0.0156 Constraint 1366 1788 3.2142 4.0177 8.0355 0.0156 Constraint 1358 1731 5.2938 6.6172 13.2345 0.0156 Constraint 1358 1720 4.2167 5.2709 10.5418 0.0156 Constraint 1351 1748 4.9552 6.1940 12.3881 0.0156 Constraint 1334 1519 4.3659 5.4574 10.9148 0.0156 Constraint 1334 1479 4.7889 5.9862 11.9723 0.0156 Constraint 1317 1526 4.9527 6.1909 12.3817 0.0156 Constraint 1251 1556 5.3762 6.7202 13.4404 0.0156 Constraint 1251 1548 4.8533 6.0666 12.1333 0.0156 Constraint 1246 1548 4.2395 5.2994 10.5988 0.0156 Constraint 1239 1391 5.8905 7.3632 14.7263 0.0156 Constraint 1220 1541 6.2600 7.8250 15.6500 0.0156 Constraint 1204 1293 5.6848 7.1060 14.2120 0.0156 Constraint 1178 1427 4.3037 5.3796 10.7592 0.0156 Constraint 1158 1575 4.8583 6.0729 12.1457 0.0156 Constraint 1117 1683 5.2049 6.5062 13.0123 0.0156 Constraint 1100 1309 6.1019 7.6274 15.2547 0.0156 Constraint 1068 1276 5.0248 6.2811 12.5621 0.0156 Constraint 997 1662 6.3713 7.9641 15.9282 0.0156 Constraint 997 1178 6.2417 7.8021 15.6042 0.0156 Constraint 997 1125 3.6811 4.6013 9.2027 0.0156 Constraint 988 1731 5.5625 6.9532 13.9063 0.0156 Constraint 988 1117 5.7874 7.2342 14.4685 0.0156 Constraint 988 1100 4.5874 5.7343 11.4686 0.0156 Constraint 980 1511 5.0364 6.2955 12.5911 0.0156 Constraint 968 1325 5.5798 6.9748 13.9496 0.0156 Constraint 963 1731 6.3453 7.9317 15.8633 0.0156 Constraint 963 1511 4.3230 5.4038 10.8076 0.0156 Constraint 955 1334 5.3162 6.6453 13.2906 0.0156 Constraint 955 1325 4.2295 5.2869 10.5738 0.0156 Constraint 944 1059 4.5904 5.7380 11.4760 0.0156 Constraint 937 1731 4.0918 5.1148 10.2296 0.0156 Constraint 937 1059 4.5480 5.6850 11.3699 0.0156 Constraint 921 1731 4.9669 6.2087 12.4173 0.0156 Constraint 921 1503 5.4063 6.7579 13.5158 0.0156 Constraint 921 1276 3.8404 4.8005 9.6010 0.0156 Constraint 913 1683 5.9315 7.4144 14.8287 0.0156 Constraint 913 1678 4.3818 5.4772 10.9544 0.0156 Constraint 913 1519 5.3688 6.7109 13.4219 0.0156 Constraint 913 997 3.7276 4.6595 9.3189 0.0156 Constraint 908 1683 4.7124 5.8904 11.7809 0.0156 Constraint 908 1678 6.1924 7.7405 15.4809 0.0156 Constraint 908 1634 5.4855 6.8568 13.7137 0.0156 Constraint 908 1149 5.1916 6.4895 12.9790 0.0156 Constraint 908 997 6.3036 7.8795 15.7591 0.0156 Constraint 899 1649 3.8526 4.8157 9.6314 0.0156 Constraint 899 1634 5.4149 6.7686 13.5371 0.0156 Constraint 899 1251 4.0473 5.0592 10.1183 0.0156 Constraint 899 1158 3.5932 4.4915 8.9831 0.0156 Constraint 892 1678 4.6880 5.8600 11.7200 0.0156 Constraint 892 1620 6.3650 7.9562 15.9124 0.0156 Constraint 892 1587 5.9300 7.4125 14.8250 0.0156 Constraint 892 1251 5.9379 7.4224 14.8448 0.0156 Constraint 884 1683 3.5116 4.3895 8.7790 0.0156 Constraint 884 1678 3.1448 3.9310 7.8621 0.0156 Constraint 884 1634 5.1290 6.4113 12.8226 0.0156 Constraint 884 1548 5.6233 7.0291 14.0581 0.0156 Constraint 884 1382 5.5466 6.9333 13.8666 0.0156 Constraint 884 1239 6.3268 7.9086 15.8171 0.0156 Constraint 884 1059 4.8056 6.0070 12.0139 0.0156 Constraint 884 1046 6.0222 7.5277 15.0554 0.0156 Constraint 884 997 5.5075 6.8844 13.7687 0.0156 Constraint 876 1683 6.3167 7.8958 15.7917 0.0156 Constraint 876 1620 5.8883 7.3604 14.7208 0.0156 Constraint 876 1603 6.3992 7.9990 15.9979 0.0156 Constraint 876 1416 4.0326 5.0408 10.0815 0.0156 Constraint 876 1251 5.8917 7.3647 14.7293 0.0156 Constraint 876 1059 5.8720 7.3400 14.6799 0.0156 Constraint 868 1455 6.2784 7.8481 15.6961 0.0156 Constraint 868 1251 3.9330 4.9162 9.8324 0.0156 Constraint 859 1634 4.5658 5.7073 11.4146 0.0156 Constraint 859 1526 5.8377 7.2972 14.5944 0.0156 Constraint 859 1301 4.8761 6.0951 12.1901 0.0156 Constraint 859 1228 6.1718 7.7148 15.4296 0.0156 Constraint 848 1325 5.9967 7.4959 14.9917 0.0156 Constraint 848 1309 3.5527 4.4409 8.8818 0.0156 Constraint 848 1301 3.4661 4.3327 8.6653 0.0156 Constraint 836 1511 3.6601 4.5751 9.1502 0.0156 Constraint 829 1739 5.4213 6.7766 13.5533 0.0156 Constraint 829 1479 5.6376 7.0470 14.0940 0.0156 Constraint 818 1526 5.4769 6.8462 13.6923 0.0156 Constraint 818 1511 3.7713 4.7141 9.4281 0.0156 Constraint 808 1366 5.2645 6.5806 13.1613 0.0156 Constraint 808 1358 3.3391 4.1739 8.3477 0.0156 Constraint 800 1526 5.5376 6.9220 13.8440 0.0156 Constraint 800 1358 6.0031 7.5039 15.0078 0.0156 Constraint 792 1567 3.1580 3.9475 7.8950 0.0156 Constraint 792 1548 4.3471 5.4338 10.8677 0.0156 Constraint 792 1541 5.3958 6.7448 13.4896 0.0156 Constraint 792 1358 5.9769 7.4712 14.9423 0.0156 Constraint 783 1556 5.1056 6.3820 12.7640 0.0156 Constraint 783 1541 5.2353 6.5441 13.0882 0.0156 Constraint 769 1567 5.1002 6.3753 12.7506 0.0156 Constraint 769 1556 6.0156 7.5196 15.0391 0.0156 Constraint 761 1556 4.9363 6.1704 12.3407 0.0156 Constraint 761 937 6.3010 7.8763 15.7526 0.0156 Constraint 756 1788 5.0816 6.3520 12.7041 0.0156 Constraint 756 1670 5.0785 6.3482 12.6963 0.0156 Constraint 756 1662 6.3193 7.8991 15.7983 0.0156 Constraint 731 1548 6.0628 7.5785 15.1570 0.0156 Constraint 731 937 6.0704 7.5879 15.1759 0.0156 Constraint 722 1788 5.5181 6.8976 13.7953 0.0156 Constraint 713 1427 3.6986 4.6233 9.2465 0.0156 Constraint 713 1416 4.9096 6.1370 12.2740 0.0156 Constraint 706 1662 4.4147 5.5184 11.0367 0.0156 Constraint 706 1657 4.4278 5.5348 11.0695 0.0156 Constraint 706 1059 5.7617 7.2021 14.4042 0.0156 Constraint 698 921 3.2857 4.1071 8.2142 0.0156 Constraint 690 1788 5.6458 7.0573 14.1145 0.0156 Constraint 681 1511 5.9025 7.3782 14.7563 0.0156 Constraint 681 1503 5.8710 7.3387 14.6774 0.0156 Constraint 681 1366 5.4921 6.8651 13.7302 0.0156 Constraint 681 1343 5.6378 7.0472 14.0945 0.0156 Constraint 681 1220 6.3443 7.9304 15.8608 0.0156 Constraint 673 1503 3.3525 4.1906 8.3812 0.0156 Constraint 673 1488 5.5776 6.9720 13.9439 0.0156 Constraint 673 1366 3.4526 4.3158 8.6315 0.0156 Constraint 673 1022 3.5844 4.4805 8.9611 0.0156 Constraint 673 921 6.0919 7.6149 15.2298 0.0156 Constraint 673 829 5.4379 6.7974 13.5948 0.0156 Constraint 665 1731 4.9729 6.2161 12.4322 0.0156 Constraint 665 1301 5.3018 6.6273 13.2546 0.0156 Constraint 665 1268 3.9232 4.9040 9.8079 0.0156 Constraint 665 1246 6.2591 7.8238 15.6477 0.0156 Constraint 657 1246 4.4006 5.5008 11.0015 0.0156 Constraint 657 1022 6.2357 7.7946 15.5892 0.0156 Constraint 650 1268 4.5652 5.7064 11.4129 0.0156 Constraint 650 1246 5.3138 6.6422 13.2844 0.0156 Constraint 650 1239 4.2094 5.2618 10.5236 0.0156 Constraint 639 1246 5.3081 6.6351 13.2703 0.0156 Constraint 639 980 6.1277 7.6597 15.3193 0.0156 Constraint 630 1714 6.0493 7.5616 15.1232 0.0156 Constraint 630 1511 5.9076 7.3846 14.7691 0.0156 Constraint 630 1276 6.3957 7.9946 15.9892 0.0156 Constraint 630 963 5.9869 7.4836 14.9672 0.0156 Constraint 623 1488 5.0585 6.3231 12.6462 0.0156 Constraint 623 1455 5.1234 6.4043 12.8086 0.0156 Constraint 623 1022 5.6680 7.0850 14.1701 0.0156 Constraint 623 792 3.9695 4.9619 9.9238 0.0156 Constraint 616 1788 5.8389 7.2987 14.5973 0.0156 Constraint 616 1683 6.2485 7.8106 15.6212 0.0156 Constraint 616 1649 4.9110 6.1387 12.2774 0.0156 Constraint 616 1634 5.3252 6.6565 13.3130 0.0156 Constraint 616 1471 5.7294 7.1617 14.3235 0.0156 Constraint 616 1438 6.3180 7.8975 15.7950 0.0156 Constraint 616 1334 5.4980 6.8725 13.7451 0.0156 Constraint 616 1325 5.1404 6.4254 12.8509 0.0156 Constraint 616 1317 4.9674 6.2092 12.4184 0.0156 Constraint 616 1309 5.7828 7.2285 14.4570 0.0156 Constraint 616 792 5.9363 7.4204 14.8407 0.0156 Constraint 608 1447 3.4670 4.3337 8.6674 0.0156 Constraint 608 1416 3.9650 4.9563 9.9126 0.0156 Constraint 597 1720 5.3303 6.6629 13.3259 0.0156 Constraint 597 1511 4.8856 6.1070 12.2140 0.0156 Constraint 597 1479 4.8116 6.0145 12.0291 0.0156 Constraint 597 1471 4.4511 5.5638 11.1277 0.0156 Constraint 597 1438 6.0173 7.5216 15.0433 0.0156 Constraint 597 1317 5.0930 6.3663 12.7325 0.0156 Constraint 597 1301 6.3668 7.9585 15.9170 0.0156 Constraint 597 1284 6.2258 7.7822 15.5644 0.0156 Constraint 597 1220 4.4741 5.5926 11.1852 0.0156 Constraint 597 1204 4.9058 6.1322 12.2645 0.0156 Constraint 589 1519 6.3161 7.8951 15.7902 0.0156 Constraint 589 1503 6.0469 7.5586 15.1172 0.0156 Constraint 589 1220 6.2860 7.8575 15.7150 0.0156 Constraint 589 1204 3.5341 4.4177 8.8354 0.0156 Constraint 589 1193 5.6100 7.0125 14.0251 0.0156 Constraint 579 1587 5.5614 6.9517 13.9035 0.0156 Constraint 579 1575 3.8034 4.7542 9.5085 0.0156 Constraint 579 1567 5.2018 6.5022 13.0044 0.0156 Constraint 579 1533 4.8135 6.0169 12.0338 0.0156 Constraint 579 1511 5.6629 7.0786 14.1572 0.0156 Constraint 572 1548 6.2495 7.8119 15.6238 0.0156 Constraint 572 1541 4.4207 5.5259 11.0517 0.0156 Constraint 572 1533 6.2072 7.7590 15.5180 0.0156 Constraint 572 1022 4.1462 5.1827 10.3654 0.0156 Constraint 572 963 3.8938 4.8672 9.7344 0.0156 Constraint 557 1193 4.6336 5.7920 11.5840 0.0156 Constraint 557 1158 4.3812 5.4765 10.9529 0.0156 Constraint 557 1068 4.4747 5.5934 11.1869 0.0156 Constraint 530 1158 5.3838 6.7297 13.4594 0.0156 Constraint 510 630 5.1690 6.4612 12.9225 0.0156 Constraint 435 1662 5.7150 7.1438 14.2875 0.0156 Constraint 421 876 5.0455 6.3068 12.6137 0.0156 Constraint 412 1533 6.3217 7.9021 15.8042 0.0156 Constraint 412 1399 5.9884 7.4855 14.9710 0.0156 Constraint 412 1382 5.9262 7.4077 14.8154 0.0156 Constraint 412 1366 4.4211 5.5264 11.0528 0.0156 Constraint 412 1301 5.4338 6.7922 13.5844 0.0156 Constraint 412 1220 6.0741 7.5926 15.1852 0.0156 Constraint 412 1204 6.0509 7.5636 15.1272 0.0156 Constraint 412 1193 6.3410 7.9262 15.8525 0.0156 Constraint 403 1533 4.5405 5.6756 11.3511 0.0156 Constraint 403 1374 5.6796 7.0996 14.1991 0.0156 Constraint 403 1366 3.8875 4.8594 9.7188 0.0156 Constraint 403 1301 5.6303 7.0378 14.0756 0.0156 Constraint 403 1193 5.7336 7.1670 14.3341 0.0156 Constraint 403 1178 5.1925 6.4906 12.9812 0.0156 Constraint 403 1125 5.6303 7.0378 14.0756 0.0156 Constraint 392 1309 6.1725 7.7156 15.4312 0.0156 Constraint 392 1301 3.5581 4.4476 8.8953 0.0156 Constraint 375 1548 6.1802 7.7253 15.4505 0.0156 Constraint 375 1334 5.9408 7.4260 14.8521 0.0156 Constraint 375 1309 4.6459 5.8074 11.6148 0.0156 Constraint 368 1239 5.1114 6.3892 12.7785 0.0156 Constraint 347 1587 5.4661 6.8327 13.6653 0.0156 Constraint 333 1620 5.8749 7.3436 14.6872 0.0156 Constraint 333 1603 5.1024 6.3780 12.7559 0.0156 Constraint 333 1596 4.3120 5.3900 10.7800 0.0156 Constraint 333 1587 4.6772 5.8465 11.6930 0.0156 Constraint 333 1239 5.0149 6.2687 12.5373 0.0156 Constraint 325 1611 5.9776 7.4719 14.9439 0.0156 Constraint 325 1587 3.6486 4.5607 9.1214 0.0156 Constraint 325 1239 4.3049 5.3811 10.7621 0.0156 Constraint 325 1228 4.1257 5.1571 10.3142 0.0156 Constraint 325 1220 5.9978 7.4973 14.9945 0.0156 Constraint 325 1213 4.1834 5.2292 10.4585 0.0156 Constraint 314 1603 5.8348 7.2935 14.5869 0.0156 Constraint 314 1587 5.1773 6.4716 12.9433 0.0156 Constraint 314 1213 5.8107 7.2633 14.5267 0.0156 Constraint 314 1204 4.3375 5.4219 10.8439 0.0156 Constraint 306 1587 6.2648 7.8310 15.6621 0.0156 Constraint 294 1596 5.2645 6.5806 13.1612 0.0156 Constraint 285 1596 4.1012 5.1266 10.2531 0.0156 Constraint 249 761 6.2925 7.8656 15.7312 0.0156 Constraint 241 761 3.9267 4.9084 9.8169 0.0156 Constraint 241 347 3.9135 4.8919 9.7839 0.0156 Constraint 233 347 5.3776 6.7220 13.4439 0.0156 Constraint 216 761 3.0825 3.8532 7.7063 0.0156 Constraint 216 368 6.3514 7.9393 15.8785 0.0156 Constraint 216 299 4.8465 6.0581 12.1162 0.0156 Constraint 216 294 4.2509 5.3136 10.6272 0.0156 Constraint 196 706 5.9236 7.4045 14.8091 0.0156 Constraint 196 368 5.8894 7.3617 14.7235 0.0156 Constraint 189 1634 4.0147 5.0184 10.0368 0.0156 Constraint 189 731 5.1992 6.4990 12.9980 0.0156 Constraint 180 1662 5.4733 6.8417 13.6833 0.0156 Constraint 180 1634 4.9744 6.2180 12.4360 0.0156 Constraint 180 783 6.3787 7.9734 15.9469 0.0156 Constraint 172 792 5.6689 7.0861 14.1723 0.0156 Constraint 164 800 5.6691 7.0864 14.1727 0.0156 Constraint 164 792 4.6386 5.7983 11.5965 0.0156 Constraint 154 1220 4.7544 5.9430 11.8860 0.0156 Constraint 154 403 5.8229 7.2787 14.5573 0.0156 Constraint 145 403 6.2075 7.7593 15.5187 0.0156 Constraint 104 487 3.1741 3.9677 7.9353 0.0156 Constraint 97 1276 5.8305 7.2881 14.5762 0.0156 Constraint 91 487 5.8954 7.3693 14.7385 0.0156 Constraint 82 549 6.1648 7.7060 15.4119 0.0156 Constraint 77 549 3.1378 3.9222 7.8444 0.0156 Constraint 77 538 5.4721 6.8401 13.6803 0.0156 Constraint 66 538 5.0149 6.2686 12.5373 0.0156 Constraint 59 564 3.3908 4.2386 8.4771 0.0156 Constraint 59 557 5.2200 6.5250 13.0500 0.0156 Constraint 59 549 6.3368 7.9210 15.8419 0.0156 Constraint 59 306 6.2985 7.8731 15.7462 0.0156 Constraint 39 579 3.1453 3.9316 7.8632 0.0156 Constraint 39 564 4.3260 5.4075 10.8151 0.0156 Constraint 18 579 5.6876 7.1095 14.2190 0.0156 Constraint 18 564 5.3411 6.6764 13.3529 0.0156 Constraint 1193 1777 6.3860 7.9824 15.9649 0.0153 Constraint 1125 1772 5.8686 7.3357 14.6714 0.0153 Constraint 1567 1788 5.7656 7.2070 14.4141 0.0151 Constraint 1556 1692 4.8991 6.1239 12.2477 0.0151 Constraint 1548 1777 6.0241 7.5301 15.0603 0.0151 Constraint 1541 1777 6.1538 7.6922 15.3845 0.0151 Constraint 1533 1692 5.8402 7.3003 14.6006 0.0151 Constraint 1511 1772 6.0026 7.5032 15.0064 0.0151 Constraint 1494 1777 3.7910 4.7387 9.4775 0.0151 Constraint 1494 1772 5.9205 7.4006 14.8013 0.0151 Constraint 1494 1748 4.9237 6.1546 12.3092 0.0151 Constraint 1488 1777 6.0438 7.5547 15.1094 0.0151 Constraint 1374 1772 5.6851 7.1063 14.2127 0.0151 Constraint 1334 1703 5.8922 7.3652 14.7304 0.0151 Constraint 1325 1575 3.7628 4.7035 9.4070 0.0151 Constraint 1325 1567 6.1881 7.7351 15.4702 0.0151 Constraint 1325 1526 6.2675 7.8343 15.6687 0.0151 Constraint 1251 1720 5.0370 6.2963 12.5925 0.0151 Constraint 1220 1777 5.7805 7.2256 14.4513 0.0151 Constraint 1213 1309 4.9945 6.2431 12.4862 0.0151 Constraint 1077 1772 3.7884 4.7355 9.4710 0.0151 Constraint 1054 1772 6.2748 7.8435 15.6870 0.0151 Constraint 1054 1739 4.6082 5.7603 11.5206 0.0151 Constraint 963 1084 5.5762 6.9703 13.9405 0.0151 Constraint 913 1100 4.7875 5.9844 11.9689 0.0151 Constraint 884 1317 4.3754 5.4693 10.9386 0.0151 Constraint 884 1293 5.1946 6.4933 12.9866 0.0151 Constraint 778 930 6.3756 7.9695 15.9391 0.0151 Constraint 756 1301 5.6725 7.0907 14.1813 0.0151 Constraint 756 1213 4.7101 5.8876 11.7752 0.0151 Constraint 756 1178 4.8513 6.0641 12.1283 0.0151 Constraint 739 1100 4.9189 6.1486 12.2972 0.0151 Constraint 510 1325 5.6559 7.0698 14.1397 0.0151 Constraint 510 739 4.6710 5.8387 11.6775 0.0151 Constraint 222 848 5.9606 7.4508 14.9015 0.0151 Constraint 189 908 6.2534 7.8168 15.6336 0.0151 Constraint 189 899 5.8364 7.2955 14.5910 0.0151 Constraint 180 1220 4.9126 6.1407 12.2815 0.0151 Constraint 180 1204 4.6927 5.8659 11.7318 0.0151 Constraint 154 1213 5.1348 6.4186 12.8371 0.0151 Constraint 145 1220 4.8551 6.0689 12.1377 0.0151 Constraint 145 1213 4.2812 5.3514 10.7029 0.0151 Constraint 136 1193 5.8096 7.2620 14.5241 0.0151 Constraint 128 1100 5.3234 6.6543 13.3085 0.0151 Constraint 112 306 3.4421 4.3026 8.6053 0.0151 Constraint 112 274 4.7574 5.9468 11.8935 0.0151 Constraint 104 1158 5.7751 7.2189 14.4379 0.0151 Constraint 104 1133 3.3569 4.1961 8.3923 0.0151 Constraint 104 285 4.8067 6.0084 12.0168 0.0151 Constraint 82 1220 5.7017 7.1272 14.2543 0.0151 Constraint 82 1158 4.6939 5.8673 11.7346 0.0151 Constraint 82 1133 4.8396 6.0495 12.0989 0.0151 Constraint 77 1158 5.1211 6.4013 12.8027 0.0151 Constraint 77 1133 5.4329 6.7911 13.5823 0.0151 Constraint 66 1178 4.2631 5.3289 10.6577 0.0151 Constraint 66 1167 4.8176 6.0220 12.0441 0.0151 Constraint 66 227 5.3654 6.7067 13.4134 0.0151 Constraint 59 1167 3.6504 4.5630 9.1260 0.0151 Constraint 59 1109 3.9610 4.9512 9.9024 0.0151 Constraint 47 1193 4.6258 5.7822 11.5645 0.0151 Constraint 47 1084 6.1866 7.7332 15.4665 0.0151 Constraint 47 884 6.1866 7.7332 15.4665 0.0151 Constraint 47 112 6.3491 7.9364 15.8728 0.0151 Constraint 39 930 4.7560 5.9449 11.8899 0.0151 Constraint 18 1220 4.7833 5.9792 11.9583 0.0151 Constraint 18 164 4.7626 5.9533 11.9066 0.0151 Constraint 11 172 5.6816 7.1020 14.2039 0.0151 Constraint 11 164 5.5999 6.9999 13.9998 0.0151 Constraint 3 164 5.5948 6.9935 13.9871 0.0151 Constraint 1374 1748 4.8610 6.0762 12.1525 0.0144 Constraint 1317 1488 4.5502 5.6878 11.3755 0.0144 Constraint 1301 1703 4.8416 6.0520 12.1040 0.0144 Constraint 1228 1334 5.8591 7.3238 14.6477 0.0144 Constraint 1193 1391 5.7196 7.1495 14.2990 0.0144 Constraint 1178 1488 3.0443 3.8054 7.6107 0.0144 Constraint 1178 1479 2.5630 3.2037 6.4075 0.0144 Constraint 1178 1351 3.1463 3.9329 7.8657 0.0144 Constraint 1178 1343 2.6215 3.2768 6.5537 0.0144 Constraint 1178 1334 6.1067 7.6333 15.2666 0.0144 Constraint 1178 1325 6.3209 7.9011 15.8022 0.0144 Constraint 1167 1479 5.9576 7.4471 14.8941 0.0144 Constraint 1158 1391 4.9120 6.1400 12.2800 0.0144 Constraint 1125 1603 5.2308 6.5385 13.0770 0.0144 Constraint 1117 1596 4.8561 6.0702 12.1403 0.0144 Constraint 1100 1764 5.4642 6.8302 13.6604 0.0144 Constraint 1100 1692 3.8077 4.7596 9.5192 0.0144 Constraint 1077 1611 6.1837 7.7296 15.4592 0.0144 Constraint 1068 1788 4.8027 6.0033 12.0067 0.0144 Constraint 1068 1764 4.3362 5.4202 10.8404 0.0144 Constraint 1068 1611 6.1746 7.7183 15.4365 0.0144 Constraint 1054 1788 4.1020 5.1275 10.2550 0.0144 Constraint 1046 1620 6.2338 7.7923 15.5846 0.0144 Constraint 1046 1603 5.8993 7.3742 14.7483 0.0144 Constraint 1022 1494 4.2076 5.2595 10.5190 0.0144 Constraint 997 1141 6.1490 7.6863 15.3726 0.0144 Constraint 968 1488 3.8027 4.7534 9.5068 0.0144 Constraint 968 1455 5.6464 7.0580 14.1160 0.0144 Constraint 944 1748 5.4438 6.8048 13.6096 0.0144 Constraint 944 1692 4.8756 6.0946 12.1891 0.0144 Constraint 944 1683 4.9359 6.1698 12.3397 0.0144 Constraint 937 1692 4.6883 5.8604 11.7209 0.0144 Constraint 937 1670 6.2870 7.8588 15.7175 0.0144 Constraint 930 1511 6.2128 7.7660 15.5321 0.0144 Constraint 930 1427 4.7609 5.9512 11.9023 0.0144 Constraint 930 1399 5.3382 6.6728 13.3455 0.0144 Constraint 921 1772 5.8581 7.3227 14.6453 0.0144 Constraint 921 1692 6.0915 7.6143 15.2287 0.0144 Constraint 921 1466 5.1108 6.3885 12.7771 0.0144 Constraint 921 1325 4.4991 5.6238 11.2477 0.0144 Constraint 913 1772 4.7794 5.9743 11.9485 0.0144 Constraint 913 1764 5.9079 7.3849 14.7697 0.0144 Constraint 913 1748 4.2969 5.3711 10.7423 0.0144 Constraint 913 1739 3.6885 4.6107 9.2214 0.0144 Constraint 908 1511 4.0404 5.0505 10.1010 0.0144 Constraint 908 1479 4.0592 5.0740 10.1479 0.0144 Constraint 899 1772 4.0931 5.1164 10.2328 0.0144 Constraint 884 1756 5.4058 6.7573 13.5145 0.0144 Constraint 884 1703 5.3077 6.6346 13.2692 0.0144 Constraint 859 1670 6.3870 7.9838 15.9676 0.0144 Constraint 818 1325 3.6205 4.5256 9.0513 0.0144 Constraint 800 1325 4.8809 6.1011 12.2022 0.0144 Constraint 792 1325 4.5395 5.6743 11.3486 0.0144 Constraint 792 1301 5.8700 7.3375 14.6750 0.0144 Constraint 769 1228 5.7755 7.2194 14.4387 0.0144 Constraint 761 1204 4.0343 5.0429 10.0858 0.0144 Constraint 748 1714 5.3324 6.6655 13.3309 0.0144 Constraint 748 1276 4.2172 5.2715 10.5430 0.0144 Constraint 739 1228 4.4827 5.6034 11.2068 0.0144 Constraint 739 1158 5.8586 7.3232 14.6464 0.0144 Constraint 722 1748 5.4651 6.8314 13.6627 0.0144 Constraint 722 1714 3.8905 4.8631 9.7262 0.0144 Constraint 722 1276 3.9984 4.9980 9.9959 0.0144 Constraint 722 876 4.3214 5.4018 10.8036 0.0144 Constraint 713 1251 4.6449 5.8061 11.6122 0.0144 Constraint 698 1772 5.8197 7.2746 14.5491 0.0144 Constraint 698 1748 5.9375 7.4219 14.8438 0.0144 Constraint 698 1620 6.3458 7.9323 15.8646 0.0144 Constraint 690 1772 4.8061 6.0076 12.0152 0.0144 Constraint 690 1764 5.9129 7.3911 14.7823 0.0144 Constraint 690 1739 3.6685 4.5856 9.1712 0.0144 Constraint 690 1276 4.0067 5.0084 10.0168 0.0144 Constraint 681 1301 6.1135 7.6419 15.2838 0.0144 Constraint 681 1276 6.1370 7.6713 15.3426 0.0144 Constraint 681 1260 5.7586 7.1983 14.3966 0.0144 Constraint 681 1141 5.0476 6.3095 12.6189 0.0144 Constraint 681 1109 3.8530 4.8163 9.6325 0.0144 Constraint 673 1772 4.1048 5.1310 10.2619 0.0144 Constraint 665 1416 6.0822 7.6027 15.2055 0.0144 Constraint 657 1334 5.3092 6.6365 13.2730 0.0144 Constraint 657 1301 4.0447 5.0559 10.1118 0.0144 Constraint 623 1334 5.3012 6.6265 13.2530 0.0144 Constraint 616 731 5.7395 7.1743 14.3487 0.0144 Constraint 608 731 4.5321 5.6652 11.3304 0.0144 Constraint 579 1141 4.0247 5.0308 10.0617 0.0144 Constraint 572 1620 4.8557 6.0696 12.1392 0.0144 Constraint 572 1556 4.8004 6.0005 12.0010 0.0144 Constraint 572 1141 6.1679 7.7099 15.4197 0.0144 Constraint 538 1587 4.6715 5.8394 11.6787 0.0144 Constraint 538 1556 6.1944 7.7430 15.4860 0.0144 Constraint 538 1455 5.4995 6.8743 13.7487 0.0144 Constraint 538 1416 6.1909 7.7386 15.4773 0.0144 Constraint 538 1068 4.6667 5.8334 11.6668 0.0144 Constraint 530 1284 4.8825 6.1031 12.2062 0.0144 Constraint 510 1620 4.8573 6.0717 12.1434 0.0144 Constraint 510 1100 4.8757 6.0946 12.1893 0.0144 Constraint 479 1133 5.8265 7.2832 14.5663 0.0144 Constraint 466 1035 4.4977 5.6221 11.2443 0.0144 Constraint 466 783 4.0761 5.0951 10.1902 0.0144 Constraint 457 1228 4.8442 6.0553 12.1106 0.0144 Constraint 457 783 6.0603 7.5753 15.1506 0.0144 Constraint 435 1068 4.4407 5.5509 11.1017 0.0144 Constraint 435 1035 6.0505 7.5631 15.1262 0.0144 Constraint 435 1008 5.7948 7.2435 14.4870 0.0144 Constraint 435 818 4.4410 5.5513 11.1025 0.0144 Constraint 429 1251 4.7001 5.8751 11.7503 0.0144 Constraint 429 1014 6.3950 7.9938 15.9875 0.0144 Constraint 412 1092 4.6396 5.7995 11.5991 0.0144 Constraint 412 1030 4.8557 6.0696 12.1392 0.0144 Constraint 412 1014 4.8012 6.0014 12.0029 0.0144 Constraint 403 1284 4.9220 6.1525 12.3050 0.0144 Constraint 403 1035 4.7546 5.9432 11.8864 0.0144 Constraint 403 1014 4.5877 5.7346 11.4692 0.0144 Constraint 403 1008 4.4204 5.5255 11.0510 0.0144 Constraint 403 980 5.6934 7.1168 14.2336 0.0144 Constraint 403 761 5.8640 7.3300 14.6600 0.0144 Constraint 403 756 5.7563 7.1953 14.3907 0.0144 Constraint 392 1014 5.8980 7.3725 14.7450 0.0144 Constraint 384 980 5.5794 6.9742 13.9485 0.0144 Constraint 384 756 5.5967 6.9959 13.9918 0.0144 Constraint 375 1008 5.5738 6.9673 13.9346 0.0144 Constraint 375 988 5.1478 6.4347 12.8694 0.0144 Constraint 363 1764 4.3721 5.4651 10.9302 0.0144 Constraint 355 1077 4.8182 6.0227 12.0455 0.0144 Constraint 355 1035 5.1023 6.3778 12.7557 0.0144 Constraint 355 722 4.7932 5.9915 11.9830 0.0144 Constraint 347 955 5.5593 6.9491 13.8982 0.0144 Constraint 347 698 4.3353 5.4191 10.8382 0.0144 Constraint 333 1109 5.4520 6.8151 13.6301 0.0144 Constraint 325 1772 6.1459 7.6824 15.3648 0.0144 Constraint 325 1764 3.2152 4.0190 8.0381 0.0144 Constraint 325 1731 5.0358 6.2947 12.5895 0.0144 Constraint 314 1408 5.7808 7.2260 14.4520 0.0144 Constraint 314 1141 5.6151 7.0189 14.0377 0.0144 Constraint 306 1408 5.0106 6.2632 12.5264 0.0144 Constraint 306 1366 5.0654 6.3317 12.6635 0.0144 Constraint 306 1149 6.2806 7.8508 15.7016 0.0144 Constraint 306 1046 6.1002 7.6253 15.2505 0.0144 Constraint 306 1022 5.0654 6.3317 12.6635 0.0144 Constraint 306 908 5.7280 7.1600 14.3199 0.0144 Constraint 306 859 4.0353 5.0441 10.0882 0.0144 Constraint 299 1683 4.9256 6.1571 12.3141 0.0144 Constraint 299 1678 5.4697 6.8371 13.6742 0.0144 Constraint 299 1634 6.3850 7.9813 15.9625 0.0144 Constraint 299 1149 4.2378 5.2973 10.5945 0.0144 Constraint 299 1133 5.2477 6.5596 13.1192 0.0144 Constraint 299 1054 5.3732 6.7165 13.4330 0.0144 Constraint 274 1772 5.7845 7.2306 14.4612 0.0144 Constraint 274 1731 4.4352 5.5440 11.0880 0.0144 Constraint 274 1678 4.4352 5.5440 11.0880 0.0144 Constraint 274 1471 6.0682 7.5853 15.1705 0.0144 Constraint 274 1343 3.7594 4.6992 9.3985 0.0144 Constraint 274 1268 5.3154 6.6443 13.2886 0.0144 Constraint 263 1772 3.2955 4.1193 8.2387 0.0144 Constraint 263 1739 3.8192 4.7740 9.5480 0.0144 Constraint 263 1731 4.7744 5.9681 11.9361 0.0144 Constraint 263 1683 3.8331 4.7914 9.5827 0.0144 Constraint 263 1678 4.7744 5.9681 11.9361 0.0144 Constraint 263 1657 2.8135 3.5168 7.0336 0.0144 Constraint 263 1634 4.7204 5.9005 11.8010 0.0144 Constraint 256 1772 5.8122 7.2653 14.5306 0.0144 Constraint 249 1772 3.3200 4.1500 8.2999 0.0144 Constraint 249 1748 5.6800 7.1000 14.2000 0.0144 Constraint 249 908 4.5671 5.7088 11.4177 0.0144 Constraint 233 1068 6.3382 7.9227 15.8455 0.0144 Constraint 233 930 5.6617 7.0771 14.1543 0.0144 Constraint 227 1503 3.2869 4.1086 8.2172 0.0144 Constraint 227 1494 3.9957 4.9946 9.9892 0.0144 Constraint 227 1471 5.7458 7.1822 14.3645 0.0144 Constraint 227 997 5.1206 6.4008 12.8016 0.0144 Constraint 227 792 5.5333 6.9166 13.8332 0.0144 Constraint 222 1466 4.6342 5.7928 11.5856 0.0144 Constraint 222 1447 5.2236 6.5294 13.0589 0.0144 Constraint 222 1416 3.2043 4.0054 8.0109 0.0144 Constraint 222 908 4.9698 6.2122 12.4244 0.0144 Constraint 222 899 4.7419 5.9274 11.8548 0.0144 Constraint 222 792 3.4004 4.2505 8.5011 0.0144 Constraint 222 761 5.8402 7.3003 14.6006 0.0144 Constraint 216 1427 5.6942 7.1178 14.2355 0.0144 Constraint 208 1471 6.2211 7.7764 15.5527 0.0144 Constraint 208 1408 6.0342 7.5427 15.0854 0.0144 Constraint 208 1343 6.2294 7.7867 15.5735 0.0144 Constraint 208 1220 3.8391 4.7989 9.5979 0.0144 Constraint 208 1204 5.2998 6.6247 13.2494 0.0144 Constraint 208 930 6.2586 7.8232 15.6465 0.0144 Constraint 208 892 4.7777 5.9721 11.9442 0.0144 Constraint 208 884 6.2520 7.8150 15.6300 0.0144 Constraint 208 868 3.8333 4.7916 9.5832 0.0144 Constraint 208 731 5.8700 7.3375 14.6750 0.0144 Constraint 196 1503 6.2811 7.8513 15.7027 0.0144 Constraint 196 1416 5.4035 6.7544 13.5087 0.0144 Constraint 196 1100 6.3182 7.8977 15.7954 0.0144 Constraint 196 930 4.2923 5.3654 10.7308 0.0144 Constraint 196 892 5.3674 6.7093 13.4185 0.0144 Constraint 196 673 6.3839 7.9798 15.9597 0.0144 Constraint 189 1772 5.0564 6.3205 12.6410 0.0144 Constraint 189 1748 3.3132 4.1415 8.2830 0.0144 Constraint 189 1739 3.9928 4.9910 9.9820 0.0144 Constraint 189 1479 4.1251 5.1563 10.3127 0.0144 Constraint 180 1748 4.3215 5.4018 10.8037 0.0144 Constraint 180 690 5.7538 7.1922 14.3844 0.0144 Constraint 180 639 4.1411 5.1764 10.3527 0.0144 Constraint 164 1748 6.2607 7.8259 15.6519 0.0144 Constraint 164 1739 6.3862 7.9828 15.9655 0.0144 Constraint 164 1714 4.3849 5.4811 10.9622 0.0144 Constraint 164 1479 6.3218 7.9022 15.8044 0.0144 Constraint 164 1447 4.2837 5.3546 10.7093 0.0144 Constraint 164 1438 4.9491 6.1864 12.3728 0.0144 Constraint 164 1309 5.1332 6.4166 12.8331 0.0144 Constraint 164 479 6.1056 7.6320 15.2640 0.0144 Constraint 164 325 5.0175 6.2719 12.5438 0.0144 Constraint 154 1748 3.7075 4.6344 9.2688 0.0144 Constraint 154 1739 5.9657 7.4572 14.9144 0.0144 Constraint 154 1731 3.8107 4.7634 9.5268 0.0144 Constraint 154 1720 4.1104 5.1380 10.2760 0.0144 Constraint 154 1714 3.7256 4.6570 9.3140 0.0144 Constraint 154 325 5.7714 7.2143 14.4286 0.0144 Constraint 128 1720 6.3881 7.9851 15.9702 0.0144 Constraint 128 1714 3.4131 4.2663 8.5326 0.0144 Constraint 128 1683 4.7194 5.8993 11.7985 0.0144 Constraint 128 1678 4.4580 5.5725 11.1449 0.0144 Constraint 128 1657 4.0761 5.0951 10.1901 0.0144 Constraint 128 1408 4.9132 6.1415 12.2830 0.0144 Constraint 128 1158 3.8887 4.8608 9.7217 0.0144 Constraint 128 1022 5.1790 6.4738 12.9475 0.0144 Constraint 128 988 6.0481 7.5601 15.1202 0.0144 Constraint 128 963 5.0996 6.3746 12.7491 0.0144 Constraint 121 1683 4.1391 5.1738 10.3476 0.0144 Constraint 121 1678 4.9367 6.1709 12.3418 0.0144 Constraint 121 1657 5.2345 6.5431 13.0861 0.0144 Constraint 121 1603 5.0979 6.3724 12.7449 0.0144 Constraint 112 1683 4.5736 5.7169 11.4339 0.0144 Constraint 112 1657 5.6924 7.1155 14.2311 0.0144 Constraint 112 1603 5.7830 7.2288 14.4575 0.0144 Constraint 112 1575 5.4325 6.7906 13.5812 0.0144 Constraint 104 1683 4.1445 5.1806 10.3613 0.0144 Constraint 104 1567 4.0305 5.0381 10.0763 0.0144 Constraint 104 1541 5.6234 7.0292 14.0585 0.0144 Constraint 104 1455 5.8776 7.3470 14.6941 0.0144 Constraint 104 1325 6.0161 7.5201 15.0403 0.0144 Constraint 104 1301 4.8864 6.1080 12.2161 0.0144 Constraint 104 1293 4.4308 5.5385 11.0770 0.0144 Constraint 104 1268 3.8754 4.8442 9.6884 0.0144 Constraint 97 1657 5.2345 6.5431 13.0861 0.0144 Constraint 97 1567 5.8751 7.3438 14.6876 0.0144 Constraint 97 1455 3.3170 4.1463 8.2926 0.0144 Constraint 97 1301 3.8162 4.7702 9.5405 0.0144 Constraint 97 1246 5.8997 7.3747 14.7493 0.0144 Constraint 91 1678 6.1643 7.7054 15.4108 0.0144 Constraint 91 1662 6.1617 7.7021 15.4042 0.0144 Constraint 91 1657 5.4818 6.8523 13.7046 0.0144 Constraint 91 1455 5.8328 7.2909 14.5819 0.0144 Constraint 82 1657 4.2519 5.3149 10.6298 0.0144 Constraint 82 1634 4.1278 5.1597 10.3194 0.0144 Constraint 82 1466 6.3257 7.9072 15.8143 0.0144 Constraint 82 1455 3.3067 4.1333 8.2667 0.0144 Constraint 82 1427 5.6270 7.0337 14.0675 0.0144 Constraint 82 1301 3.7499 4.6874 9.3748 0.0144 Constraint 82 1276 5.7847 7.2309 14.4618 0.0144 Constraint 82 1268 5.2385 6.5481 13.0962 0.0144 Constraint 82 829 6.3309 7.9136 15.8272 0.0144 Constraint 77 1683 4.7095 5.8869 11.7738 0.0144 Constraint 77 1678 4.3859 5.4824 10.9647 0.0144 Constraint 77 921 4.7979 5.9974 11.9948 0.0144 Constraint 66 1683 3.8848 4.8560 9.7119 0.0144 Constraint 66 1662 4.0819 5.1024 10.2047 0.0144 Constraint 59 1683 4.5885 5.7356 11.4712 0.0144 Constraint 59 1678 4.5947 5.7434 11.4868 0.0144 Constraint 59 1293 5.8685 7.3356 14.6713 0.0144 Constraint 59 1268 4.9400 6.1750 12.3501 0.0144 Constraint 47 921 4.8252 6.0315 12.0630 0.0144 Constraint 39 1260 5.5288 6.9110 13.8221 0.0144 Constraint 39 1109 6.3842 7.9803 15.9605 0.0144 Constraint 39 836 5.6253 7.0316 14.0632 0.0144 Constraint 33 1334 6.0747 7.5934 15.1868 0.0144 Constraint 33 1325 5.1509 6.4386 12.8773 0.0144 Constraint 33 1068 6.1002 7.6253 15.2506 0.0144 Constraint 33 988 6.1131 7.6414 15.2828 0.0144 Constraint 33 980 5.1380 6.4225 12.8449 0.0144 Constraint 25 1358 3.4175 4.2718 8.5437 0.0144 Constraint 25 1334 3.9522 4.9402 9.8805 0.0144 Constraint 25 1325 3.9525 4.9406 9.8812 0.0144 Constraint 25 988 4.0238 5.0297 10.0594 0.0144 Constraint 25 980 3.8995 4.8744 9.7489 0.0144 Constraint 18 1634 4.4279 5.5348 11.0697 0.0144 Constraint 18 1466 6.3228 7.9034 15.8069 0.0144 Constraint 18 1427 5.6659 7.0824 14.1647 0.0144 Constraint 18 1334 4.6695 5.8369 11.6738 0.0144 Constraint 18 1301 5.6561 7.0701 14.1403 0.0144 Constraint 18 1117 4.7222 5.9027 11.8055 0.0144 Constraint 18 1084 3.7900 4.7375 9.4750 0.0144 Constraint 11 1117 3.8162 4.7702 9.5405 0.0144 Constraint 11 1109 4.8364 6.0455 12.0911 0.0144 Constraint 3 1014 4.4424 5.5530 11.1061 0.0144 Constraint 3 988 6.2020 7.7524 15.5049 0.0144 Constraint 3 980 5.1231 6.4039 12.8077 0.0144 Constraint 3 955 4.4424 5.5531 11.1061 0.0144 Constraint 3 208 6.0779 7.5973 15.1947 0.0144 Constraint 1634 1714 6.1442 7.6802 15.3604 0.0139 Constraint 1567 1657 6.3600 7.9501 15.9001 0.0139 Constraint 1494 1739 6.0512 7.5640 15.1280 0.0139 Constraint 1479 1720 5.0837 6.3546 12.7092 0.0139 Constraint 1466 1703 4.5913 5.7392 11.4783 0.0139 Constraint 1455 1748 6.1798 7.7247 15.4494 0.0139 Constraint 1366 1772 4.4350 5.5438 11.0876 0.0139 Constraint 1366 1764 4.5203 5.6504 11.3008 0.0139 Constraint 1366 1756 4.7586 5.9483 11.8965 0.0139 Constraint 1343 1692 5.7624 7.2030 14.4061 0.0139 Constraint 1343 1678 3.9385 4.9232 9.8463 0.0139 Constraint 1343 1657 3.9385 4.9232 9.8463 0.0139 Constraint 1343 1634 3.1735 3.9668 7.9337 0.0139 Constraint 1334 1683 5.8988 7.3735 14.7470 0.0139 Constraint 1284 1714 5.0838 6.3547 12.7094 0.0139 Constraint 1246 1427 4.3250 5.4063 10.8125 0.0139 Constraint 1228 1416 4.7280 5.9100 11.8199 0.0139 Constraint 1220 1416 4.5228 5.6535 11.3070 0.0139 Constraint 1220 1408 4.7253 5.9066 11.8133 0.0139 Constraint 1220 1399 6.0491 7.5613 15.1226 0.0139 Constraint 1204 1399 5.8864 7.3580 14.7160 0.0139 Constraint 1178 1408 4.8178 6.0222 12.0444 0.0139 Constraint 1178 1399 4.4442 5.5552 11.1105 0.0139 Constraint 1117 1634 4.1858 5.2322 10.4645 0.0139 Constraint 1117 1351 3.5944 4.4930 8.9860 0.0139 Constraint 1092 1351 6.1900 7.7375 15.4750 0.0139 Constraint 1022 1670 6.0500 7.5624 15.1249 0.0139 Constraint 1014 1246 4.4898 5.6122 11.2244 0.0139 Constraint 980 1366 5.9359 7.4199 14.8397 0.0139 Constraint 968 1479 6.0518 7.5648 15.1295 0.0139 Constraint 963 1141 3.9459 4.9324 9.8648 0.0139 Constraint 955 1100 4.9045 6.1306 12.2612 0.0139 Constraint 955 1068 5.4249 6.7812 13.5623 0.0139 Constraint 899 1133 4.8736 6.0920 12.1841 0.0139 Constraint 899 1100 4.8789 6.0986 12.1972 0.0139 Constraint 884 1455 6.2002 7.7502 15.5005 0.0139 Constraint 884 1077 4.4768 5.5960 11.1921 0.0139 Constraint 884 1008 4.9435 6.1794 12.3588 0.0139 Constraint 868 1133 6.1465 7.6831 15.3662 0.0139 Constraint 818 1756 4.4286 5.5357 11.0714 0.0139 Constraint 818 1731 4.5812 5.7266 11.4531 0.0139 Constraint 818 1109 5.2060 6.5076 13.0151 0.0139 Constraint 800 1777 6.0226 7.5283 15.0565 0.0139 Constraint 792 1788 5.0256 6.2819 12.5639 0.0139 Constraint 792 1777 4.6141 5.7676 11.5352 0.0139 Constraint 792 1731 6.2906 7.8632 15.7264 0.0139 Constraint 783 1756 5.9396 7.4245 14.8489 0.0139 Constraint 783 1620 6.0494 7.5617 15.1235 0.0139 Constraint 783 1382 4.4333 5.5416 11.0832 0.0139 Constraint 778 1777 6.3968 7.9960 15.9920 0.0139 Constraint 778 1764 5.5457 6.9321 13.8642 0.0139 Constraint 778 1756 5.0404 6.3005 12.6009 0.0139 Constraint 778 1748 5.2860 6.6076 13.2151 0.0139 Constraint 761 1309 6.2636 7.8295 15.6589 0.0139 Constraint 748 1334 4.7520 5.9400 11.8799 0.0139 Constraint 748 1246 4.5492 5.6865 11.3729 0.0139 Constraint 739 1246 5.4243 6.7804 13.5608 0.0139 Constraint 713 1309 5.3946 6.7433 13.4866 0.0139 Constraint 706 1077 4.9887 6.2359 12.4718 0.0139 Constraint 706 1008 3.5176 4.3970 8.7940 0.0139 Constraint 706 963 3.6742 4.5927 9.1855 0.0139 Constraint 681 1309 4.2034 5.2542 10.5084 0.0139 Constraint 681 1246 5.4768 6.8460 13.6921 0.0139 Constraint 681 1239 4.6173 5.7717 11.5433 0.0139 Constraint 681 997 6.3443 7.9304 15.8608 0.0139 Constraint 673 930 5.6397 7.0496 14.0992 0.0139 Constraint 665 748 5.0076 6.2595 12.5190 0.0139 Constraint 650 1334 3.0791 3.8489 7.6977 0.0139 Constraint 650 930 5.8994 7.3742 14.7485 0.0139 Constraint 639 1309 6.2576 7.8221 15.6441 0.0139 Constraint 608 1382 4.8945 6.1181 12.2362 0.0139 Constraint 608 1358 4.1496 5.1871 10.3741 0.0139 Constraint 608 1351 5.1850 6.4813 12.9626 0.0139 Constraint 597 1358 6.1949 7.7436 15.4872 0.0139 Constraint 597 963 5.2785 6.5981 13.1962 0.0139 Constraint 572 1739 4.8555 6.0694 12.1389 0.0139 Constraint 572 1382 6.1968 7.7460 15.4920 0.0139 Constraint 549 1427 5.4127 6.7659 13.5319 0.0139 Constraint 549 876 3.4477 4.3097 8.6194 0.0139 Constraint 538 1739 4.5678 5.7098 11.4196 0.0139 Constraint 530 1748 5.3923 6.7403 13.4807 0.0139 Constraint 530 1739 5.4179 6.7724 13.5447 0.0139 Constraint 510 769 4.8412 6.0515 12.1029 0.0139 Constraint 501 1777 4.6503 5.8129 11.6257 0.0139 Constraint 501 1756 3.7439 4.6799 9.3598 0.0139 Constraint 501 1748 6.1900 7.7376 15.4751 0.0139 Constraint 501 1739 6.2603 7.8254 15.6508 0.0139 Constraint 501 1670 3.7953 4.7442 9.4883 0.0139 Constraint 493 1756 5.6845 7.1056 14.2112 0.0139 Constraint 487 1748 5.3029 6.6286 13.2573 0.0139 Constraint 487 1670 5.0614 6.3268 12.6536 0.0139 Constraint 487 1662 5.2925 6.6156 13.2311 0.0139 Constraint 487 1301 5.0392 6.2990 12.5980 0.0139 Constraint 487 657 6.0336 7.5419 15.0839 0.0139 Constraint 479 616 3.9117 4.8896 9.7792 0.0139 Constraint 457 1455 6.2072 7.7589 15.5179 0.0139 Constraint 457 761 6.0994 7.6242 15.2485 0.0139 Constraint 457 731 3.9365 4.9207 9.8413 0.0139 Constraint 384 1416 4.9982 6.2477 12.4954 0.0139 Constraint 368 1777 6.0566 7.5707 15.1415 0.0139 Constraint 363 1788 5.0256 6.2819 12.5639 0.0139 Constraint 363 1777 4.6141 5.7676 11.5352 0.0139 Constraint 363 1756 3.6981 4.6226 9.2452 0.0139 Constraint 363 1447 4.0534 5.0667 10.1334 0.0139 Constraint 355 1756 5.8063 7.2579 14.5158 0.0139 Constraint 355 1416 4.9312 6.1640 12.3279 0.0139 Constraint 355 1408 4.0446 5.0557 10.1115 0.0139 Constraint 355 1382 4.4836 5.6046 11.2091 0.0139 Constraint 355 1343 5.8323 7.2903 14.5806 0.0139 Constraint 347 1777 6.2179 7.7723 15.5446 0.0139 Constraint 347 1756 5.0397 6.2996 12.5993 0.0139 Constraint 347 1748 5.3399 6.6749 13.3498 0.0139 Constraint 347 1720 5.7709 7.2136 14.4273 0.0139 Constraint 347 1301 5.2692 6.5865 13.1729 0.0139 Constraint 333 1301 5.8280 7.2850 14.5699 0.0139 Constraint 325 1309 6.0695 7.5869 15.1738 0.0139 Constraint 325 1301 4.3931 5.4914 10.9828 0.0139 Constraint 314 665 5.2324 6.5405 13.0809 0.0139 Constraint 314 597 3.9554 4.9443 9.8885 0.0139 Constraint 314 579 6.0432 7.5541 15.1081 0.0139 Constraint 306 589 5.1226 6.4033 12.8066 0.0139 Constraint 299 403 5.3075 6.6343 13.2687 0.0139 Constraint 274 616 6.3891 7.9863 15.9726 0.0139 Constraint 189 1575 5.1622 6.4527 12.9055 0.0139 Constraint 189 466 5.4878 6.8598 13.7196 0.0139 Constraint 180 1548 4.1322 5.1652 10.3304 0.0139 Constraint 180 1511 6.3523 7.9403 15.8807 0.0139 Constraint 180 1488 5.4243 6.7804 13.5608 0.0139 Constraint 145 1575 2.9580 3.6976 7.3951 0.0139 Constraint 136 448 3.7332 4.6665 9.3330 0.0139 Constraint 128 1575 4.9581 6.1977 12.3953 0.0139 Constraint 112 448 3.9228 4.9035 9.8070 0.0139 Constraint 104 1596 5.2041 6.5051 13.0103 0.0139 Constraint 104 1587 5.9733 7.4666 14.9332 0.0139 Constraint 104 448 3.4953 4.3692 8.7383 0.0139 Constraint 104 435 6.0341 7.5427 15.0854 0.0139 Constraint 97 1603 6.1536 7.6920 15.3841 0.0139 Constraint 82 1603 3.9325 4.9156 9.8312 0.0139 Constraint 77 1611 5.9587 7.4484 14.8968 0.0139 Constraint 77 1603 3.5586 4.4483 8.8966 0.0139 Constraint 66 1634 6.1257 7.6572 15.3143 0.0139 Constraint 47 443 6.3165 7.8956 15.7912 0.0139 Constraint 33 294 5.2677 6.5846 13.1692 0.0139 Constraint 3 256 4.3285 5.4106 10.8212 0.0139 Constraint 1587 1739 5.3141 6.6426 13.2851 0.0137 Constraint 1503 1683 5.6645 7.0806 14.1613 0.0137 Constraint 1334 1447 5.6964 7.1206 14.2411 0.0137 Constraint 1276 1596 4.0690 5.0862 10.1725 0.0137 Constraint 1276 1587 6.3810 7.9763 15.9525 0.0137 Constraint 1213 1455 5.1173 6.3966 12.7933 0.0137 Constraint 1149 1596 5.5063 6.8829 13.7658 0.0137 Constraint 1133 1788 5.9346 7.4183 14.8366 0.0137 Constraint 1109 1556 5.2454 6.5568 13.1136 0.0137 Constraint 1092 1788 6.1157 7.6447 15.2894 0.0137 Constraint 1084 1788 4.8330 6.0413 12.0825 0.0137 Constraint 1068 1416 4.2525 5.3157 10.6313 0.0137 Constraint 1014 1399 4.6365 5.7956 11.5913 0.0137 Constraint 884 1260 6.0916 7.6145 15.2289 0.0137 Constraint 868 1556 5.4205 6.7757 13.5514 0.0137 Constraint 868 1167 6.1976 7.7470 15.4941 0.0137 Constraint 836 1466 3.8875 4.8594 9.7189 0.0137 Constraint 808 1548 4.2477 5.3097 10.6193 0.0137 Constraint 783 1109 5.5393 6.9241 13.8482 0.0137 Constraint 769 1068 4.6616 5.8270 11.6540 0.0137 Constraint 690 997 4.3309 5.4136 10.8273 0.0137 Constraint 665 1670 6.2549 7.8186 15.6373 0.0137 Constraint 657 1068 3.3740 4.2175 8.4349 0.0137 Constraint 657 748 4.8577 6.0722 12.1444 0.0137 Constraint 639 1228 5.9394 7.4243 14.8485 0.0137 Constraint 630 1309 4.4477 5.5596 11.1193 0.0137 Constraint 630 1228 3.4461 4.3076 8.6152 0.0137 Constraint 630 1204 3.9131 4.8913 9.7827 0.0137 Constraint 608 1541 3.1314 3.9142 7.8284 0.0137 Constraint 608 800 3.8634 4.8292 9.6584 0.0137 Constraint 608 778 4.0917 5.1147 10.2294 0.0137 Constraint 597 761 3.6173 4.5216 9.0432 0.0137 Constraint 589 1014 3.7295 4.6619 9.3238 0.0137 Constraint 579 1022 3.5616 4.4520 8.9041 0.0137 Constraint 572 1479 6.0994 7.6243 15.2486 0.0137 Constraint 564 1022 6.0565 7.5706 15.1412 0.0137 Constraint 549 1022 6.2159 7.7699 15.5399 0.0137 Constraint 549 963 4.4765 5.5957 11.1913 0.0137 Constraint 549 884 6.3953 7.9941 15.9882 0.0137 Constraint 538 876 6.3353 7.9191 15.8382 0.0137 Constraint 538 739 4.3753 5.4692 10.9383 0.0137 Constraint 530 980 4.9006 6.1257 12.2514 0.0137 Constraint 530 739 5.9069 7.3837 14.7673 0.0137 Constraint 510 963 6.1208 7.6509 15.3019 0.0137 Constraint 493 1109 6.3728 7.9660 15.9320 0.0137 Constraint 487 1100 5.0286 6.2857 12.5714 0.0137 Constraint 487 1068 4.6300 5.7875 11.5750 0.0137 Constraint 479 1788 5.3449 6.6811 13.3621 0.0137 Constraint 457 1068 5.7270 7.1587 14.3174 0.0137 Constraint 457 908 6.3517 7.9397 15.8794 0.0137 Constraint 457 884 5.8453 7.3066 14.6132 0.0137 Constraint 448 1068 4.8693 6.0866 12.1732 0.0137 Constraint 443 690 5.3542 6.6927 13.3855 0.0137 Constraint 435 623 6.2856 7.8570 15.7140 0.0137 Constraint 429 1046 4.8426 6.0532 12.1065 0.0137 Constraint 403 818 4.6074 5.7593 11.5186 0.0137 Constraint 333 792 4.7579 5.9474 11.8948 0.0137 Constraint 285 681 5.4034 6.7542 13.5084 0.0137 Constraint 263 1611 4.2872 5.3589 10.7179 0.0137 Constraint 256 1731 4.4221 5.5277 11.0553 0.0137 Constraint 256 1703 5.5682 6.9603 13.9205 0.0137 Constraint 256 1167 4.3590 5.4487 10.8974 0.0137 Constraint 241 1611 6.2375 7.7969 15.5938 0.0137 Constraint 241 650 5.9918 7.4897 14.9794 0.0137 Constraint 233 1720 5.0464 6.3080 12.6160 0.0137 Constraint 233 1692 5.2190 6.5237 13.0475 0.0137 Constraint 233 1620 4.2979 5.3723 10.7446 0.0137 Constraint 233 1587 6.2659 7.8324 15.6648 0.0137 Constraint 227 1587 5.0264 6.2830 12.5661 0.0137 Constraint 216 1692 4.7799 5.9749 11.9498 0.0137 Constraint 216 1670 5.6010 7.0013 14.0025 0.0137 Constraint 216 1125 5.1744 6.4680 12.9360 0.0137 Constraint 216 681 5.8974 7.3718 14.7435 0.0137 Constraint 216 657 3.8643 4.8304 9.6608 0.0137 Constraint 208 1634 4.3523 5.4404 10.8808 0.0137 Constraint 208 1620 5.5363 6.9204 13.8407 0.0137 Constraint 208 1611 5.6395 7.0494 14.0988 0.0137 Constraint 208 1603 4.3453 5.4317 10.8633 0.0137 Constraint 208 1587 5.4805 6.8506 13.7012 0.0137 Constraint 208 1567 5.3665 6.7081 13.4163 0.0137 Constraint 208 1158 5.2161 6.5201 13.0402 0.0137 Constraint 208 1125 4.3060 5.3825 10.7650 0.0137 Constraint 196 1125 4.4381 5.5476 11.0953 0.0137 Constraint 180 1603 6.3153 7.8941 15.7883 0.0137 Constraint 180 1301 3.8025 4.7531 9.5063 0.0137 Constraint 180 1293 6.2383 7.7979 15.5959 0.0137 Constraint 180 1158 6.2316 7.7895 15.5789 0.0137 Constraint 180 868 5.6116 7.0146 14.0291 0.0137 Constraint 180 859 4.2693 5.3366 10.6732 0.0137 Constraint 172 1611 4.2739 5.3423 10.6847 0.0137 Constraint 172 1587 4.1659 5.2074 10.4148 0.0137 Constraint 154 1309 4.2118 5.2648 10.5295 0.0137 Constraint 136 1634 6.0868 7.6085 15.2169 0.0137 Constraint 128 314 5.1180 6.3976 12.7951 0.0137 Constraint 112 868 6.3977 7.9972 15.9943 0.0137 Constraint 104 479 6.1322 7.6653 15.3306 0.0137 Constraint 104 375 5.3691 6.7114 13.4228 0.0137 Constraint 97 1670 5.2820 6.6025 13.2051 0.0137 Constraint 97 1649 4.8368 6.0460 12.0920 0.0137 Constraint 97 285 4.9704 6.2131 12.4261 0.0137 Constraint 91 1670 6.1095 7.6369 15.2738 0.0137 Constraint 91 1649 3.9739 4.9674 9.9348 0.0137 Constraint 91 421 5.6890 7.1113 14.2225 0.0137 Constraint 77 510 4.5170 5.6462 11.2925 0.0137 Constraint 77 501 3.7719 4.7149 9.4297 0.0137 Constraint 77 412 4.3868 5.4835 10.9670 0.0137 Constraint 77 363 5.8448 7.3060 14.6120 0.0137 Constraint 77 355 4.3844 5.4805 10.9609 0.0137 Constraint 66 1670 5.2279 6.5348 13.0696 0.0137 Constraint 66 1649 6.2071 7.7589 15.5178 0.0137 Constraint 66 1620 5.9313 7.4141 14.8282 0.0137 Constraint 66 392 4.8269 6.0336 12.0672 0.0137 Constraint 59 1788 6.3025 7.8781 15.7563 0.0137 Constraint 59 510 5.9730 7.4663 14.9326 0.0137 Constraint 47 1748 6.3749 7.9687 15.9373 0.0137 Constraint 47 375 5.6187 7.0234 14.0467 0.0137 Constraint 39 1670 5.6604 7.0755 14.1511 0.0137 Constraint 39 1662 4.2866 5.3583 10.7166 0.0137 Constraint 33 1662 4.3202 5.4003 10.8006 0.0137 Constraint 33 355 6.2366 7.7958 15.5915 0.0137 Constraint 33 325 5.9643 7.4553 14.9107 0.0137 Constraint 25 1649 5.6042 7.0052 14.0105 0.0137 Constraint 25 355 5.9493 7.4366 14.8732 0.0137 Constraint 25 314 5.0969 6.3711 12.7422 0.0137 Constraint 25 274 6.0106 7.5132 15.0264 0.0137 Constraint 18 1788 5.5766 6.9707 13.9414 0.0137 Constraint 18 1748 5.1341 6.4177 12.8353 0.0137 Constraint 18 325 5.6090 7.0112 14.0224 0.0137 Constraint 18 274 4.8235 6.0293 12.0587 0.0137 Constraint 11 1788 4.2594 5.3243 10.6485 0.0137 Constraint 11 1662 6.1709 7.7136 15.4272 0.0137 Constraint 11 299 6.3029 7.8786 15.7573 0.0137 Constraint 3 299 6.3456 7.9320 15.8641 0.0137 Constraint 3 274 6.0494 7.5617 15.1234 0.0137 Constraint 3 97 5.4961 6.8701 13.7402 0.0137 Constraint 3 82 4.8838 6.1048 12.2096 0.0137 Constraint 1334 1494 5.4941 6.8676 13.7352 0.0115 Constraint 1334 1466 3.7348 4.6685 9.3370 0.0115 Constraint 1059 1479 4.5088 5.6360 11.2719 0.0115 Constraint 1059 1455 5.7561 7.1952 14.3903 0.0115 Constraint 944 1511 5.7668 7.2085 14.4170 0.0115 Constraint 944 1503 4.3885 5.4856 10.9712 0.0115 Constraint 908 1533 4.2599 5.3249 10.6497 0.0115 Constraint 908 1494 5.2840 6.6050 13.2099 0.0115 Constraint 884 1575 6.3313 7.9142 15.8283 0.0115 Constraint 859 1587 5.7554 7.1943 14.3885 0.0115 Constraint 859 1556 3.9483 4.9353 9.8706 0.0115 Constraint 859 988 6.0848 7.6060 15.2121 0.0115 Constraint 848 1014 6.0309 7.5386 15.0772 0.0115 Constraint 836 1455 5.8500 7.3124 14.6249 0.0115 Constraint 808 1587 5.9649 7.4562 14.9123 0.0115 Constraint 808 1092 5.5718 6.9647 13.9294 0.0115 Constraint 783 1092 4.6793 5.8491 11.6982 0.0115 Constraint 761 1228 5.3337 6.6671 13.3343 0.0115 Constraint 761 1125 5.4713 6.8391 13.6782 0.0115 Constraint 761 1092 5.5758 6.9698 13.9396 0.0115 Constraint 690 1479 5.6594 7.0743 14.1485 0.0115 Constraint 657 1603 4.4454 5.5568 11.1136 0.0115 Constraint 657 1479 5.7699 7.2123 14.4247 0.0115 Constraint 657 1358 4.4648 5.5810 11.1619 0.0115 Constraint 650 1603 5.2921 6.6151 13.2302 0.0115 Constraint 650 1382 6.2591 7.8239 15.6478 0.0115 Constraint 650 1358 5.4094 6.7617 13.5235 0.0115 Constraint 623 1382 6.1061 7.6326 15.2651 0.0115 Constraint 597 1427 5.4434 6.8043 13.6085 0.0115 Constraint 572 1657 5.6216 7.0270 14.0541 0.0115 Constraint 572 1634 4.2078 5.2598 10.5196 0.0115 Constraint 572 1567 5.8031 7.2539 14.5078 0.0115 Constraint 564 1596 4.4263 5.5329 11.0658 0.0115 Constraint 564 1567 4.3130 5.3913 10.7825 0.0115 Constraint 564 1556 6.0811 7.6013 15.2026 0.0115 Constraint 549 1488 5.7880 7.2350 14.4699 0.0115 Constraint 549 1455 4.0027 5.0033 10.0066 0.0115 Constraint 538 1657 5.6626 7.0782 14.1564 0.0115 Constraint 538 1603 5.5119 6.8899 13.7799 0.0115 Constraint 538 1596 6.1306 7.6633 15.3265 0.0115 Constraint 530 1596 5.7608 7.2011 14.4021 0.0115 Constraint 510 1488 5.9334 7.4168 14.8336 0.0115 Constraint 510 1479 6.3871 7.9839 15.9677 0.0115 Constraint 487 944 5.5515 6.9394 13.8788 0.0115 Constraint 466 1541 5.1777 6.4721 12.9442 0.0115 Constraint 457 1567 5.8631 7.3289 14.6578 0.0115 Constraint 448 1596 4.4185 5.5231 11.0462 0.0115 Constraint 448 1567 4.3238 5.4047 10.8094 0.0115 Constraint 435 1657 5.6235 7.0294 14.0587 0.0115 Constraint 435 1634 4.0573 5.0716 10.1433 0.0115 Constraint 435 698 5.9334 7.4168 14.8335 0.0115 Constraint 403 1657 5.6670 7.0837 14.1674 0.0115 Constraint 403 731 5.2489 6.5612 13.1223 0.0115 Constraint 392 1739 5.0710 6.3387 12.6775 0.0115 Constraint 392 1692 3.7061 4.6326 9.2652 0.0115 Constraint 384 1714 5.8807 7.3508 14.7017 0.0115 Constraint 384 1692 5.9310 7.4137 14.8274 0.0115 Constraint 368 1739 4.6908 5.8635 11.7269 0.0115 Constraint 368 1731 3.0592 3.8240 7.6480 0.0115 Constraint 368 1720 5.8922 7.3652 14.7304 0.0115 Constraint 368 1703 6.0506 7.5633 15.1266 0.0115 Constraint 368 1692 3.2417 4.0521 8.1041 0.0115 Constraint 363 1731 6.0742 7.5927 15.1855 0.0115 Constraint 363 1720 5.7336 7.1670 14.3339 0.0115 Constraint 363 1714 3.5074 4.3843 8.7686 0.0115 Constraint 363 1703 5.9754 7.4693 14.9386 0.0115 Constraint 363 1692 3.6124 4.5155 9.0311 0.0115 Constraint 363 572 4.9126 6.1408 12.2816 0.0115 Constraint 347 1731 5.5350 6.9187 13.8374 0.0115 Constraint 347 1567 6.1135 7.6419 15.2839 0.0115 Constraint 347 1541 5.1124 6.3905 12.7809 0.0115 Constraint 333 1731 4.2167 5.2709 10.5419 0.0115 Constraint 333 1720 4.1469 5.1836 10.3672 0.0115 Constraint 333 1714 5.5400 6.9250 13.8501 0.0115 Constraint 333 1703 4.3425 5.4282 10.8563 0.0115 Constraint 333 1692 5.5834 6.9793 13.9585 0.0115 Constraint 333 572 4.4000 5.5000 11.0000 0.0115 Constraint 325 1575 6.1000 7.6250 15.2499 0.0115 Constraint 306 1455 6.2594 7.8243 15.6486 0.0115 Constraint 306 1427 4.9656 6.2070 12.4140 0.0115 Constraint 306 1416 4.9656 6.2070 12.4140 0.0115 Constraint 306 1391 6.2805 7.8507 15.7013 0.0115 Constraint 299 1575 6.0628 7.5785 15.1569 0.0115 Constraint 299 1416 4.4158 5.5198 11.0396 0.0115 Constraint 299 1391 5.9756 7.4695 14.9389 0.0115 Constraint 299 1382 5.9888 7.4860 14.9721 0.0115 Constraint 285 1575 6.0792 7.5990 15.1980 0.0115 Constraint 285 608 4.0338 5.0422 10.0845 0.0115 Constraint 274 1714 3.6821 4.6026 9.2053 0.0115 Constraint 274 1567 6.0201 7.5251 15.0502 0.0115 Constraint 274 1488 6.3866 7.9833 15.9666 0.0115 Constraint 274 1427 5.6962 7.1203 14.2406 0.0115 Constraint 274 1416 5.6962 7.1203 14.2406 0.0115 Constraint 263 1714 5.8475 7.3094 14.6189 0.0115 Constraint 263 572 6.2916 7.8646 15.7291 0.0115 Constraint 249 1731 3.0994 3.8743 7.7485 0.0115 Constraint 249 1720 5.9670 7.4588 14.9176 0.0115 Constraint 249 1657 5.1182 6.3978 12.7956 0.0115 Constraint 249 1548 5.1424 6.4279 12.8559 0.0115 Constraint 249 1541 5.2388 6.5485 13.0970 0.0115 Constraint 241 1731 6.0729 7.5912 15.1823 0.0115 Constraint 241 1603 5.8087 7.2609 14.5217 0.0115 Constraint 241 1526 5.9749 7.4687 14.9374 0.0115 Constraint 233 597 5.8844 7.3554 14.7109 0.0115 Constraint 227 1692 3.3522 4.1902 8.3804 0.0115 Constraint 227 1657 4.8283 6.0354 12.0708 0.0115 Constraint 227 1548 4.8429 6.0537 12.1073 0.0115 Constraint 227 1519 3.3435 4.1794 8.3588 0.0115 Constraint 227 457 5.5947 6.9933 13.9867 0.0115 Constraint 222 1692 3.5412 4.4265 8.8530 0.0115 Constraint 216 1731 6.0836 7.6045 15.2090 0.0115 Constraint 208 1541 5.5320 6.9150 13.8301 0.0115 Constraint 208 623 5.3609 6.7011 13.4022 0.0115 Constraint 196 1541 4.1897 5.2371 10.4742 0.0115 Constraint 189 1692 5.5679 6.9599 13.9197 0.0115 Constraint 189 521 5.6390 7.0487 14.0974 0.0115 Constraint 180 429 6.1398 7.6748 15.3496 0.0115 Constraint 180 392 5.0788 6.3484 12.6969 0.0115 Constraint 172 1731 5.5619 6.9524 13.9048 0.0115 Constraint 164 1603 4.9022 6.1278 12.2555 0.0115 Constraint 154 1567 5.9508 7.4385 14.8771 0.0115 Constraint 128 1603 5.8087 7.2609 14.5217 0.0115 Constraint 121 1714 4.8216 6.0270 12.0540 0.0115 Constraint 121 1692 3.3521 4.1902 8.3803 0.0115 Constraint 112 1720 5.7336 7.1670 14.3339 0.0115 Constraint 112 1714 3.5074 4.3843 8.7686 0.0115 Constraint 112 1703 5.9754 7.4693 14.9386 0.0115 Constraint 112 1692 3.6124 4.5155 9.0311 0.0115 Constraint 112 698 5.7568 7.1960 14.3920 0.0115 Constraint 112 589 4.7361 5.9201 11.8402 0.0115 Constraint 91 1714 5.4837 6.8546 13.7091 0.0115 Constraint 91 1692 5.5281 6.9102 13.8204 0.0115 Constraint 91 196 5.4846 6.8557 13.7114 0.0115 Constraint 91 172 4.2489 5.3111 10.6221 0.0115 Constraint 82 616 4.0461 5.0576 10.1151 0.0115 Constraint 82 608 6.3572 7.9465 15.8929 0.0115 Constraint 77 325 5.4291 6.7864 13.5728 0.0115 Constraint 47 616 5.4128 6.7660 13.5320 0.0115 Constraint 33 128 5.8023 7.2529 14.5058 0.0115 Constraint 25 616 5.4062 6.7577 13.5155 0.0115 Constraint 1777 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1772 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1772 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1764 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1764 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1764 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1756 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1756 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1756 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1756 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1748 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1748 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1748 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1748 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1748 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1739 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1739 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1739 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1739 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1739 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1739 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1731 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1731 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1731 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1731 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1731 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1731 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1731 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1720 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1714 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1703 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1692 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1683 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1678 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1670 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1662 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1657 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1649 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1649 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1649 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1649 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1649 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1649 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1649 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1634 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1634 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1634 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1634 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1634 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1634 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1620 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1620 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1620 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1620 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1620 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1620 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1611 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1603 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1603 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1603 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1603 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1603 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1603 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1603 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1596 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1596 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1596 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1596 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1596 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1596 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1596 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1587 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1587 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1587 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1587 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1587 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1587 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1575 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1567 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1567 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1567 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1567 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1567 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1567 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1567 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1556 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1548 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1541 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1533 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1526 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1519 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1511 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1503 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1494 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1488 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1479 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1471 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1466 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1455 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1447 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1438 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1427 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1416 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1408 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1399 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1391 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1382 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1374 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1366 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1358 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1351 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1343 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1438 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1334 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1325 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1317 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1503 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1309 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1479 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1301 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1293 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1351 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1284 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1343 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1276 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1334 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1268 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1260 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1251 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1246 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1239 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1541 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1228 1239 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1447 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1358 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1239 0.8000 1.0000 2.0000 0.0000 Constraint 1220 1228 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1239 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1228 0.8000 1.0000 2.0000 0.0000 Constraint 1213 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1416 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1382 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1317 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1268 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1239 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1228 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1204 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1533 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1374 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1260 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1239 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1228 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1193 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1703 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1239 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1228 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1178 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1408 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1284 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1239 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1228 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1167 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1158 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1301 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1213 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1149 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1204 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1141 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1193 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1133 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1720 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1678 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1657 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1293 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1125 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1548 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1325 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1117 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1167 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1109 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1556 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1100 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1649 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1634 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1603 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1158 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1092 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1683 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1149 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1084 1092 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1575 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1567 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1141 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1092 0.8000 1.0000 2.0000 0.0000 Constraint 1077 1084 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1620 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1596 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1133 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1092 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1084 0.8000 1.0000 2.0000 0.0000 Constraint 1068 1077 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1587 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1471 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1092 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1084 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1077 0.8000 1.0000 2.0000 0.0000 Constraint 1059 1068 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1399 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1220 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1117 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1092 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1084 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1077 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1068 0.8000 1.0000 2.0000 0.0000 Constraint 1054 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1756 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1670 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1519 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1246 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1109 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1092 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1084 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1077 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1068 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1046 1054 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1777 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1366 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1092 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1084 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1077 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1068 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1054 0.8000 1.0000 2.0000 0.0000 Constraint 1035 1046 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1788 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1611 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1125 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1084 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1077 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1068 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1054 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1046 0.8000 1.0000 2.0000 0.0000 Constraint 1030 1035 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1178 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1100 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1077 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1068 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1054 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1046 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1035 0.8000 1.0000 2.0000 0.0000 Constraint 1022 1030 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1731 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1466 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1455 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1068 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1054 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1046 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1035 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1030 0.8000 1.0000 2.0000 0.0000 Constraint 1014 1022 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1772 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1764 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1748 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1739 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1714 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1692 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1662 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1526 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1511 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1494 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1488 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1427 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1391 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1309 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1276 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1251 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1059 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1054 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1046 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1035 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1030 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1022 0.8000 1.0000 2.0000 0.0000 Constraint 1008 1014 0.8000 1.0000 2.0000 0.0000 Constraint 997 1788 0.8000 1.0000 2.0000 0.0000 Constraint 997 1772 0.8000 1.0000 2.0000 0.0000 Constraint 997 1511 0.8000 1.0000 2.0000 0.0000 Constraint 997 1276 0.8000 1.0000 2.0000 0.0000 Constraint 997 1167 0.8000 1.0000 2.0000 0.0000 Constraint 997 1149 0.8000 1.0000 2.0000 0.0000 Constraint 997 1054 0.8000 1.0000 2.0000 0.0000 Constraint 997 1046 0.8000 1.0000 2.0000 0.0000 Constraint 997 1035 0.8000 1.0000 2.0000 0.0000 Constraint 997 1030 0.8000 1.0000 2.0000 0.0000 Constraint 997 1022 0.8000 1.0000 2.0000 0.0000 Constraint 997 1014 0.8000 1.0000 2.0000 0.0000 Constraint 997 1008 0.8000 1.0000 2.0000 0.0000 Constraint 988 1788 0.8000 1.0000 2.0000 0.0000 Constraint 988 1772 0.8000 1.0000 2.0000 0.0000 Constraint 988 1739 0.8000 1.0000 2.0000 0.0000 Constraint 988 1714 0.8000 1.0000 2.0000 0.0000 Constraint 988 1683 0.8000 1.0000 2.0000 0.0000 Constraint 988 1662 0.8000 1.0000 2.0000 0.0000 Constraint 988 1657 0.8000 1.0000 2.0000 0.0000 Constraint 988 1603 0.8000 1.0000 2.0000 0.0000 Constraint 988 1587 0.8000 1.0000 2.0000 0.0000 Constraint 988 1511 0.8000 1.0000 2.0000 0.0000 Constraint 988 1427 0.8000 1.0000 2.0000 0.0000 Constraint 988 1334 0.8000 1.0000 2.0000 0.0000 Constraint 988 1309 0.8000 1.0000 2.0000 0.0000 Constraint 988 1276 0.8000 1.0000 2.0000 0.0000 Constraint 988 1246 0.8000 1.0000 2.0000 0.0000 Constraint 988 1213 0.8000 1.0000 2.0000 0.0000 Constraint 988 1193 0.8000 1.0000 2.0000 0.0000 Constraint 988 1125 0.8000 1.0000 2.0000 0.0000 Constraint 988 1046 0.8000 1.0000 2.0000 0.0000 Constraint 988 1035 0.8000 1.0000 2.0000 0.0000 Constraint 988 1030 0.8000 1.0000 2.0000 0.0000 Constraint 988 1022 0.8000 1.0000 2.0000 0.0000 Constraint 988 1014 0.8000 1.0000 2.0000 0.0000 Constraint 988 1008 0.8000 1.0000 2.0000 0.0000 Constraint 988 997 0.8000 1.0000 2.0000 0.0000 Constraint 980 1788 0.8000 1.0000 2.0000 0.0000 Constraint 980 1777 0.8000 1.0000 2.0000 0.0000 Constraint 980 1772 0.8000 1.0000 2.0000 0.0000 Constraint 980 1764 0.8000 1.0000 2.0000 0.0000 Constraint 980 1748 0.8000 1.0000 2.0000 0.0000 Constraint 980 1739 0.8000 1.0000 2.0000 0.0000 Constraint 980 1731 0.8000 1.0000 2.0000 0.0000 Constraint 980 1720 0.8000 1.0000 2.0000 0.0000 Constraint 980 1714 0.8000 1.0000 2.0000 0.0000 Constraint 980 1692 0.8000 1.0000 2.0000 0.0000 Constraint 980 1683 0.8000 1.0000 2.0000 0.0000 Constraint 980 1548 0.8000 1.0000 2.0000 0.0000 Constraint 980 1488 0.8000 1.0000 2.0000 0.0000 Constraint 980 1466 0.8000 1.0000 2.0000 0.0000 Constraint 980 1149 0.8000 1.0000 2.0000 0.0000 Constraint 980 1035 0.8000 1.0000 2.0000 0.0000 Constraint 980 1030 0.8000 1.0000 2.0000 0.0000 Constraint 980 1022 0.8000 1.0000 2.0000 0.0000 Constraint 980 1014 0.8000 1.0000 2.0000 0.0000 Constraint 980 1008 0.8000 1.0000 2.0000 0.0000 Constraint 980 997 0.8000 1.0000 2.0000 0.0000 Constraint 980 988 0.8000 1.0000 2.0000 0.0000 Constraint 968 1788 0.8000 1.0000 2.0000 0.0000 Constraint 968 1764 0.8000 1.0000 2.0000 0.0000 Constraint 968 1748 0.8000 1.0000 2.0000 0.0000 Constraint 968 1720 0.8000 1.0000 2.0000 0.0000 Constraint 968 1692 0.8000 1.0000 2.0000 0.0000 Constraint 968 1548 0.8000 1.0000 2.0000 0.0000 Constraint 968 1334 0.8000 1.0000 2.0000 0.0000 Constraint 968 1228 0.8000 1.0000 2.0000 0.0000 Constraint 968 1035 0.8000 1.0000 2.0000 0.0000 Constraint 968 1030 0.8000 1.0000 2.0000 0.0000 Constraint 968 1022 0.8000 1.0000 2.0000 0.0000 Constraint 968 1014 0.8000 1.0000 2.0000 0.0000 Constraint 968 1008 0.8000 1.0000 2.0000 0.0000 Constraint 968 997 0.8000 1.0000 2.0000 0.0000 Constraint 968 988 0.8000 1.0000 2.0000 0.0000 Constraint 968 980 0.8000 1.0000 2.0000 0.0000 Constraint 963 1748 0.8000 1.0000 2.0000 0.0000 Constraint 963 1714 0.8000 1.0000 2.0000 0.0000 Constraint 963 1692 0.8000 1.0000 2.0000 0.0000 Constraint 963 1670 0.8000 1.0000 2.0000 0.0000 Constraint 963 1587 0.8000 1.0000 2.0000 0.0000 Constraint 963 1358 0.8000 1.0000 2.0000 0.0000 Constraint 963 1334 0.8000 1.0000 2.0000 0.0000 Constraint 963 1325 0.8000 1.0000 2.0000 0.0000 Constraint 963 1276 0.8000 1.0000 2.0000 0.0000 Constraint 963 1220 0.8000 1.0000 2.0000 0.0000 Constraint 963 1149 0.8000 1.0000 2.0000 0.0000 Constraint 963 1109 0.8000 1.0000 2.0000 0.0000 Constraint 963 1092 0.8000 1.0000 2.0000 0.0000 Constraint 963 1030 0.8000 1.0000 2.0000 0.0000 Constraint 963 1022 0.8000 1.0000 2.0000 0.0000 Constraint 963 1014 0.8000 1.0000 2.0000 0.0000 Constraint 963 1008 0.8000 1.0000 2.0000 0.0000 Constraint 963 997 0.8000 1.0000 2.0000 0.0000 Constraint 963 988 0.8000 1.0000 2.0000 0.0000 Constraint 963 980 0.8000 1.0000 2.0000 0.0000 Constraint 963 968 0.8000 1.0000 2.0000 0.0000 Constraint 955 1788 0.8000 1.0000 2.0000 0.0000 Constraint 955 1777 0.8000 1.0000 2.0000 0.0000 Constraint 955 1772 0.8000 1.0000 2.0000 0.0000 Constraint 955 1764 0.8000 1.0000 2.0000 0.0000 Constraint 955 1748 0.8000 1.0000 2.0000 0.0000 Constraint 955 1731 0.8000 1.0000 2.0000 0.0000 Constraint 955 1720 0.8000 1.0000 2.0000 0.0000 Constraint 955 1714 0.8000 1.0000 2.0000 0.0000 Constraint 955 1703 0.8000 1.0000 2.0000 0.0000 Constraint 955 1692 0.8000 1.0000 2.0000 0.0000 Constraint 955 1683 0.8000 1.0000 2.0000 0.0000 Constraint 955 1374 0.8000 1.0000 2.0000 0.0000 Constraint 955 1366 0.8000 1.0000 2.0000 0.0000 Constraint 955 1022 0.8000 1.0000 2.0000 0.0000 Constraint 955 1014 0.8000 1.0000 2.0000 0.0000 Constraint 955 1008 0.8000 1.0000 2.0000 0.0000 Constraint 955 997 0.8000 1.0000 2.0000 0.0000 Constraint 955 988 0.8000 1.0000 2.0000 0.0000 Constraint 955 980 0.8000 1.0000 2.0000 0.0000 Constraint 955 968 0.8000 1.0000 2.0000 0.0000 Constraint 955 963 0.8000 1.0000 2.0000 0.0000 Constraint 944 1764 0.8000 1.0000 2.0000 0.0000 Constraint 944 1739 0.8000 1.0000 2.0000 0.0000 Constraint 944 1611 0.8000 1.0000 2.0000 0.0000 Constraint 944 1494 0.8000 1.0000 2.0000 0.0000 Constraint 944 1488 0.8000 1.0000 2.0000 0.0000 Constraint 944 1092 0.8000 1.0000 2.0000 0.0000 Constraint 944 1014 0.8000 1.0000 2.0000 0.0000 Constraint 944 1008 0.8000 1.0000 2.0000 0.0000 Constraint 944 997 0.8000 1.0000 2.0000 0.0000 Constraint 944 988 0.8000 1.0000 2.0000 0.0000 Constraint 944 980 0.8000 1.0000 2.0000 0.0000 Constraint 944 968 0.8000 1.0000 2.0000 0.0000 Constraint 944 963 0.8000 1.0000 2.0000 0.0000 Constraint 944 955 0.8000 1.0000 2.0000 0.0000 Constraint 937 1788 0.8000 1.0000 2.0000 0.0000 Constraint 937 1777 0.8000 1.0000 2.0000 0.0000 Constraint 937 1772 0.8000 1.0000 2.0000 0.0000 Constraint 937 1764 0.8000 1.0000 2.0000 0.0000 Constraint 937 1756 0.8000 1.0000 2.0000 0.0000 Constraint 937 1748 0.8000 1.0000 2.0000 0.0000 Constraint 937 1720 0.8000 1.0000 2.0000 0.0000 Constraint 937 1703 0.8000 1.0000 2.0000 0.0000 Constraint 937 1683 0.8000 1.0000 2.0000 0.0000 Constraint 937 1678 0.8000 1.0000 2.0000 0.0000 Constraint 937 1662 0.8000 1.0000 2.0000 0.0000 Constraint 937 1611 0.8000 1.0000 2.0000 0.0000 Constraint 937 1548 0.8000 1.0000 2.0000 0.0000 Constraint 937 1526 0.8000 1.0000 2.0000 0.0000 Constraint 937 1427 0.8000 1.0000 2.0000 0.0000 Constraint 937 1391 0.8000 1.0000 2.0000 0.0000 Constraint 937 1325 0.8000 1.0000 2.0000 0.0000 Constraint 937 1220 0.8000 1.0000 2.0000 0.0000 Constraint 937 1213 0.8000 1.0000 2.0000 0.0000 Constraint 937 1204 0.8000 1.0000 2.0000 0.0000 Constraint 937 1117 0.8000 1.0000 2.0000 0.0000 Constraint 937 1092 0.8000 1.0000 2.0000 0.0000 Constraint 937 1084 0.8000 1.0000 2.0000 0.0000 Constraint 937 1035 0.8000 1.0000 2.0000 0.0000 Constraint 937 1008 0.8000 1.0000 2.0000 0.0000 Constraint 937 997 0.8000 1.0000 2.0000 0.0000 Constraint 937 988 0.8000 1.0000 2.0000 0.0000 Constraint 937 980 0.8000 1.0000 2.0000 0.0000 Constraint 937 968 0.8000 1.0000 2.0000 0.0000 Constraint 937 963 0.8000 1.0000 2.0000 0.0000 Constraint 937 955 0.8000 1.0000 2.0000 0.0000 Constraint 937 944 0.8000 1.0000 2.0000 0.0000 Constraint 930 1788 0.8000 1.0000 2.0000 0.0000 Constraint 930 1777 0.8000 1.0000 2.0000 0.0000 Constraint 930 1772 0.8000 1.0000 2.0000 0.0000 Constraint 930 1764 0.8000 1.0000 2.0000 0.0000 Constraint 930 1756 0.8000 1.0000 2.0000 0.0000 Constraint 930 1748 0.8000 1.0000 2.0000 0.0000 Constraint 930 1739 0.8000 1.0000 2.0000 0.0000 Constraint 930 1731 0.8000 1.0000 2.0000 0.0000 Constraint 930 1720 0.8000 1.0000 2.0000 0.0000 Constraint 930 1714 0.8000 1.0000 2.0000 0.0000 Constraint 930 1703 0.8000 1.0000 2.0000 0.0000 Constraint 930 1692 0.8000 1.0000 2.0000 0.0000 Constraint 930 1670 0.8000 1.0000 2.0000 0.0000 Constraint 930 1662 0.8000 1.0000 2.0000 0.0000 Constraint 930 1611 0.8000 1.0000 2.0000 0.0000 Constraint 930 1408 0.8000 1.0000 2.0000 0.0000 Constraint 930 1374 0.8000 1.0000 2.0000 0.0000 Constraint 930 1366 0.8000 1.0000 2.0000 0.0000 Constraint 930 1334 0.8000 1.0000 2.0000 0.0000 Constraint 930 1276 0.8000 1.0000 2.0000 0.0000 Constraint 930 1220 0.8000 1.0000 2.0000 0.0000 Constraint 930 1077 0.8000 1.0000 2.0000 0.0000 Constraint 930 997 0.8000 1.0000 2.0000 0.0000 Constraint 930 988 0.8000 1.0000 2.0000 0.0000 Constraint 930 980 0.8000 1.0000 2.0000 0.0000 Constraint 930 968 0.8000 1.0000 2.0000 0.0000 Constraint 930 963 0.8000 1.0000 2.0000 0.0000 Constraint 930 955 0.8000 1.0000 2.0000 0.0000 Constraint 930 944 0.8000 1.0000 2.0000 0.0000 Constraint 930 937 0.8000 1.0000 2.0000 0.0000 Constraint 921 1788 0.8000 1.0000 2.0000 0.0000 Constraint 921 1777 0.8000 1.0000 2.0000 0.0000 Constraint 921 1764 0.8000 1.0000 2.0000 0.0000 Constraint 921 1756 0.8000 1.0000 2.0000 0.0000 Constraint 921 1739 0.8000 1.0000 2.0000 0.0000 Constraint 921 1720 0.8000 1.0000 2.0000 0.0000 Constraint 921 1703 0.8000 1.0000 2.0000 0.0000 Constraint 921 1683 0.8000 1.0000 2.0000 0.0000 Constraint 921 1670 0.8000 1.0000 2.0000 0.0000 Constraint 921 1611 0.8000 1.0000 2.0000 0.0000 Constraint 921 1575 0.8000 1.0000 2.0000 0.0000 Constraint 921 1519 0.8000 1.0000 2.0000 0.0000 Constraint 921 1494 0.8000 1.0000 2.0000 0.0000 Constraint 921 988 0.8000 1.0000 2.0000 0.0000 Constraint 921 980 0.8000 1.0000 2.0000 0.0000 Constraint 921 968 0.8000 1.0000 2.0000 0.0000 Constraint 921 963 0.8000 1.0000 2.0000 0.0000 Constraint 921 955 0.8000 1.0000 2.0000 0.0000 Constraint 921 944 0.8000 1.0000 2.0000 0.0000 Constraint 921 937 0.8000 1.0000 2.0000 0.0000 Constraint 921 930 0.8000 1.0000 2.0000 0.0000 Constraint 913 1788 0.8000 1.0000 2.0000 0.0000 Constraint 913 1777 0.8000 1.0000 2.0000 0.0000 Constraint 913 1756 0.8000 1.0000 2.0000 0.0000 Constraint 913 1731 0.8000 1.0000 2.0000 0.0000 Constraint 913 1662 0.8000 1.0000 2.0000 0.0000 Constraint 913 1657 0.8000 1.0000 2.0000 0.0000 Constraint 913 1649 0.8000 1.0000 2.0000 0.0000 Constraint 913 1634 0.8000 1.0000 2.0000 0.0000 Constraint 913 1611 0.8000 1.0000 2.0000 0.0000 Constraint 913 1603 0.8000 1.0000 2.0000 0.0000 Constraint 913 1575 0.8000 1.0000 2.0000 0.0000 Constraint 913 1541 0.8000 1.0000 2.0000 0.0000 Constraint 913 1494 0.8000 1.0000 2.0000 0.0000 Constraint 913 1488 0.8000 1.0000 2.0000 0.0000 Constraint 913 1366 0.8000 1.0000 2.0000 0.0000 Constraint 913 1358 0.8000 1.0000 2.0000 0.0000 Constraint 913 1351 0.8000 1.0000 2.0000 0.0000 Constraint 913 1092 0.8000 1.0000 2.0000 0.0000 Constraint 913 1084 0.8000 1.0000 2.0000 0.0000 Constraint 913 1059 0.8000 1.0000 2.0000 0.0000 Constraint 913 980 0.8000 1.0000 2.0000 0.0000 Constraint 913 968 0.8000 1.0000 2.0000 0.0000 Constraint 913 963 0.8000 1.0000 2.0000 0.0000 Constraint 913 955 0.8000 1.0000 2.0000 0.0000 Constraint 913 944 0.8000 1.0000 2.0000 0.0000 Constraint 913 937 0.8000 1.0000 2.0000 0.0000 Constraint 913 930 0.8000 1.0000 2.0000 0.0000 Constraint 913 921 0.8000 1.0000 2.0000 0.0000 Constraint 908 1788 0.8000 1.0000 2.0000 0.0000 Constraint 908 1777 0.8000 1.0000 2.0000 0.0000 Constraint 908 1772 0.8000 1.0000 2.0000 0.0000 Constraint 908 1764 0.8000 1.0000 2.0000 0.0000 Constraint 908 1756 0.8000 1.0000 2.0000 0.0000 Constraint 908 1748 0.8000 1.0000 2.0000 0.0000 Constraint 908 1739 0.8000 1.0000 2.0000 0.0000 Constraint 908 1731 0.8000 1.0000 2.0000 0.0000 Constraint 908 1720 0.8000 1.0000 2.0000 0.0000 Constraint 908 1714 0.8000 1.0000 2.0000 0.0000 Constraint 908 1703 0.8000 1.0000 2.0000 0.0000 Constraint 908 1692 0.8000 1.0000 2.0000 0.0000 Constraint 908 1670 0.8000 1.0000 2.0000 0.0000 Constraint 908 1662 0.8000 1.0000 2.0000 0.0000 Constraint 908 1649 0.8000 1.0000 2.0000 0.0000 Constraint 908 1611 0.8000 1.0000 2.0000 0.0000 Constraint 908 1603 0.8000 1.0000 2.0000 0.0000 Constraint 908 1587 0.8000 1.0000 2.0000 0.0000 Constraint 908 1575 0.8000 1.0000 2.0000 0.0000 Constraint 908 1548 0.8000 1.0000 2.0000 0.0000 Constraint 908 1416 0.8000 1.0000 2.0000 0.0000 Constraint 908 1358 0.8000 1.0000 2.0000 0.0000 Constraint 908 1334 0.8000 1.0000 2.0000 0.0000 Constraint 908 1325 0.8000 1.0000 2.0000 0.0000 Constraint 908 1309 0.8000 1.0000 2.0000 0.0000 Constraint 908 1268 0.8000 1.0000 2.0000 0.0000 Constraint 908 1246 0.8000 1.0000 2.0000 0.0000 Constraint 908 1220 0.8000 1.0000 2.0000 0.0000 Constraint 908 1084 0.8000 1.0000 2.0000 0.0000 Constraint 908 1059 0.8000 1.0000 2.0000 0.0000 Constraint 908 968 0.8000 1.0000 2.0000 0.0000 Constraint 908 963 0.8000 1.0000 2.0000 0.0000 Constraint 908 955 0.8000 1.0000 2.0000 0.0000 Constraint 908 944 0.8000 1.0000 2.0000 0.0000 Constraint 908 937 0.8000 1.0000 2.0000 0.0000 Constraint 908 930 0.8000 1.0000 2.0000 0.0000 Constraint 908 921 0.8000 1.0000 2.0000 0.0000 Constraint 908 913 0.8000 1.0000 2.0000 0.0000 Constraint 899 1788 0.8000 1.0000 2.0000 0.0000 Constraint 899 1777 0.8000 1.0000 2.0000 0.0000 Constraint 899 1764 0.8000 1.0000 2.0000 0.0000 Constraint 899 1756 0.8000 1.0000 2.0000 0.0000 Constraint 899 1748 0.8000 1.0000 2.0000 0.0000 Constraint 899 1731 0.8000 1.0000 2.0000 0.0000 Constraint 899 1720 0.8000 1.0000 2.0000 0.0000 Constraint 899 1714 0.8000 1.0000 2.0000 0.0000 Constraint 899 1670 0.8000 1.0000 2.0000 0.0000 Constraint 899 1662 0.8000 1.0000 2.0000 0.0000 Constraint 899 1620 0.8000 1.0000 2.0000 0.0000 Constraint 899 1611 0.8000 1.0000 2.0000 0.0000 Constraint 899 1603 0.8000 1.0000 2.0000 0.0000 Constraint 899 1587 0.8000 1.0000 2.0000 0.0000 Constraint 899 1503 0.8000 1.0000 2.0000 0.0000 Constraint 899 1479 0.8000 1.0000 2.0000 0.0000 Constraint 899 1408 0.8000 1.0000 2.0000 0.0000 Constraint 899 1351 0.8000 1.0000 2.0000 0.0000 Constraint 899 1334 0.8000 1.0000 2.0000 0.0000 Constraint 899 1325 0.8000 1.0000 2.0000 0.0000 Constraint 899 1309 0.8000 1.0000 2.0000 0.0000 Constraint 899 1284 0.8000 1.0000 2.0000 0.0000 Constraint 899 1276 0.8000 1.0000 2.0000 0.0000 Constraint 899 1220 0.8000 1.0000 2.0000 0.0000 Constraint 899 1204 0.8000 1.0000 2.0000 0.0000 Constraint 899 1193 0.8000 1.0000 2.0000 0.0000 Constraint 899 1092 0.8000 1.0000 2.0000 0.0000 Constraint 899 1084 0.8000 1.0000 2.0000 0.0000 Constraint 899 1059 0.8000 1.0000 2.0000 0.0000 Constraint 899 997 0.8000 1.0000 2.0000 0.0000 Constraint 899 963 0.8000 1.0000 2.0000 0.0000 Constraint 899 955 0.8000 1.0000 2.0000 0.0000 Constraint 899 944 0.8000 1.0000 2.0000 0.0000 Constraint 899 937 0.8000 1.0000 2.0000 0.0000 Constraint 899 930 0.8000 1.0000 2.0000 0.0000 Constraint 899 921 0.8000 1.0000 2.0000 0.0000 Constraint 899 913 0.8000 1.0000 2.0000 0.0000 Constraint 899 908 0.8000 1.0000 2.0000 0.0000 Constraint 892 1788 0.8000 1.0000 2.0000 0.0000 Constraint 892 1777 0.8000 1.0000 2.0000 0.0000 Constraint 892 1772 0.8000 1.0000 2.0000 0.0000 Constraint 892 1764 0.8000 1.0000 2.0000 0.0000 Constraint 892 1756 0.8000 1.0000 2.0000 0.0000 Constraint 892 1748 0.8000 1.0000 2.0000 0.0000 Constraint 892 1739 0.8000 1.0000 2.0000 0.0000 Constraint 892 1731 0.8000 1.0000 2.0000 0.0000 Constraint 892 1720 0.8000 1.0000 2.0000 0.0000 Constraint 892 1714 0.8000 1.0000 2.0000 0.0000 Constraint 892 1703 0.8000 1.0000 2.0000 0.0000 Constraint 892 1692 0.8000 1.0000 2.0000 0.0000 Constraint 892 1683 0.8000 1.0000 2.0000 0.0000 Constraint 892 1670 0.8000 1.0000 2.0000 0.0000 Constraint 892 1662 0.8000 1.0000 2.0000 0.0000 Constraint 892 1634 0.8000 1.0000 2.0000 0.0000 Constraint 892 1611 0.8000 1.0000 2.0000 0.0000 Constraint 892 1603 0.8000 1.0000 2.0000 0.0000 Constraint 892 1575 0.8000 1.0000 2.0000 0.0000 Constraint 892 1494 0.8000 1.0000 2.0000 0.0000 Constraint 892 1427 0.8000 1.0000 2.0000 0.0000 Constraint 892 1416 0.8000 1.0000 2.0000 0.0000 Constraint 892 1391 0.8000 1.0000 2.0000 0.0000 Constraint 892 1358 0.8000 1.0000 2.0000 0.0000 Constraint 892 1092 0.8000 1.0000 2.0000 0.0000 Constraint 892 997 0.8000 1.0000 2.0000 0.0000 Constraint 892 955 0.8000 1.0000 2.0000 0.0000 Constraint 892 944 0.8000 1.0000 2.0000 0.0000 Constraint 892 937 0.8000 1.0000 2.0000 0.0000 Constraint 892 930 0.8000 1.0000 2.0000 0.0000 Constraint 892 921 0.8000 1.0000 2.0000 0.0000 Constraint 892 913 0.8000 1.0000 2.0000 0.0000 Constraint 892 908 0.8000 1.0000 2.0000 0.0000 Constraint 892 899 0.8000 1.0000 2.0000 0.0000 Constraint 884 1788 0.8000 1.0000 2.0000 0.0000 Constraint 884 1777 0.8000 1.0000 2.0000 0.0000 Constraint 884 1772 0.8000 1.0000 2.0000 0.0000 Constraint 884 1764 0.8000 1.0000 2.0000 0.0000 Constraint 884 1748 0.8000 1.0000 2.0000 0.0000 Constraint 884 1739 0.8000 1.0000 2.0000 0.0000 Constraint 884 1731 0.8000 1.0000 2.0000 0.0000 Constraint 884 1720 0.8000 1.0000 2.0000 0.0000 Constraint 884 1714 0.8000 1.0000 2.0000 0.0000 Constraint 884 1692 0.8000 1.0000 2.0000 0.0000 Constraint 884 1620 0.8000 1.0000 2.0000 0.0000 Constraint 884 1603 0.8000 1.0000 2.0000 0.0000 Constraint 884 1556 0.8000 1.0000 2.0000 0.0000 Constraint 884 1488 0.8000 1.0000 2.0000 0.0000 Constraint 884 1466 0.8000 1.0000 2.0000 0.0000 Constraint 884 1416 0.8000 1.0000 2.0000 0.0000 Constraint 884 1391 0.8000 1.0000 2.0000 0.0000 Constraint 884 1358 0.8000 1.0000 2.0000 0.0000 Constraint 884 1268 0.8000 1.0000 2.0000 0.0000 Constraint 884 1246 0.8000 1.0000 2.0000 0.0000 Constraint 884 1167 0.8000 1.0000 2.0000 0.0000 Constraint 884 1125 0.8000 1.0000 2.0000 0.0000 Constraint 884 1092 0.8000 1.0000 2.0000 0.0000 Constraint 884 1084 0.8000 1.0000 2.0000 0.0000 Constraint 884 1030 0.8000 1.0000 2.0000 0.0000 Constraint 884 944 0.8000 1.0000 2.0000 0.0000 Constraint 884 937 0.8000 1.0000 2.0000 0.0000 Constraint 884 930 0.8000 1.0000 2.0000 0.0000 Constraint 884 921 0.8000 1.0000 2.0000 0.0000 Constraint 884 913 0.8000 1.0000 2.0000 0.0000 Constraint 884 908 0.8000 1.0000 2.0000 0.0000 Constraint 884 899 0.8000 1.0000 2.0000 0.0000 Constraint 884 892 0.8000 1.0000 2.0000 0.0000 Constraint 876 1788 0.8000 1.0000 2.0000 0.0000 Constraint 876 1764 0.8000 1.0000 2.0000 0.0000 Constraint 876 1756 0.8000 1.0000 2.0000 0.0000 Constraint 876 1739 0.8000 1.0000 2.0000 0.0000 Constraint 876 1731 0.8000 1.0000 2.0000 0.0000 Constraint 876 1720 0.8000 1.0000 2.0000 0.0000 Constraint 876 1714 0.8000 1.0000 2.0000 0.0000 Constraint 876 1703 0.8000 1.0000 2.0000 0.0000 Constraint 876 1678 0.8000 1.0000 2.0000 0.0000 Constraint 876 1662 0.8000 1.0000 2.0000 0.0000 Constraint 876 1649 0.8000 1.0000 2.0000 0.0000 Constraint 876 1611 0.8000 1.0000 2.0000 0.0000 Constraint 876 1596 0.8000 1.0000 2.0000 0.0000 Constraint 876 1575 0.8000 1.0000 2.0000 0.0000 Constraint 876 1567 0.8000 1.0000 2.0000 0.0000 Constraint 876 1494 0.8000 1.0000 2.0000 0.0000 Constraint 876 1488 0.8000 1.0000 2.0000 0.0000 Constraint 876 1466 0.8000 1.0000 2.0000 0.0000 Constraint 876 1408 0.8000 1.0000 2.0000 0.0000 Constraint 876 1382 0.8000 1.0000 2.0000 0.0000 Constraint 876 1334 0.8000 1.0000 2.0000 0.0000 Constraint 876 1293 0.8000 1.0000 2.0000 0.0000 Constraint 876 1246 0.8000 1.0000 2.0000 0.0000 Constraint 876 1220 0.8000 1.0000 2.0000 0.0000 Constraint 876 1158 0.8000 1.0000 2.0000 0.0000 Constraint 876 1149 0.8000 1.0000 2.0000 0.0000 Constraint 876 1125 0.8000 1.0000 2.0000 0.0000 Constraint 876 997 0.8000 1.0000 2.0000 0.0000 Constraint 876 988 0.8000 1.0000 2.0000 0.0000 Constraint 876 937 0.8000 1.0000 2.0000 0.0000 Constraint 876 930 0.8000 1.0000 2.0000 0.0000 Constraint 876 921 0.8000 1.0000 2.0000 0.0000 Constraint 876 913 0.8000 1.0000 2.0000 0.0000 Constraint 876 908 0.8000 1.0000 2.0000 0.0000 Constraint 876 899 0.8000 1.0000 2.0000 0.0000 Constraint 876 892 0.8000 1.0000 2.0000 0.0000 Constraint 876 884 0.8000 1.0000 2.0000 0.0000 Constraint 868 1788 0.8000 1.0000 2.0000 0.0000 Constraint 868 1777 0.8000 1.0000 2.0000 0.0000 Constraint 868 1683 0.8000 1.0000 2.0000 0.0000 Constraint 868 1678 0.8000 1.0000 2.0000 0.0000 Constraint 868 1670 0.8000 1.0000 2.0000 0.0000 Constraint 868 1662 0.8000 1.0000 2.0000 0.0000 Constraint 868 1611 0.8000 1.0000 2.0000 0.0000 Constraint 868 1494 0.8000 1.0000 2.0000 0.0000 Constraint 868 1488 0.8000 1.0000 2.0000 0.0000 Constraint 868 1466 0.8000 1.0000 2.0000 0.0000 Constraint 868 1276 0.8000 1.0000 2.0000 0.0000 Constraint 868 1220 0.8000 1.0000 2.0000 0.0000 Constraint 868 1158 0.8000 1.0000 2.0000 0.0000 Constraint 868 1149 0.8000 1.0000 2.0000 0.0000 Constraint 868 1125 0.8000 1.0000 2.0000 0.0000 Constraint 868 930 0.8000 1.0000 2.0000 0.0000 Constraint 868 921 0.8000 1.0000 2.0000 0.0000 Constraint 868 913 0.8000 1.0000 2.0000 0.0000 Constraint 868 908 0.8000 1.0000 2.0000 0.0000 Constraint 868 899 0.8000 1.0000 2.0000 0.0000 Constraint 868 892 0.8000 1.0000 2.0000 0.0000 Constraint 868 884 0.8000 1.0000 2.0000 0.0000 Constraint 868 876 0.8000 1.0000 2.0000 0.0000 Constraint 859 1788 0.8000 1.0000 2.0000 0.0000 Constraint 859 1777 0.8000 1.0000 2.0000 0.0000 Constraint 859 1772 0.8000 1.0000 2.0000 0.0000 Constraint 859 1764 0.8000 1.0000 2.0000 0.0000 Constraint 859 1748 0.8000 1.0000 2.0000 0.0000 Constraint 859 1739 0.8000 1.0000 2.0000 0.0000 Constraint 859 1731 0.8000 1.0000 2.0000 0.0000 Constraint 859 1720 0.8000 1.0000 2.0000 0.0000 Constraint 859 1714 0.8000 1.0000 2.0000 0.0000 Constraint 859 1703 0.8000 1.0000 2.0000 0.0000 Constraint 859 1692 0.8000 1.0000 2.0000 0.0000 Constraint 859 1683 0.8000 1.0000 2.0000 0.0000 Constraint 859 1662 0.8000 1.0000 2.0000 0.0000 Constraint 859 1620 0.8000 1.0000 2.0000 0.0000 Constraint 859 1611 0.8000 1.0000 2.0000 0.0000 Constraint 859 1575 0.8000 1.0000 2.0000 0.0000 Constraint 859 1494 0.8000 1.0000 2.0000 0.0000 Constraint 859 1488 0.8000 1.0000 2.0000 0.0000 Constraint 859 1358 0.8000 1.0000 2.0000 0.0000 Constraint 859 1125 0.8000 1.0000 2.0000 0.0000 Constraint 859 1059 0.8000 1.0000 2.0000 0.0000 Constraint 859 1054 0.8000 1.0000 2.0000 0.0000 Constraint 859 921 0.8000 1.0000 2.0000 0.0000 Constraint 859 913 0.8000 1.0000 2.0000 0.0000 Constraint 859 908 0.8000 1.0000 2.0000 0.0000 Constraint 859 899 0.8000 1.0000 2.0000 0.0000 Constraint 859 892 0.8000 1.0000 2.0000 0.0000 Constraint 859 884 0.8000 1.0000 2.0000 0.0000 Constraint 859 876 0.8000 1.0000 2.0000 0.0000 Constraint 859 868 0.8000 1.0000 2.0000 0.0000 Constraint 848 1788 0.8000 1.0000 2.0000 0.0000 Constraint 848 1777 0.8000 1.0000 2.0000 0.0000 Constraint 848 1764 0.8000 1.0000 2.0000 0.0000 Constraint 848 1756 0.8000 1.0000 2.0000 0.0000 Constraint 848 1748 0.8000 1.0000 2.0000 0.0000 Constraint 848 1739 0.8000 1.0000 2.0000 0.0000 Constraint 848 1731 0.8000 1.0000 2.0000 0.0000 Constraint 848 1720 0.8000 1.0000 2.0000 0.0000 Constraint 848 1714 0.8000 1.0000 2.0000 0.0000 Constraint 848 1703 0.8000 1.0000 2.0000 0.0000 Constraint 848 1692 0.8000 1.0000 2.0000 0.0000 Constraint 848 1683 0.8000 1.0000 2.0000 0.0000 Constraint 848 1678 0.8000 1.0000 2.0000 0.0000 Constraint 848 1662 0.8000 1.0000 2.0000 0.0000 Constraint 848 1611 0.8000 1.0000 2.0000 0.0000 Constraint 848 1503 0.8000 1.0000 2.0000 0.0000 Constraint 848 1494 0.8000 1.0000 2.0000 0.0000 Constraint 848 1479 0.8000 1.0000 2.0000 0.0000 Constraint 848 1391 0.8000 1.0000 2.0000 0.0000 Constraint 848 1317 0.8000 1.0000 2.0000 0.0000 Constraint 848 1251 0.8000 1.0000 2.0000 0.0000 Constraint 848 1133 0.8000 1.0000 2.0000 0.0000 Constraint 848 1125 0.8000 1.0000 2.0000 0.0000 Constraint 848 913 0.8000 1.0000 2.0000 0.0000 Constraint 848 908 0.8000 1.0000 2.0000 0.0000 Constraint 848 899 0.8000 1.0000 2.0000 0.0000 Constraint 848 892 0.8000 1.0000 2.0000 0.0000 Constraint 848 884 0.8000 1.0000 2.0000 0.0000 Constraint 848 876 0.8000 1.0000 2.0000 0.0000 Constraint 848 868 0.8000 1.0000 2.0000 0.0000 Constraint 848 859 0.8000 1.0000 2.0000 0.0000 Constraint 836 1777 0.8000 1.0000 2.0000 0.0000 Constraint 836 1772 0.8000 1.0000 2.0000 0.0000 Constraint 836 1756 0.8000 1.0000 2.0000 0.0000 Constraint 836 1748 0.8000 1.0000 2.0000 0.0000 Constraint 836 1739 0.8000 1.0000 2.0000 0.0000 Constraint 836 1720 0.8000 1.0000 2.0000 0.0000 Constraint 836 1714 0.8000 1.0000 2.0000 0.0000 Constraint 836 1692 0.8000 1.0000 2.0000 0.0000 Constraint 836 1683 0.8000 1.0000 2.0000 0.0000 Constraint 836 1662 0.8000 1.0000 2.0000 0.0000 Constraint 836 1657 0.8000 1.0000 2.0000 0.0000 Constraint 836 1603 0.8000 1.0000 2.0000 0.0000 Constraint 836 1526 0.8000 1.0000 2.0000 0.0000 Constraint 836 1251 0.8000 1.0000 2.0000 0.0000 Constraint 836 1228 0.8000 1.0000 2.0000 0.0000 Constraint 836 1220 0.8000 1.0000 2.0000 0.0000 Constraint 836 1193 0.8000 1.0000 2.0000 0.0000 Constraint 836 1158 0.8000 1.0000 2.0000 0.0000 Constraint 836 1149 0.8000 1.0000 2.0000 0.0000 Constraint 836 1133 0.8000 1.0000 2.0000 0.0000 Constraint 836 1125 0.8000 1.0000 2.0000 0.0000 Constraint 836 899 0.8000 1.0000 2.0000 0.0000 Constraint 836 892 0.8000 1.0000 2.0000 0.0000 Constraint 836 884 0.8000 1.0000 2.0000 0.0000 Constraint 836 876 0.8000 1.0000 2.0000 0.0000 Constraint 836 868 0.8000 1.0000 2.0000 0.0000 Constraint 836 859 0.8000 1.0000 2.0000 0.0000 Constraint 836 848 0.8000 1.0000 2.0000 0.0000 Constraint 829 1788 0.8000 1.0000 2.0000 0.0000 Constraint 829 1777 0.8000 1.0000 2.0000 0.0000 Constraint 829 1772 0.8000 1.0000 2.0000 0.0000 Constraint 829 1764 0.8000 1.0000 2.0000 0.0000 Constraint 829 1756 0.8000 1.0000 2.0000 0.0000 Constraint 829 1748 0.8000 1.0000 2.0000 0.0000 Constraint 829 1731 0.8000 1.0000 2.0000 0.0000 Constraint 829 1720 0.8000 1.0000 2.0000 0.0000 Constraint 829 1714 0.8000 1.0000 2.0000 0.0000 Constraint 829 1703 0.8000 1.0000 2.0000 0.0000 Constraint 829 1692 0.8000 1.0000 2.0000 0.0000 Constraint 829 1683 0.8000 1.0000 2.0000 0.0000 Constraint 829 1634 0.8000 1.0000 2.0000 0.0000 Constraint 829 1526 0.8000 1.0000 2.0000 0.0000 Constraint 829 1494 0.8000 1.0000 2.0000 0.0000 Constraint 829 1466 0.8000 1.0000 2.0000 0.0000 Constraint 829 1427 0.8000 1.0000 2.0000 0.0000 Constraint 829 1399 0.8000 1.0000 2.0000 0.0000 Constraint 829 1391 0.8000 1.0000 2.0000 0.0000 Constraint 829 1325 0.8000 1.0000 2.0000 0.0000 Constraint 829 1284 0.8000 1.0000 2.0000 0.0000 Constraint 829 1213 0.8000 1.0000 2.0000 0.0000 Constraint 829 1149 0.8000 1.0000 2.0000 0.0000 Constraint 829 1125 0.8000 1.0000 2.0000 0.0000 Constraint 829 892 0.8000 1.0000 2.0000 0.0000 Constraint 829 884 0.8000 1.0000 2.0000 0.0000 Constraint 829 876 0.8000 1.0000 2.0000 0.0000 Constraint 829 868 0.8000 1.0000 2.0000 0.0000 Constraint 829 859 0.8000 1.0000 2.0000 0.0000 Constraint 829 848 0.8000 1.0000 2.0000 0.0000 Constraint 829 836 0.8000 1.0000 2.0000 0.0000 Constraint 818 1788 0.8000 1.0000 2.0000 0.0000 Constraint 818 1777 0.8000 1.0000 2.0000 0.0000 Constraint 818 1772 0.8000 1.0000 2.0000 0.0000 Constraint 818 1764 0.8000 1.0000 2.0000 0.0000 Constraint 818 1748 0.8000 1.0000 2.0000 0.0000 Constraint 818 1739 0.8000 1.0000 2.0000 0.0000 Constraint 818 1720 0.8000 1.0000 2.0000 0.0000 Constraint 818 1714 0.8000 1.0000 2.0000 0.0000 Constraint 818 1683 0.8000 1.0000 2.0000 0.0000 Constraint 818 1657 0.8000 1.0000 2.0000 0.0000 Constraint 818 1649 0.8000 1.0000 2.0000 0.0000 Constraint 818 1634 0.8000 1.0000 2.0000 0.0000 Constraint 818 1503 0.8000 1.0000 2.0000 0.0000 Constraint 818 1494 0.8000 1.0000 2.0000 0.0000 Constraint 818 1358 0.8000 1.0000 2.0000 0.0000 Constraint 818 1334 0.8000 1.0000 2.0000 0.0000 Constraint 818 1309 0.8000 1.0000 2.0000 0.0000 Constraint 818 1251 0.8000 1.0000 2.0000 0.0000 Constraint 818 1228 0.8000 1.0000 2.0000 0.0000 Constraint 818 1220 0.8000 1.0000 2.0000 0.0000 Constraint 818 1193 0.8000 1.0000 2.0000 0.0000 Constraint 818 1158 0.8000 1.0000 2.0000 0.0000 Constraint 818 1149 0.8000 1.0000 2.0000 0.0000 Constraint 818 1133 0.8000 1.0000 2.0000 0.0000 Constraint 818 884 0.8000 1.0000 2.0000 0.0000 Constraint 818 876 0.8000 1.0000 2.0000 0.0000 Constraint 818 868 0.8000 1.0000 2.0000 0.0000 Constraint 818 859 0.8000 1.0000 2.0000 0.0000 Constraint 818 848 0.8000 1.0000 2.0000 0.0000 Constraint 818 836 0.8000 1.0000 2.0000 0.0000 Constraint 818 829 0.8000 1.0000 2.0000 0.0000 Constraint 808 1788 0.8000 1.0000 2.0000 0.0000 Constraint 808 1777 0.8000 1.0000 2.0000 0.0000 Constraint 808 1772 0.8000 1.0000 2.0000 0.0000 Constraint 808 1756 0.8000 1.0000 2.0000 0.0000 Constraint 808 1748 0.8000 1.0000 2.0000 0.0000 Constraint 808 1739 0.8000 1.0000 2.0000 0.0000 Constraint 808 1731 0.8000 1.0000 2.0000 0.0000 Constraint 808 1720 0.8000 1.0000 2.0000 0.0000 Constraint 808 1714 0.8000 1.0000 2.0000 0.0000 Constraint 808 1692 0.8000 1.0000 2.0000 0.0000 Constraint 808 1683 0.8000 1.0000 2.0000 0.0000 Constraint 808 1662 0.8000 1.0000 2.0000 0.0000 Constraint 808 1657 0.8000 1.0000 2.0000 0.0000 Constraint 808 1611 0.8000 1.0000 2.0000 0.0000 Constraint 808 1519 0.8000 1.0000 2.0000 0.0000 Constraint 808 1503 0.8000 1.0000 2.0000 0.0000 Constraint 808 1193 0.8000 1.0000 2.0000 0.0000 Constraint 808 1125 0.8000 1.0000 2.0000 0.0000 Constraint 808 1022 0.8000 1.0000 2.0000 0.0000 Constraint 808 868 0.8000 1.0000 2.0000 0.0000 Constraint 808 859 0.8000 1.0000 2.0000 0.0000 Constraint 808 848 0.8000 1.0000 2.0000 0.0000 Constraint 808 836 0.8000 1.0000 2.0000 0.0000 Constraint 808 829 0.8000 1.0000 2.0000 0.0000 Constraint 808 818 0.8000 1.0000 2.0000 0.0000 Constraint 800 1788 0.8000 1.0000 2.0000 0.0000 Constraint 800 1772 0.8000 1.0000 2.0000 0.0000 Constraint 800 1764 0.8000 1.0000 2.0000 0.0000 Constraint 800 1756 0.8000 1.0000 2.0000 0.0000 Constraint 800 1748 0.8000 1.0000 2.0000 0.0000 Constraint 800 1739 0.8000 1.0000 2.0000 0.0000 Constraint 800 1731 0.8000 1.0000 2.0000 0.0000 Constraint 800 1714 0.8000 1.0000 2.0000 0.0000 Constraint 800 1703 0.8000 1.0000 2.0000 0.0000 Constraint 800 1692 0.8000 1.0000 2.0000 0.0000 Constraint 800 1683 0.8000 1.0000 2.0000 0.0000 Constraint 800 1678 0.8000 1.0000 2.0000 0.0000 Constraint 800 1670 0.8000 1.0000 2.0000 0.0000 Constraint 800 1662 0.8000 1.0000 2.0000 0.0000 Constraint 800 1657 0.8000 1.0000 2.0000 0.0000 Constraint 800 1587 0.8000 1.0000 2.0000 0.0000 Constraint 800 1548 0.8000 1.0000 2.0000 0.0000 Constraint 800 1503 0.8000 1.0000 2.0000 0.0000 Constraint 800 1494 0.8000 1.0000 2.0000 0.0000 Constraint 800 1488 0.8000 1.0000 2.0000 0.0000 Constraint 800 1399 0.8000 1.0000 2.0000 0.0000 Constraint 800 1366 0.8000 1.0000 2.0000 0.0000 Constraint 800 1334 0.8000 1.0000 2.0000 0.0000 Constraint 800 1309 0.8000 1.0000 2.0000 0.0000 Constraint 800 1301 0.8000 1.0000 2.0000 0.0000 Constraint 800 1276 0.8000 1.0000 2.0000 0.0000 Constraint 800 1251 0.8000 1.0000 2.0000 0.0000 Constraint 800 1220 0.8000 1.0000 2.0000 0.0000 Constraint 800 1158 0.8000 1.0000 2.0000 0.0000 Constraint 800 1125 0.8000 1.0000 2.0000 0.0000 Constraint 800 859 0.8000 1.0000 2.0000 0.0000 Constraint 800 848 0.8000 1.0000 2.0000 0.0000 Constraint 800 836 0.8000 1.0000 2.0000 0.0000 Constraint 800 829 0.8000 1.0000 2.0000 0.0000 Constraint 800 818 0.8000 1.0000 2.0000 0.0000 Constraint 800 808 0.8000 1.0000 2.0000 0.0000 Constraint 792 1772 0.8000 1.0000 2.0000 0.0000 Constraint 792 1764 0.8000 1.0000 2.0000 0.0000 Constraint 792 1748 0.8000 1.0000 2.0000 0.0000 Constraint 792 1739 0.8000 1.0000 2.0000 0.0000 Constraint 792 1714 0.8000 1.0000 2.0000 0.0000 Constraint 792 1703 0.8000 1.0000 2.0000 0.0000 Constraint 792 1683 0.8000 1.0000 2.0000 0.0000 Constraint 792 1649 0.8000 1.0000 2.0000 0.0000 Constraint 792 1634 0.8000 1.0000 2.0000 0.0000 Constraint 792 1603 0.8000 1.0000 2.0000 0.0000 Constraint 792 1575 0.8000 1.0000 2.0000 0.0000 Constraint 792 1533 0.8000 1.0000 2.0000 0.0000 Constraint 792 1526 0.8000 1.0000 2.0000 0.0000 Constraint 792 1519 0.8000 1.0000 2.0000 0.0000 Constraint 792 1511 0.8000 1.0000 2.0000 0.0000 Constraint 792 1503 0.8000 1.0000 2.0000 0.0000 Constraint 792 1494 0.8000 1.0000 2.0000 0.0000 Constraint 792 1488 0.8000 1.0000 2.0000 0.0000 Constraint 792 1471 0.8000 1.0000 2.0000 0.0000 Constraint 792 1466 0.8000 1.0000 2.0000 0.0000 Constraint 792 1455 0.8000 1.0000 2.0000 0.0000 Constraint 792 1366 0.8000 1.0000 2.0000 0.0000 Constraint 792 1343 0.8000 1.0000 2.0000 0.0000 Constraint 792 1334 0.8000 1.0000 2.0000 0.0000 Constraint 792 1309 0.8000 1.0000 2.0000 0.0000 Constraint 792 1268 0.8000 1.0000 2.0000 0.0000 Constraint 792 1246 0.8000 1.0000 2.0000 0.0000 Constraint 792 1239 0.8000 1.0000 2.0000 0.0000 Constraint 792 1220 0.8000 1.0000 2.0000 0.0000 Constraint 792 1213 0.8000 1.0000 2.0000 0.0000 Constraint 792 1193 0.8000 1.0000 2.0000 0.0000 Constraint 792 1149 0.8000 1.0000 2.0000 0.0000 Constraint 792 1125 0.8000 1.0000 2.0000 0.0000 Constraint 792 1100 0.8000 1.0000 2.0000 0.0000 Constraint 792 848 0.8000 1.0000 2.0000 0.0000 Constraint 792 836 0.8000 1.0000 2.0000 0.0000 Constraint 792 829 0.8000 1.0000 2.0000 0.0000 Constraint 792 818 0.8000 1.0000 2.0000 0.0000 Constraint 792 808 0.8000 1.0000 2.0000 0.0000 Constraint 792 800 0.8000 1.0000 2.0000 0.0000 Constraint 783 1777 0.8000 1.0000 2.0000 0.0000 Constraint 783 1748 0.8000 1.0000 2.0000 0.0000 Constraint 783 1731 0.8000 1.0000 2.0000 0.0000 Constraint 783 1720 0.8000 1.0000 2.0000 0.0000 Constraint 783 1714 0.8000 1.0000 2.0000 0.0000 Constraint 783 1692 0.8000 1.0000 2.0000 0.0000 Constraint 783 1596 0.8000 1.0000 2.0000 0.0000 Constraint 783 1587 0.8000 1.0000 2.0000 0.0000 Constraint 783 1533 0.8000 1.0000 2.0000 0.0000 Constraint 783 1526 0.8000 1.0000 2.0000 0.0000 Constraint 783 1519 0.8000 1.0000 2.0000 0.0000 Constraint 783 1503 0.8000 1.0000 2.0000 0.0000 Constraint 783 1309 0.8000 1.0000 2.0000 0.0000 Constraint 783 1276 0.8000 1.0000 2.0000 0.0000 Constraint 783 1268 0.8000 1.0000 2.0000 0.0000 Constraint 783 1251 0.8000 1.0000 2.0000 0.0000 Constraint 783 1246 0.8000 1.0000 2.0000 0.0000 Constraint 783 1220 0.8000 1.0000 2.0000 0.0000 Constraint 783 1213 0.8000 1.0000 2.0000 0.0000 Constraint 783 1193 0.8000 1.0000 2.0000 0.0000 Constraint 783 1158 0.8000 1.0000 2.0000 0.0000 Constraint 783 1149 0.8000 1.0000 2.0000 0.0000 Constraint 783 1125 0.8000 1.0000 2.0000 0.0000 Constraint 783 1117 0.8000 1.0000 2.0000 0.0000 Constraint 783 1100 0.8000 1.0000 2.0000 0.0000 Constraint 783 1022 0.8000 1.0000 2.0000 0.0000 Constraint 783 836 0.8000 1.0000 2.0000 0.0000 Constraint 783 829 0.8000 1.0000 2.0000 0.0000 Constraint 783 818 0.8000 1.0000 2.0000 0.0000 Constraint 783 808 0.8000 1.0000 2.0000 0.0000 Constraint 783 800 0.8000 1.0000 2.0000 0.0000 Constraint 783 792 0.8000 1.0000 2.0000 0.0000 Constraint 778 1788 0.8000 1.0000 2.0000 0.0000 Constraint 778 1772 0.8000 1.0000 2.0000 0.0000 Constraint 778 1739 0.8000 1.0000 2.0000 0.0000 Constraint 778 1731 0.8000 1.0000 2.0000 0.0000 Constraint 778 1714 0.8000 1.0000 2.0000 0.0000 Constraint 778 1703 0.8000 1.0000 2.0000 0.0000 Constraint 778 1692 0.8000 1.0000 2.0000 0.0000 Constraint 778 1683 0.8000 1.0000 2.0000 0.0000 Constraint 778 1587 0.8000 1.0000 2.0000 0.0000 Constraint 778 1575 0.8000 1.0000 2.0000 0.0000 Constraint 778 1541 0.8000 1.0000 2.0000 0.0000 Constraint 778 1533 0.8000 1.0000 2.0000 0.0000 Constraint 778 1519 0.8000 1.0000 2.0000 0.0000 Constraint 778 1494 0.8000 1.0000 2.0000 0.0000 Constraint 778 1488 0.8000 1.0000 2.0000 0.0000 Constraint 778 1466 0.8000 1.0000 2.0000 0.0000 Constraint 778 1427 0.8000 1.0000 2.0000 0.0000 Constraint 778 1391 0.8000 1.0000 2.0000 0.0000 Constraint 778 1366 0.8000 1.0000 2.0000 0.0000 Constraint 778 1358 0.8000 1.0000 2.0000 0.0000 Constraint 778 1309 0.8000 1.0000 2.0000 0.0000 Constraint 778 1276 0.8000 1.0000 2.0000 0.0000 Constraint 778 1251 0.8000 1.0000 2.0000 0.0000 Constraint 778 1246 0.8000 1.0000 2.0000 0.0000 Constraint 778 1213 0.8000 1.0000 2.0000 0.0000 Constraint 778 1178 0.8000 1.0000 2.0000 0.0000 Constraint 778 1158 0.8000 1.0000 2.0000 0.0000 Constraint 778 1125 0.8000 1.0000 2.0000 0.0000 Constraint 778 908 0.8000 1.0000 2.0000 0.0000 Constraint 778 836 0.8000 1.0000 2.0000 0.0000 Constraint 778 829 0.8000 1.0000 2.0000 0.0000 Constraint 778 818 0.8000 1.0000 2.0000 0.0000 Constraint 778 808 0.8000 1.0000 2.0000 0.0000 Constraint 778 800 0.8000 1.0000 2.0000 0.0000 Constraint 778 792 0.8000 1.0000 2.0000 0.0000 Constraint 778 783 0.8000 1.0000 2.0000 0.0000 Constraint 769 1788 0.8000 1.0000 2.0000 0.0000 Constraint 769 1777 0.8000 1.0000 2.0000 0.0000 Constraint 769 1772 0.8000 1.0000 2.0000 0.0000 Constraint 769 1764 0.8000 1.0000 2.0000 0.0000 Constraint 769 1739 0.8000 1.0000 2.0000 0.0000 Constraint 769 1731 0.8000 1.0000 2.0000 0.0000 Constraint 769 1714 0.8000 1.0000 2.0000 0.0000 Constraint 769 1703 0.8000 1.0000 2.0000 0.0000 Constraint 769 1683 0.8000 1.0000 2.0000 0.0000 Constraint 769 1678 0.8000 1.0000 2.0000 0.0000 Constraint 769 1657 0.8000 1.0000 2.0000 0.0000 Constraint 769 1587 0.8000 1.0000 2.0000 0.0000 Constraint 769 1575 0.8000 1.0000 2.0000 0.0000 Constraint 769 1548 0.8000 1.0000 2.0000 0.0000 Constraint 769 1541 0.8000 1.0000 2.0000 0.0000 Constraint 769 1533 0.8000 1.0000 2.0000 0.0000 Constraint 769 1526 0.8000 1.0000 2.0000 0.0000 Constraint 769 1519 0.8000 1.0000 2.0000 0.0000 Constraint 769 1503 0.8000 1.0000 2.0000 0.0000 Constraint 769 1427 0.8000 1.0000 2.0000 0.0000 Constraint 769 1366 0.8000 1.0000 2.0000 0.0000 Constraint 769 1251 0.8000 1.0000 2.0000 0.0000 Constraint 769 1246 0.8000 1.0000 2.0000 0.0000 Constraint 769 1220 0.8000 1.0000 2.0000 0.0000 Constraint 769 1213 0.8000 1.0000 2.0000 0.0000 Constraint 769 1178 0.8000 1.0000 2.0000 0.0000 Constraint 769 1125 0.8000 1.0000 2.0000 0.0000 Constraint 769 884 0.8000 1.0000 2.0000 0.0000 Constraint 769 829 0.8000 1.0000 2.0000 0.0000 Constraint 769 818 0.8000 1.0000 2.0000 0.0000 Constraint 769 808 0.8000 1.0000 2.0000 0.0000 Constraint 769 800 0.8000 1.0000 2.0000 0.0000 Constraint 769 792 0.8000 1.0000 2.0000 0.0000 Constraint 769 783 0.8000 1.0000 2.0000 0.0000 Constraint 769 778 0.8000 1.0000 2.0000 0.0000 Constraint 761 1788 0.8000 1.0000 2.0000 0.0000 Constraint 761 1777 0.8000 1.0000 2.0000 0.0000 Constraint 761 1772 0.8000 1.0000 2.0000 0.0000 Constraint 761 1764 0.8000 1.0000 2.0000 0.0000 Constraint 761 1756 0.8000 1.0000 2.0000 0.0000 Constraint 761 1748 0.8000 1.0000 2.0000 0.0000 Constraint 761 1731 0.8000 1.0000 2.0000 0.0000 Constraint 761 1720 0.8000 1.0000 2.0000 0.0000 Constraint 761 1714 0.8000 1.0000 2.0000 0.0000 Constraint 761 1703 0.8000 1.0000 2.0000 0.0000 Constraint 761 1692 0.8000 1.0000 2.0000 0.0000 Constraint 761 1670 0.8000 1.0000 2.0000 0.0000 Constraint 761 1649 0.8000 1.0000 2.0000 0.0000 Constraint 761 1634 0.8000 1.0000 2.0000 0.0000 Constraint 761 1620 0.8000 1.0000 2.0000 0.0000 Constraint 761 1603 0.8000 1.0000 2.0000 0.0000 Constraint 761 1596 0.8000 1.0000 2.0000 0.0000 Constraint 761 1587 0.8000 1.0000 2.0000 0.0000 Constraint 761 1575 0.8000 1.0000 2.0000 0.0000 Constraint 761 1567 0.8000 1.0000 2.0000 0.0000 Constraint 761 1541 0.8000 1.0000 2.0000 0.0000 Constraint 761 1533 0.8000 1.0000 2.0000 0.0000 Constraint 761 1526 0.8000 1.0000 2.0000 0.0000 Constraint 761 1511 0.8000 1.0000 2.0000 0.0000 Constraint 761 1503 0.8000 1.0000 2.0000 0.0000 Constraint 761 1494 0.8000 1.0000 2.0000 0.0000 Constraint 761 1479 0.8000 1.0000 2.0000 0.0000 Constraint 761 1471 0.8000 1.0000 2.0000 0.0000 Constraint 761 1455 0.8000 1.0000 2.0000 0.0000 Constraint 761 1447 0.8000 1.0000 2.0000 0.0000 Constraint 761 1427 0.8000 1.0000 2.0000 0.0000 Constraint 761 1416 0.8000 1.0000 2.0000 0.0000 Constraint 761 1408 0.8000 1.0000 2.0000 0.0000 Constraint 761 1399 0.8000 1.0000 2.0000 0.0000 Constraint 761 1391 0.8000 1.0000 2.0000 0.0000 Constraint 761 1382 0.8000 1.0000 2.0000 0.0000 Constraint 761 1374 0.8000 1.0000 2.0000 0.0000 Constraint 761 1366 0.8000 1.0000 2.0000 0.0000 Constraint 761 1358 0.8000 1.0000 2.0000 0.0000 Constraint 761 1351 0.8000 1.0000 2.0000 0.0000 Constraint 761 1343 0.8000 1.0000 2.0000 0.0000 Constraint 761 1334 0.8000 1.0000 2.0000 0.0000 Constraint 761 1325 0.8000 1.0000 2.0000 0.0000 Constraint 761 1251 0.8000 1.0000 2.0000 0.0000 Constraint 761 1246 0.8000 1.0000 2.0000 0.0000 Constraint 761 1239 0.8000 1.0000 2.0000 0.0000 Constraint 761 1220 0.8000 1.0000 2.0000 0.0000 Constraint 761 1213 0.8000 1.0000 2.0000 0.0000 Constraint 761 1178 0.8000 1.0000 2.0000 0.0000 Constraint 761 1149 0.8000 1.0000 2.0000 0.0000 Constraint 761 1141 0.8000 1.0000 2.0000 0.0000 Constraint 761 1133 0.8000 1.0000 2.0000 0.0000 Constraint 761 1109 0.8000 1.0000 2.0000 0.0000 Constraint 761 1100 0.8000 1.0000 2.0000 0.0000 Constraint 761 818 0.8000 1.0000 2.0000 0.0000 Constraint 761 808 0.8000 1.0000 2.0000 0.0000 Constraint 761 800 0.8000 1.0000 2.0000 0.0000 Constraint 761 792 0.8000 1.0000 2.0000 0.0000 Constraint 761 783 0.8000 1.0000 2.0000 0.0000 Constraint 761 778 0.8000 1.0000 2.0000 0.0000 Constraint 761 769 0.8000 1.0000 2.0000 0.0000 Constraint 756 1777 0.8000 1.0000 2.0000 0.0000 Constraint 756 1772 0.8000 1.0000 2.0000 0.0000 Constraint 756 1756 0.8000 1.0000 2.0000 0.0000 Constraint 756 1748 0.8000 1.0000 2.0000 0.0000 Constraint 756 1720 0.8000 1.0000 2.0000 0.0000 Constraint 756 1714 0.8000 1.0000 2.0000 0.0000 Constraint 756 1692 0.8000 1.0000 2.0000 0.0000 Constraint 756 1649 0.8000 1.0000 2.0000 0.0000 Constraint 756 1620 0.8000 1.0000 2.0000 0.0000 Constraint 756 1611 0.8000 1.0000 2.0000 0.0000 Constraint 756 1587 0.8000 1.0000 2.0000 0.0000 Constraint 756 1575 0.8000 1.0000 2.0000 0.0000 Constraint 756 1541 0.8000 1.0000 2.0000 0.0000 Constraint 756 1447 0.8000 1.0000 2.0000 0.0000 Constraint 756 1391 0.8000 1.0000 2.0000 0.0000 Constraint 756 1366 0.8000 1.0000 2.0000 0.0000 Constraint 756 1358 0.8000 1.0000 2.0000 0.0000 Constraint 756 1334 0.8000 1.0000 2.0000 0.0000 Constraint 756 1251 0.8000 1.0000 2.0000 0.0000 Constraint 756 1246 0.8000 1.0000 2.0000 0.0000 Constraint 756 1239 0.8000 1.0000 2.0000 0.0000 Constraint 756 1228 0.8000 1.0000 2.0000 0.0000 Constraint 756 1220 0.8000 1.0000 2.0000 0.0000 Constraint 756 1204 0.8000 1.0000 2.0000 0.0000 Constraint 756 1193 0.8000 1.0000 2.0000 0.0000 Constraint 756 1149 0.8000 1.0000 2.0000 0.0000 Constraint 756 1125 0.8000 1.0000 2.0000 0.0000 Constraint 756 1092 0.8000 1.0000 2.0000 0.0000 Constraint 756 808 0.8000 1.0000 2.0000 0.0000 Constraint 756 800 0.8000 1.0000 2.0000 0.0000 Constraint 756 792 0.8000 1.0000 2.0000 0.0000 Constraint 756 783 0.8000 1.0000 2.0000 0.0000 Constraint 756 778 0.8000 1.0000 2.0000 0.0000 Constraint 756 769 0.8000 1.0000 2.0000 0.0000 Constraint 756 761 0.8000 1.0000 2.0000 0.0000 Constraint 748 1788 0.8000 1.0000 2.0000 0.0000 Constraint 748 1777 0.8000 1.0000 2.0000 0.0000 Constraint 748 1772 0.8000 1.0000 2.0000 0.0000 Constraint 748 1764 0.8000 1.0000 2.0000 0.0000 Constraint 748 1756 0.8000 1.0000 2.0000 0.0000 Constraint 748 1748 0.8000 1.0000 2.0000 0.0000 Constraint 748 1739 0.8000 1.0000 2.0000 0.0000 Constraint 748 1720 0.8000 1.0000 2.0000 0.0000 Constraint 748 1683 0.8000 1.0000 2.0000 0.0000 Constraint 748 1620 0.8000 1.0000 2.0000 0.0000 Constraint 748 1587 0.8000 1.0000 2.0000 0.0000 Constraint 748 1575 0.8000 1.0000 2.0000 0.0000 Constraint 748 1494 0.8000 1.0000 2.0000 0.0000 Constraint 748 1488 0.8000 1.0000 2.0000 0.0000 Constraint 748 1479 0.8000 1.0000 2.0000 0.0000 Constraint 748 1427 0.8000 1.0000 2.0000 0.0000 Constraint 748 1343 0.8000 1.0000 2.0000 0.0000 Constraint 748 1251 0.8000 1.0000 2.0000 0.0000 Constraint 748 1193 0.8000 1.0000 2.0000 0.0000 Constraint 748 1158 0.8000 1.0000 2.0000 0.0000 Constraint 748 1149 0.8000 1.0000 2.0000 0.0000 Constraint 748 1117 0.8000 1.0000 2.0000 0.0000 Constraint 748 1077 0.8000 1.0000 2.0000 0.0000 Constraint 748 808 0.8000 1.0000 2.0000 0.0000 Constraint 748 800 0.8000 1.0000 2.0000 0.0000 Constraint 748 792 0.8000 1.0000 2.0000 0.0000 Constraint 748 783 0.8000 1.0000 2.0000 0.0000 Constraint 748 778 0.8000 1.0000 2.0000 0.0000 Constraint 748 769 0.8000 1.0000 2.0000 0.0000 Constraint 748 761 0.8000 1.0000 2.0000 0.0000 Constraint 748 756 0.8000 1.0000 2.0000 0.0000 Constraint 739 1788 0.8000 1.0000 2.0000 0.0000 Constraint 739 1772 0.8000 1.0000 2.0000 0.0000 Constraint 739 1764 0.8000 1.0000 2.0000 0.0000 Constraint 739 1739 0.8000 1.0000 2.0000 0.0000 Constraint 739 1731 0.8000 1.0000 2.0000 0.0000 Constraint 739 1720 0.8000 1.0000 2.0000 0.0000 Constraint 739 1714 0.8000 1.0000 2.0000 0.0000 Constraint 739 1703 0.8000 1.0000 2.0000 0.0000 Constraint 739 1683 0.8000 1.0000 2.0000 0.0000 Constraint 739 1678 0.8000 1.0000 2.0000 0.0000 Constraint 739 1634 0.8000 1.0000 2.0000 0.0000 Constraint 739 1611 0.8000 1.0000 2.0000 0.0000 Constraint 739 1603 0.8000 1.0000 2.0000 0.0000 Constraint 739 1596 0.8000 1.0000 2.0000 0.0000 Constraint 739 1587 0.8000 1.0000 2.0000 0.0000 Constraint 739 1575 0.8000 1.0000 2.0000 0.0000 Constraint 739 1567 0.8000 1.0000 2.0000 0.0000 Constraint 739 1556 0.8000 1.0000 2.0000 0.0000 Constraint 739 1533 0.8000 1.0000 2.0000 0.0000 Constraint 739 1526 0.8000 1.0000 2.0000 0.0000 Constraint 739 1511 0.8000 1.0000 2.0000 0.0000 Constraint 739 1503 0.8000 1.0000 2.0000 0.0000 Constraint 739 1427 0.8000 1.0000 2.0000 0.0000 Constraint 739 1416 0.8000 1.0000 2.0000 0.0000 Constraint 739 1399 0.8000 1.0000 2.0000 0.0000 Constraint 739 1366 0.8000 1.0000 2.0000 0.0000 Constraint 739 1251 0.8000 1.0000 2.0000 0.0000 Constraint 739 1220 0.8000 1.0000 2.0000 0.0000 Constraint 739 1213 0.8000 1.0000 2.0000 0.0000 Constraint 739 1204 0.8000 1.0000 2.0000 0.0000 Constraint 739 1193 0.8000 1.0000 2.0000 0.0000 Constraint 739 1167 0.8000 1.0000 2.0000 0.0000 Constraint 739 1149 0.8000 1.0000 2.0000 0.0000 Constraint 739 1133 0.8000 1.0000 2.0000 0.0000 Constraint 739 1125 0.8000 1.0000 2.0000 0.0000 Constraint 739 1117 0.8000 1.0000 2.0000 0.0000 Constraint 739 1109 0.8000 1.0000 2.0000 0.0000 Constraint 739 1077 0.8000 1.0000 2.0000 0.0000 Constraint 739 1022 0.8000 1.0000 2.0000 0.0000 Constraint 739 1008 0.8000 1.0000 2.0000 0.0000 Constraint 739 988 0.8000 1.0000 2.0000 0.0000 Constraint 739 955 0.8000 1.0000 2.0000 0.0000 Constraint 739 913 0.8000 1.0000 2.0000 0.0000 Constraint 739 800 0.8000 1.0000 2.0000 0.0000 Constraint 739 792 0.8000 1.0000 2.0000 0.0000 Constraint 739 783 0.8000 1.0000 2.0000 0.0000 Constraint 739 778 0.8000 1.0000 2.0000 0.0000 Constraint 739 769 0.8000 1.0000 2.0000 0.0000 Constraint 739 761 0.8000 1.0000 2.0000 0.0000 Constraint 739 756 0.8000 1.0000 2.0000 0.0000 Constraint 739 748 0.8000 1.0000 2.0000 0.0000 Constraint 731 1788 0.8000 1.0000 2.0000 0.0000 Constraint 731 1777 0.8000 1.0000 2.0000 0.0000 Constraint 731 1764 0.8000 1.0000 2.0000 0.0000 Constraint 731 1756 0.8000 1.0000 2.0000 0.0000 Constraint 731 1748 0.8000 1.0000 2.0000 0.0000 Constraint 731 1731 0.8000 1.0000 2.0000 0.0000 Constraint 731 1720 0.8000 1.0000 2.0000 0.0000 Constraint 731 1703 0.8000 1.0000 2.0000 0.0000 Constraint 731 1692 0.8000 1.0000 2.0000 0.0000 Constraint 731 1678 0.8000 1.0000 2.0000 0.0000 Constraint 731 1670 0.8000 1.0000 2.0000 0.0000 Constraint 731 1634 0.8000 1.0000 2.0000 0.0000 Constraint 731 1620 0.8000 1.0000 2.0000 0.0000 Constraint 731 1611 0.8000 1.0000 2.0000 0.0000 Constraint 731 1596 0.8000 1.0000 2.0000 0.0000 Constraint 731 1587 0.8000 1.0000 2.0000 0.0000 Constraint 731 1556 0.8000 1.0000 2.0000 0.0000 Constraint 731 1526 0.8000 1.0000 2.0000 0.0000 Constraint 731 1343 0.8000 1.0000 2.0000 0.0000 Constraint 731 1334 0.8000 1.0000 2.0000 0.0000 Constraint 731 1276 0.8000 1.0000 2.0000 0.0000 Constraint 731 1268 0.8000 1.0000 2.0000 0.0000 Constraint 731 1246 0.8000 1.0000 2.0000 0.0000 Constraint 731 1239 0.8000 1.0000 2.0000 0.0000 Constraint 731 1228 0.8000 1.0000 2.0000 0.0000 Constraint 731 1220 0.8000 1.0000 2.0000 0.0000 Constraint 731 1204 0.8000 1.0000 2.0000 0.0000 Constraint 731 1149 0.8000 1.0000 2.0000 0.0000 Constraint 731 1117 0.8000 1.0000 2.0000 0.0000 Constraint 731 908 0.8000 1.0000 2.0000 0.0000 Constraint 731 792 0.8000 1.0000 2.0000 0.0000 Constraint 731 783 0.8000 1.0000 2.0000 0.0000 Constraint 731 778 0.8000 1.0000 2.0000 0.0000 Constraint 731 769 0.8000 1.0000 2.0000 0.0000 Constraint 731 761 0.8000 1.0000 2.0000 0.0000 Constraint 731 756 0.8000 1.0000 2.0000 0.0000 Constraint 731 748 0.8000 1.0000 2.0000 0.0000 Constraint 731 739 0.8000 1.0000 2.0000 0.0000 Constraint 722 1777 0.8000 1.0000 2.0000 0.0000 Constraint 722 1772 0.8000 1.0000 2.0000 0.0000 Constraint 722 1756 0.8000 1.0000 2.0000 0.0000 Constraint 722 1683 0.8000 1.0000 2.0000 0.0000 Constraint 722 1662 0.8000 1.0000 2.0000 0.0000 Constraint 722 1649 0.8000 1.0000 2.0000 0.0000 Constraint 722 1620 0.8000 1.0000 2.0000 0.0000 Constraint 722 1587 0.8000 1.0000 2.0000 0.0000 Constraint 722 1358 0.8000 1.0000 2.0000 0.0000 Constraint 722 1251 0.8000 1.0000 2.0000 0.0000 Constraint 722 1246 0.8000 1.0000 2.0000 0.0000 Constraint 722 1213 0.8000 1.0000 2.0000 0.0000 Constraint 722 1204 0.8000 1.0000 2.0000 0.0000 Constraint 722 783 0.8000 1.0000 2.0000 0.0000 Constraint 722 778 0.8000 1.0000 2.0000 0.0000 Constraint 722 769 0.8000 1.0000 2.0000 0.0000 Constraint 722 761 0.8000 1.0000 2.0000 0.0000 Constraint 722 756 0.8000 1.0000 2.0000 0.0000 Constraint 722 748 0.8000 1.0000 2.0000 0.0000 Constraint 722 739 0.8000 1.0000 2.0000 0.0000 Constraint 722 731 0.8000 1.0000 2.0000 0.0000 Constraint 713 1772 0.8000 1.0000 2.0000 0.0000 Constraint 713 1756 0.8000 1.0000 2.0000 0.0000 Constraint 713 1739 0.8000 1.0000 2.0000 0.0000 Constraint 713 1683 0.8000 1.0000 2.0000 0.0000 Constraint 713 1603 0.8000 1.0000 2.0000 0.0000 Constraint 713 1587 0.8000 1.0000 2.0000 0.0000 Constraint 713 1548 0.8000 1.0000 2.0000 0.0000 Constraint 713 1488 0.8000 1.0000 2.0000 0.0000 Constraint 713 1479 0.8000 1.0000 2.0000 0.0000 Constraint 713 1466 0.8000 1.0000 2.0000 0.0000 Constraint 713 1455 0.8000 1.0000 2.0000 0.0000 Constraint 713 1438 0.8000 1.0000 2.0000 0.0000 Constraint 713 1399 0.8000 1.0000 2.0000 0.0000 Constraint 713 1193 0.8000 1.0000 2.0000 0.0000 Constraint 713 1141 0.8000 1.0000 2.0000 0.0000 Constraint 713 1117 0.8000 1.0000 2.0000 0.0000 Constraint 713 1109 0.8000 1.0000 2.0000 0.0000 Constraint 713 1084 0.8000 1.0000 2.0000 0.0000 Constraint 713 1068 0.8000 1.0000 2.0000 0.0000 Constraint 713 1014 0.8000 1.0000 2.0000 0.0000 Constraint 713 980 0.8000 1.0000 2.0000 0.0000 Constraint 713 921 0.8000 1.0000 2.0000 0.0000 Constraint 713 899 0.8000 1.0000 2.0000 0.0000 Constraint 713 778 0.8000 1.0000 2.0000 0.0000 Constraint 713 769 0.8000 1.0000 2.0000 0.0000 Constraint 713 761 0.8000 1.0000 2.0000 0.0000 Constraint 713 756 0.8000 1.0000 2.0000 0.0000 Constraint 713 748 0.8000 1.0000 2.0000 0.0000 Constraint 713 739 0.8000 1.0000 2.0000 0.0000 Constraint 713 731 0.8000 1.0000 2.0000 0.0000 Constraint 713 722 0.8000 1.0000 2.0000 0.0000 Constraint 706 1788 0.8000 1.0000 2.0000 0.0000 Constraint 706 1772 0.8000 1.0000 2.0000 0.0000 Constraint 706 1764 0.8000 1.0000 2.0000 0.0000 Constraint 706 1756 0.8000 1.0000 2.0000 0.0000 Constraint 706 1748 0.8000 1.0000 2.0000 0.0000 Constraint 706 1739 0.8000 1.0000 2.0000 0.0000 Constraint 706 1731 0.8000 1.0000 2.0000 0.0000 Constraint 706 1720 0.8000 1.0000 2.0000 0.0000 Constraint 706 1714 0.8000 1.0000 2.0000 0.0000 Constraint 706 1703 0.8000 1.0000 2.0000 0.0000 Constraint 706 1692 0.8000 1.0000 2.0000 0.0000 Constraint 706 1683 0.8000 1.0000 2.0000 0.0000 Constraint 706 1670 0.8000 1.0000 2.0000 0.0000 Constraint 706 1649 0.8000 1.0000 2.0000 0.0000 Constraint 706 1634 0.8000 1.0000 2.0000 0.0000 Constraint 706 1611 0.8000 1.0000 2.0000 0.0000 Constraint 706 1603 0.8000 1.0000 2.0000 0.0000 Constraint 706 1548 0.8000 1.0000 2.0000 0.0000 Constraint 706 1488 0.8000 1.0000 2.0000 0.0000 Constraint 706 1479 0.8000 1.0000 2.0000 0.0000 Constraint 706 1466 0.8000 1.0000 2.0000 0.0000 Constraint 706 1455 0.8000 1.0000 2.0000 0.0000 Constraint 706 1334 0.8000 1.0000 2.0000 0.0000 Constraint 706 1309 0.8000 1.0000 2.0000 0.0000 Constraint 706 1284 0.8000 1.0000 2.0000 0.0000 Constraint 706 1276 0.8000 1.0000 2.0000 0.0000 Constraint 706 1251 0.8000 1.0000 2.0000 0.0000 Constraint 706 1246 0.8000 1.0000 2.0000 0.0000 Constraint 706 1228 0.8000 1.0000 2.0000 0.0000 Constraint 706 1220 0.8000 1.0000 2.0000 0.0000 Constraint 706 1149 0.8000 1.0000 2.0000 0.0000 Constraint 706 1125 0.8000 1.0000 2.0000 0.0000 Constraint 706 1109 0.8000 1.0000 2.0000 0.0000 Constraint 706 1092 0.8000 1.0000 2.0000 0.0000 Constraint 706 1068 0.8000 1.0000 2.0000 0.0000 Constraint 706 1054 0.8000 1.0000 2.0000 0.0000 Constraint 706 908 0.8000 1.0000 2.0000 0.0000 Constraint 706 899 0.8000 1.0000 2.0000 0.0000 Constraint 706 884 0.8000 1.0000 2.0000 0.0000 Constraint 706 868 0.8000 1.0000 2.0000 0.0000 Constraint 706 769 0.8000 1.0000 2.0000 0.0000 Constraint 706 761 0.8000 1.0000 2.0000 0.0000 Constraint 706 756 0.8000 1.0000 2.0000 0.0000 Constraint 706 748 0.8000 1.0000 2.0000 0.0000 Constraint 706 739 0.8000 1.0000 2.0000 0.0000 Constraint 706 731 0.8000 1.0000 2.0000 0.0000 Constraint 706 722 0.8000 1.0000 2.0000 0.0000 Constraint 706 713 0.8000 1.0000 2.0000 0.0000 Constraint 698 1788 0.8000 1.0000 2.0000 0.0000 Constraint 698 1777 0.8000 1.0000 2.0000 0.0000 Constraint 698 1764 0.8000 1.0000 2.0000 0.0000 Constraint 698 1756 0.8000 1.0000 2.0000 0.0000 Constraint 698 1731 0.8000 1.0000 2.0000 0.0000 Constraint 698 1720 0.8000 1.0000 2.0000 0.0000 Constraint 698 1714 0.8000 1.0000 2.0000 0.0000 Constraint 698 1703 0.8000 1.0000 2.0000 0.0000 Constraint 698 1692 0.8000 1.0000 2.0000 0.0000 Constraint 698 1683 0.8000 1.0000 2.0000 0.0000 Constraint 698 1670 0.8000 1.0000 2.0000 0.0000 Constraint 698 1662 0.8000 1.0000 2.0000 0.0000 Constraint 698 1657 0.8000 1.0000 2.0000 0.0000 Constraint 698 1611 0.8000 1.0000 2.0000 0.0000 Constraint 698 1575 0.8000 1.0000 2.0000 0.0000 Constraint 698 1567 0.8000 1.0000 2.0000 0.0000 Constraint 698 1548 0.8000 1.0000 2.0000 0.0000 Constraint 698 1488 0.8000 1.0000 2.0000 0.0000 Constraint 698 1358 0.8000 1.0000 2.0000 0.0000 Constraint 698 1334 0.8000 1.0000 2.0000 0.0000 Constraint 698 1325 0.8000 1.0000 2.0000 0.0000 Constraint 698 1309 0.8000 1.0000 2.0000 0.0000 Constraint 698 1301 0.8000 1.0000 2.0000 0.0000 Constraint 698 1276 0.8000 1.0000 2.0000 0.0000 Constraint 698 1246 0.8000 1.0000 2.0000 0.0000 Constraint 698 1178 0.8000 1.0000 2.0000 0.0000 Constraint 698 1149 0.8000 1.0000 2.0000 0.0000 Constraint 698 930 0.8000 1.0000 2.0000 0.0000 Constraint 698 761 0.8000 1.0000 2.0000 0.0000 Constraint 698 756 0.8000 1.0000 2.0000 0.0000 Constraint 698 748 0.8000 1.0000 2.0000 0.0000 Constraint 698 739 0.8000 1.0000 2.0000 0.0000 Constraint 698 731 0.8000 1.0000 2.0000 0.0000 Constraint 698 722 0.8000 1.0000 2.0000 0.0000 Constraint 698 713 0.8000 1.0000 2.0000 0.0000 Constraint 698 706 0.8000 1.0000 2.0000 0.0000 Constraint 690 1777 0.8000 1.0000 2.0000 0.0000 Constraint 690 1662 0.8000 1.0000 2.0000 0.0000 Constraint 690 1620 0.8000 1.0000 2.0000 0.0000 Constraint 690 1494 0.8000 1.0000 2.0000 0.0000 Constraint 690 1488 0.8000 1.0000 2.0000 0.0000 Constraint 690 1455 0.8000 1.0000 2.0000 0.0000 Constraint 690 1427 0.8000 1.0000 2.0000 0.0000 Constraint 690 1416 0.8000 1.0000 2.0000 0.0000 Constraint 690 1366 0.8000 1.0000 2.0000 0.0000 Constraint 690 1358 0.8000 1.0000 2.0000 0.0000 Constraint 690 1325 0.8000 1.0000 2.0000 0.0000 Constraint 690 1246 0.8000 1.0000 2.0000 0.0000 Constraint 690 1204 0.8000 1.0000 2.0000 0.0000 Constraint 690 1178 0.8000 1.0000 2.0000 0.0000 Constraint 690 1149 0.8000 1.0000 2.0000 0.0000 Constraint 690 1022 0.8000 1.0000 2.0000 0.0000 Constraint 690 899 0.8000 1.0000 2.0000 0.0000 Constraint 690 756 0.8000 1.0000 2.0000 0.0000 Constraint 690 748 0.8000 1.0000 2.0000 0.0000 Constraint 690 739 0.8000 1.0000 2.0000 0.0000 Constraint 690 731 0.8000 1.0000 2.0000 0.0000 Constraint 690 722 0.8000 1.0000 2.0000 0.0000 Constraint 690 713 0.8000 1.0000 2.0000 0.0000 Constraint 690 706 0.8000 1.0000 2.0000 0.0000 Constraint 690 698 0.8000 1.0000 2.0000 0.0000 Constraint 681 1788 0.8000 1.0000 2.0000 0.0000 Constraint 681 1777 0.8000 1.0000 2.0000 0.0000 Constraint 681 1772 0.8000 1.0000 2.0000 0.0000 Constraint 681 1764 0.8000 1.0000 2.0000 0.0000 Constraint 681 1756 0.8000 1.0000 2.0000 0.0000 Constraint 681 1739 0.8000 1.0000 2.0000 0.0000 Constraint 681 1731 0.8000 1.0000 2.0000 0.0000 Constraint 681 1703 0.8000 1.0000 2.0000 0.0000 Constraint 681 1678 0.8000 1.0000 2.0000 0.0000 Constraint 681 1670 0.8000 1.0000 2.0000 0.0000 Constraint 681 1657 0.8000 1.0000 2.0000 0.0000 Constraint 681 1649 0.8000 1.0000 2.0000 0.0000 Constraint 681 1603 0.8000 1.0000 2.0000 0.0000 Constraint 681 1596 0.8000 1.0000 2.0000 0.0000 Constraint 681 1575 0.8000 1.0000 2.0000 0.0000 Constraint 681 1567 0.8000 1.0000 2.0000 0.0000 Constraint 681 1556 0.8000 1.0000 2.0000 0.0000 Constraint 681 1548 0.8000 1.0000 2.0000 0.0000 Constraint 681 1541 0.8000 1.0000 2.0000 0.0000 Constraint 681 1519 0.8000 1.0000 2.0000 0.0000 Constraint 681 1494 0.8000 1.0000 2.0000 0.0000 Constraint 681 1488 0.8000 1.0000 2.0000 0.0000 Constraint 681 1479 0.8000 1.0000 2.0000 0.0000 Constraint 681 1471 0.8000 1.0000 2.0000 0.0000 Constraint 681 1466 0.8000 1.0000 2.0000 0.0000 Constraint 681 1358 0.8000 1.0000 2.0000 0.0000 Constraint 681 1284 0.8000 1.0000 2.0000 0.0000 Constraint 681 1251 0.8000 1.0000 2.0000 0.0000 Constraint 681 1228 0.8000 1.0000 2.0000 0.0000 Constraint 681 1204 0.8000 1.0000 2.0000 0.0000 Constraint 681 1193 0.8000 1.0000 2.0000 0.0000 Constraint 681 1167 0.8000 1.0000 2.0000 0.0000 Constraint 681 1149 0.8000 1.0000 2.0000 0.0000 Constraint 681 930 0.8000 1.0000 2.0000 0.0000 Constraint 681 921 0.8000 1.0000 2.0000 0.0000 Constraint 681 899 0.8000 1.0000 2.0000 0.0000 Constraint 681 748 0.8000 1.0000 2.0000 0.0000 Constraint 681 739 0.8000 1.0000 2.0000 0.0000 Constraint 681 731 0.8000 1.0000 2.0000 0.0000 Constraint 681 722 0.8000 1.0000 2.0000 0.0000 Constraint 681 713 0.8000 1.0000 2.0000 0.0000 Constraint 681 706 0.8000 1.0000 2.0000 0.0000 Constraint 681 698 0.8000 1.0000 2.0000 0.0000 Constraint 681 690 0.8000 1.0000 2.0000 0.0000 Constraint 673 1788 0.8000 1.0000 2.0000 0.0000 Constraint 673 1777 0.8000 1.0000 2.0000 0.0000 Constraint 673 1764 0.8000 1.0000 2.0000 0.0000 Constraint 673 1756 0.8000 1.0000 2.0000 0.0000 Constraint 673 1748 0.8000 1.0000 2.0000 0.0000 Constraint 673 1739 0.8000 1.0000 2.0000 0.0000 Constraint 673 1731 0.8000 1.0000 2.0000 0.0000 Constraint 673 1720 0.8000 1.0000 2.0000 0.0000 Constraint 673 1714 0.8000 1.0000 2.0000 0.0000 Constraint 673 1703 0.8000 1.0000 2.0000 0.0000 Constraint 673 1692 0.8000 1.0000 2.0000 0.0000 Constraint 673 1683 0.8000 1.0000 2.0000 0.0000 Constraint 673 1678 0.8000 1.0000 2.0000 0.0000 Constraint 673 1670 0.8000 1.0000 2.0000 0.0000 Constraint 673 1649 0.8000 1.0000 2.0000 0.0000 Constraint 673 1634 0.8000 1.0000 2.0000 0.0000 Constraint 673 1620 0.8000 1.0000 2.0000 0.0000 Constraint 673 1611 0.8000 1.0000 2.0000 0.0000 Constraint 673 1603 0.8000 1.0000 2.0000 0.0000 Constraint 673 1567 0.8000 1.0000 2.0000 0.0000 Constraint 673 1511 0.8000 1.0000 2.0000 0.0000 Constraint 673 1494 0.8000 1.0000 2.0000 0.0000 Constraint 673 1479 0.8000 1.0000 2.0000 0.0000 Constraint 673 1471 0.8000 1.0000 2.0000 0.0000 Constraint 673 1466 0.8000 1.0000 2.0000 0.0000 Constraint 673 1358 0.8000 1.0000 2.0000 0.0000 Constraint 673 1351 0.8000 1.0000 2.0000 0.0000 Constraint 673 1343 0.8000 1.0000 2.0000 0.0000 Constraint 673 1334 0.8000 1.0000 2.0000 0.0000 Constraint 673 1325 0.8000 1.0000 2.0000 0.0000 Constraint 673 1309 0.8000 1.0000 2.0000 0.0000 Constraint 673 1301 0.8000 1.0000 2.0000 0.0000 Constraint 673 1276 0.8000 1.0000 2.0000 0.0000 Constraint 673 1268 0.8000 1.0000 2.0000 0.0000 Constraint 673 1251 0.8000 1.0000 2.0000 0.0000 Constraint 673 1246 0.8000 1.0000 2.0000 0.0000 Constraint 673 1220 0.8000 1.0000 2.0000 0.0000 Constraint 673 1213 0.8000 1.0000 2.0000 0.0000 Constraint 673 1077 0.8000 1.0000 2.0000 0.0000 Constraint 673 1046 0.8000 1.0000 2.0000 0.0000 Constraint 673 899 0.8000 1.0000 2.0000 0.0000 Constraint 673 848 0.8000 1.0000 2.0000 0.0000 Constraint 673 792 0.8000 1.0000 2.0000 0.0000 Constraint 673 739 0.8000 1.0000 2.0000 0.0000 Constraint 673 731 0.8000 1.0000 2.0000 0.0000 Constraint 673 722 0.8000 1.0000 2.0000 0.0000 Constraint 673 713 0.8000 1.0000 2.0000 0.0000 Constraint 673 706 0.8000 1.0000 2.0000 0.0000 Constraint 673 698 0.8000 1.0000 2.0000 0.0000 Constraint 673 690 0.8000 1.0000 2.0000 0.0000 Constraint 673 681 0.8000 1.0000 2.0000 0.0000 Constraint 665 1788 0.8000 1.0000 2.0000 0.0000 Constraint 665 1772 0.8000 1.0000 2.0000 0.0000 Constraint 665 1739 0.8000 1.0000 2.0000 0.0000 Constraint 665 1720 0.8000 1.0000 2.0000 0.0000 Constraint 665 1714 0.8000 1.0000 2.0000 0.0000 Constraint 665 1703 0.8000 1.0000 2.0000 0.0000 Constraint 665 1692 0.8000 1.0000 2.0000 0.0000 Constraint 665 1683 0.8000 1.0000 2.0000 0.0000 Constraint 665 1649 0.8000 1.0000 2.0000 0.0000 Constraint 665 1620 0.8000 1.0000 2.0000 0.0000 Constraint 665 1611 0.8000 1.0000 2.0000 0.0000 Constraint 665 1603 0.8000 1.0000 2.0000 0.0000 Constraint 665 1587 0.8000 1.0000 2.0000 0.0000 Constraint 665 1575 0.8000 1.0000 2.0000 0.0000 Constraint 665 1494 0.8000 1.0000 2.0000 0.0000 Constraint 665 1488 0.8000 1.0000 2.0000 0.0000 Constraint 665 1466 0.8000 1.0000 2.0000 0.0000 Constraint 665 1455 0.8000 1.0000 2.0000 0.0000 Constraint 665 1427 0.8000 1.0000 2.0000 0.0000 Constraint 665 1399 0.8000 1.0000 2.0000 0.0000 Constraint 665 1366 0.8000 1.0000 2.0000 0.0000 Constraint 665 1358 0.8000 1.0000 2.0000 0.0000 Constraint 665 1343 0.8000 1.0000 2.0000 0.0000 Constraint 665 1325 0.8000 1.0000 2.0000 0.0000 Constraint 665 1309 0.8000 1.0000 2.0000 0.0000 Constraint 665 1284 0.8000 1.0000 2.0000 0.0000 Constraint 665 1276 0.8000 1.0000 2.0000 0.0000 Constraint 665 1251 0.8000 1.0000 2.0000 0.0000 Constraint 665 1213 0.8000 1.0000 2.0000 0.0000 Constraint 665 955 0.8000 1.0000 2.0000 0.0000 Constraint 665 739 0.8000 1.0000 2.0000 0.0000 Constraint 665 731 0.8000 1.0000 2.0000 0.0000 Constraint 665 722 0.8000 1.0000 2.0000 0.0000 Constraint 665 713 0.8000 1.0000 2.0000 0.0000 Constraint 665 706 0.8000 1.0000 2.0000 0.0000 Constraint 665 698 0.8000 1.0000 2.0000 0.0000 Constraint 665 690 0.8000 1.0000 2.0000 0.0000 Constraint 665 681 0.8000 1.0000 2.0000 0.0000 Constraint 665 673 0.8000 1.0000 2.0000 0.0000 Constraint 657 1788 0.8000 1.0000 2.0000 0.0000 Constraint 657 1764 0.8000 1.0000 2.0000 0.0000 Constraint 657 1739 0.8000 1.0000 2.0000 0.0000 Constraint 657 1670 0.8000 1.0000 2.0000 0.0000 Constraint 657 1620 0.8000 1.0000 2.0000 0.0000 Constraint 657 1611 0.8000 1.0000 2.0000 0.0000 Constraint 657 1596 0.8000 1.0000 2.0000 0.0000 Constraint 657 1587 0.8000 1.0000 2.0000 0.0000 Constraint 657 1575 0.8000 1.0000 2.0000 0.0000 Constraint 657 1567 0.8000 1.0000 2.0000 0.0000 Constraint 657 1541 0.8000 1.0000 2.0000 0.0000 Constraint 657 1519 0.8000 1.0000 2.0000 0.0000 Constraint 657 1511 0.8000 1.0000 2.0000 0.0000 Constraint 657 1488 0.8000 1.0000 2.0000 0.0000 Constraint 657 1455 0.8000 1.0000 2.0000 0.0000 Constraint 657 1427 0.8000 1.0000 2.0000 0.0000 Constraint 657 1416 0.8000 1.0000 2.0000 0.0000 Constraint 657 1391 0.8000 1.0000 2.0000 0.0000 Constraint 657 1366 0.8000 1.0000 2.0000 0.0000 Constraint 657 1325 0.8000 1.0000 2.0000 0.0000 Constraint 657 1293 0.8000 1.0000 2.0000 0.0000 Constraint 657 1284 0.8000 1.0000 2.0000 0.0000 Constraint 657 1276 0.8000 1.0000 2.0000 0.0000 Constraint 657 1251 0.8000 1.0000 2.0000 0.0000 Constraint 657 1220 0.8000 1.0000 2.0000 0.0000 Constraint 657 1213 0.8000 1.0000 2.0000 0.0000 Constraint 657 1178 0.8000 1.0000 2.0000 0.0000 Constraint 657 1158 0.8000 1.0000 2.0000 0.0000 Constraint 657 1149 0.8000 1.0000 2.0000 0.0000 Constraint 657 1117 0.8000 1.0000 2.0000 0.0000 Constraint 657 1030 0.8000 1.0000 2.0000 0.0000 Constraint 657 963 0.8000 1.0000 2.0000 0.0000 Constraint 657 930 0.8000 1.0000 2.0000 0.0000 Constraint 657 739 0.8000 1.0000 2.0000 0.0000 Constraint 657 731 0.8000 1.0000 2.0000 0.0000 Constraint 657 722 0.8000 1.0000 2.0000 0.0000 Constraint 657 713 0.8000 1.0000 2.0000 0.0000 Constraint 657 706 0.8000 1.0000 2.0000 0.0000 Constraint 657 698 0.8000 1.0000 2.0000 0.0000 Constraint 657 690 0.8000 1.0000 2.0000 0.0000 Constraint 657 681 0.8000 1.0000 2.0000 0.0000 Constraint 657 673 0.8000 1.0000 2.0000 0.0000 Constraint 657 665 0.8000 1.0000 2.0000 0.0000 Constraint 650 1788 0.8000 1.0000 2.0000 0.0000 Constraint 650 1772 0.8000 1.0000 2.0000 0.0000 Constraint 650 1764 0.8000 1.0000 2.0000 0.0000 Constraint 650 1748 0.8000 1.0000 2.0000 0.0000 Constraint 650 1739 0.8000 1.0000 2.0000 0.0000 Constraint 650 1731 0.8000 1.0000 2.0000 0.0000 Constraint 650 1720 0.8000 1.0000 2.0000 0.0000 Constraint 650 1714 0.8000 1.0000 2.0000 0.0000 Constraint 650 1703 0.8000 1.0000 2.0000 0.0000 Constraint 650 1678 0.8000 1.0000 2.0000 0.0000 Constraint 650 1670 0.8000 1.0000 2.0000 0.0000 Constraint 650 1662 0.8000 1.0000 2.0000 0.0000 Constraint 650 1657 0.8000 1.0000 2.0000 0.0000 Constraint 650 1649 0.8000 1.0000 2.0000 0.0000 Constraint 650 1634 0.8000 1.0000 2.0000 0.0000 Constraint 650 1620 0.8000 1.0000 2.0000 0.0000 Constraint 650 1611 0.8000 1.0000 2.0000 0.0000 Constraint 650 1596 0.8000 1.0000 2.0000 0.0000 Constraint 650 1587 0.8000 1.0000 2.0000 0.0000 Constraint 650 1575 0.8000 1.0000 2.0000 0.0000 Constraint 650 1541 0.8000 1.0000 2.0000 0.0000 Constraint 650 1494 0.8000 1.0000 2.0000 0.0000 Constraint 650 1488 0.8000 1.0000 2.0000 0.0000 Constraint 650 1479 0.8000 1.0000 2.0000 0.0000 Constraint 650 1447 0.8000 1.0000 2.0000 0.0000 Constraint 650 1438 0.8000 1.0000 2.0000 0.0000 Constraint 650 1351 0.8000 1.0000 2.0000 0.0000 Constraint 650 1343 0.8000 1.0000 2.0000 0.0000 Constraint 650 1325 0.8000 1.0000 2.0000 0.0000 Constraint 650 1317 0.8000 1.0000 2.0000 0.0000 Constraint 650 1309 0.8000 1.0000 2.0000 0.0000 Constraint 650 1301 0.8000 1.0000 2.0000 0.0000 Constraint 650 1293 0.8000 1.0000 2.0000 0.0000 Constraint 650 1276 0.8000 1.0000 2.0000 0.0000 Constraint 650 1220 0.8000 1.0000 2.0000 0.0000 Constraint 650 1213 0.8000 1.0000 2.0000 0.0000 Constraint 650 1204 0.8000 1.0000 2.0000 0.0000 Constraint 650 1193 0.8000 1.0000 2.0000 0.0000 Constraint 650 1178 0.8000 1.0000 2.0000 0.0000 Constraint 650 1167 0.8000 1.0000 2.0000 0.0000 Constraint 650 1158 0.8000 1.0000 2.0000 0.0000 Constraint 650 1125 0.8000 1.0000 2.0000 0.0000 Constraint 650 1030 0.8000 1.0000 2.0000 0.0000 Constraint 650 944 0.8000 1.0000 2.0000 0.0000 Constraint 650 937 0.8000 1.0000 2.0000 0.0000 Constraint 650 913 0.8000 1.0000 2.0000 0.0000 Constraint 650 899 0.8000 1.0000 2.0000 0.0000 Constraint 650 892 0.8000 1.0000 2.0000 0.0000 Constraint 650 829 0.8000 1.0000 2.0000 0.0000 Constraint 650 713 0.8000 1.0000 2.0000 0.0000 Constraint 650 706 0.8000 1.0000 2.0000 0.0000 Constraint 650 698 0.8000 1.0000 2.0000 0.0000 Constraint 650 690 0.8000 1.0000 2.0000 0.0000 Constraint 650 681 0.8000 1.0000 2.0000 0.0000 Constraint 650 673 0.8000 1.0000 2.0000 0.0000 Constraint 650 665 0.8000 1.0000 2.0000 0.0000 Constraint 650 657 0.8000 1.0000 2.0000 0.0000 Constraint 639 1772 0.8000 1.0000 2.0000 0.0000 Constraint 639 1739 0.8000 1.0000 2.0000 0.0000 Constraint 639 1703 0.8000 1.0000 2.0000 0.0000 Constraint 639 1683 0.8000 1.0000 2.0000 0.0000 Constraint 639 1678 0.8000 1.0000 2.0000 0.0000 Constraint 639 1670 0.8000 1.0000 2.0000 0.0000 Constraint 639 1662 0.8000 1.0000 2.0000 0.0000 Constraint 639 1649 0.8000 1.0000 2.0000 0.0000 Constraint 639 1634 0.8000 1.0000 2.0000 0.0000 Constraint 639 1620 0.8000 1.0000 2.0000 0.0000 Constraint 639 1611 0.8000 1.0000 2.0000 0.0000 Constraint 639 1603 0.8000 1.0000 2.0000 0.0000 Constraint 639 1596 0.8000 1.0000 2.0000 0.0000 Constraint 639 1587 0.8000 1.0000 2.0000 0.0000 Constraint 639 1575 0.8000 1.0000 2.0000 0.0000 Constraint 639 1567 0.8000 1.0000 2.0000 0.0000 Constraint 639 1556 0.8000 1.0000 2.0000 0.0000 Constraint 639 1548 0.8000 1.0000 2.0000 0.0000 Constraint 639 1533 0.8000 1.0000 2.0000 0.0000 Constraint 639 1511 0.8000 1.0000 2.0000 0.0000 Constraint 639 1503 0.8000 1.0000 2.0000 0.0000 Constraint 639 1494 0.8000 1.0000 2.0000 0.0000 Constraint 639 1488 0.8000 1.0000 2.0000 0.0000 Constraint 639 1466 0.8000 1.0000 2.0000 0.0000 Constraint 639 1455 0.8000 1.0000 2.0000 0.0000 Constraint 639 1427 0.8000 1.0000 2.0000 0.0000 Constraint 639 1382 0.8000 1.0000 2.0000 0.0000 Constraint 639 1358 0.8000 1.0000 2.0000 0.0000 Constraint 639 1351 0.8000 1.0000 2.0000 0.0000 Constraint 639 1343 0.8000 1.0000 2.0000 0.0000 Constraint 639 1334 0.8000 1.0000 2.0000 0.0000 Constraint 639 1325 0.8000 1.0000 2.0000 0.0000 Constraint 639 1301 0.8000 1.0000 2.0000 0.0000 Constraint 639 1284 0.8000 1.0000 2.0000 0.0000 Constraint 639 1276 0.8000 1.0000 2.0000 0.0000 Constraint 639 1220 0.8000 1.0000 2.0000 0.0000 Constraint 639 988 0.8000 1.0000 2.0000 0.0000 Constraint 639 829 0.8000 1.0000 2.0000 0.0000 Constraint 639 818 0.8000 1.0000 2.0000 0.0000 Constraint 639 792 0.8000 1.0000 2.0000 0.0000 Constraint 639 706 0.8000 1.0000 2.0000 0.0000 Constraint 639 698 0.8000 1.0000 2.0000 0.0000 Constraint 639 690 0.8000 1.0000 2.0000 0.0000 Constraint 639 681 0.8000 1.0000 2.0000 0.0000 Constraint 639 673 0.8000 1.0000 2.0000 0.0000 Constraint 639 665 0.8000 1.0000 2.0000 0.0000 Constraint 639 657 0.8000 1.0000 2.0000 0.0000 Constraint 639 650 0.8000 1.0000 2.0000 0.0000 Constraint 630 1788 0.8000 1.0000 2.0000 0.0000 Constraint 630 1772 0.8000 1.0000 2.0000 0.0000 Constraint 630 1764 0.8000 1.0000 2.0000 0.0000 Constraint 630 1748 0.8000 1.0000 2.0000 0.0000 Constraint 630 1739 0.8000 1.0000 2.0000 0.0000 Constraint 630 1731 0.8000 1.0000 2.0000 0.0000 Constraint 630 1670 0.8000 1.0000 2.0000 0.0000 Constraint 630 1634 0.8000 1.0000 2.0000 0.0000 Constraint 630 1620 0.8000 1.0000 2.0000 0.0000 Constraint 630 1611 0.8000 1.0000 2.0000 0.0000 Constraint 630 1587 0.8000 1.0000 2.0000 0.0000 Constraint 630 1575 0.8000 1.0000 2.0000 0.0000 Constraint 630 1556 0.8000 1.0000 2.0000 0.0000 Constraint 630 1548 0.8000 1.0000 2.0000 0.0000 Constraint 630 1533 0.8000 1.0000 2.0000 0.0000 Constraint 630 1526 0.8000 1.0000 2.0000 0.0000 Constraint 630 1503 0.8000 1.0000 2.0000 0.0000 Constraint 630 1488 0.8000 1.0000 2.0000 0.0000 Constraint 630 1479 0.8000 1.0000 2.0000 0.0000 Constraint 630 1466 0.8000 1.0000 2.0000 0.0000 Constraint 630 1455 0.8000 1.0000 2.0000 0.0000 Constraint 630 1438 0.8000 1.0000 2.0000 0.0000 Constraint 630 1427 0.8000 1.0000 2.0000 0.0000 Constraint 630 1408 0.8000 1.0000 2.0000 0.0000 Constraint 630 1366 0.8000 1.0000 2.0000 0.0000 Constraint 630 1358 0.8000 1.0000 2.0000 0.0000 Constraint 630 1351 0.8000 1.0000 2.0000 0.0000 Constraint 630 1343 0.8000 1.0000 2.0000 0.0000 Constraint 630 1301 0.8000 1.0000 2.0000 0.0000 Constraint 630 1284 0.8000 1.0000 2.0000 0.0000 Constraint 630 1246 0.8000 1.0000 2.0000 0.0000 Constraint 630 1220 0.8000 1.0000 2.0000 0.0000 Constraint 630 1213 0.8000 1.0000 2.0000 0.0000 Constraint 630 1008 0.8000 1.0000 2.0000 0.0000 Constraint 630 997 0.8000 1.0000 2.0000 0.0000 Constraint 630 988 0.8000 1.0000 2.0000 0.0000 Constraint 630 818 0.8000 1.0000 2.0000 0.0000 Constraint 630 792 0.8000 1.0000 2.0000 0.0000 Constraint 630 698 0.8000 1.0000 2.0000 0.0000 Constraint 630 690 0.8000 1.0000 2.0000 0.0000 Constraint 630 681 0.8000 1.0000 2.0000 0.0000 Constraint 630 673 0.8000 1.0000 2.0000 0.0000 Constraint 630 665 0.8000 1.0000 2.0000 0.0000 Constraint 630 657 0.8000 1.0000 2.0000 0.0000 Constraint 630 650 0.8000 1.0000 2.0000 0.0000 Constraint 630 639 0.8000 1.0000 2.0000 0.0000 Constraint 623 1788 0.8000 1.0000 2.0000 0.0000 Constraint 623 1777 0.8000 1.0000 2.0000 0.0000 Constraint 623 1772 0.8000 1.0000 2.0000 0.0000 Constraint 623 1764 0.8000 1.0000 2.0000 0.0000 Constraint 623 1748 0.8000 1.0000 2.0000 0.0000 Constraint 623 1739 0.8000 1.0000 2.0000 0.0000 Constraint 623 1731 0.8000 1.0000 2.0000 0.0000 Constraint 623 1714 0.8000 1.0000 2.0000 0.0000 Constraint 623 1703 0.8000 1.0000 2.0000 0.0000 Constraint 623 1620 0.8000 1.0000 2.0000 0.0000 Constraint 623 1611 0.8000 1.0000 2.0000 0.0000 Constraint 623 1603 0.8000 1.0000 2.0000 0.0000 Constraint 623 1587 0.8000 1.0000 2.0000 0.0000 Constraint 623 1533 0.8000 1.0000 2.0000 0.0000 Constraint 623 1511 0.8000 1.0000 2.0000 0.0000 Constraint 623 1494 0.8000 1.0000 2.0000 0.0000 Constraint 623 1374 0.8000 1.0000 2.0000 0.0000 Constraint 623 1366 0.8000 1.0000 2.0000 0.0000 Constraint 623 1358 0.8000 1.0000 2.0000 0.0000 Constraint 623 1351 0.8000 1.0000 2.0000 0.0000 Constraint 623 1343 0.8000 1.0000 2.0000 0.0000 Constraint 623 1325 0.8000 1.0000 2.0000 0.0000 Constraint 623 1309 0.8000 1.0000 2.0000 0.0000 Constraint 623 1301 0.8000 1.0000 2.0000 0.0000 Constraint 623 1276 0.8000 1.0000 2.0000 0.0000 Constraint 623 1268 0.8000 1.0000 2.0000 0.0000 Constraint 623 1246 0.8000 1.0000 2.0000 0.0000 Constraint 623 1228 0.8000 1.0000 2.0000 0.0000 Constraint 623 1220 0.8000 1.0000 2.0000 0.0000 Constraint 623 1193 0.8000 1.0000 2.0000 0.0000 Constraint 623 1178 0.8000 1.0000 2.0000 0.0000 Constraint 623 1167 0.8000 1.0000 2.0000 0.0000 Constraint 623 1158 0.8000 1.0000 2.0000 0.0000 Constraint 623 1149 0.8000 1.0000 2.0000 0.0000 Constraint 623 1092 0.8000 1.0000 2.0000 0.0000 Constraint 623 1008 0.8000 1.0000 2.0000 0.0000 Constraint 623 997 0.8000 1.0000 2.0000 0.0000 Constraint 623 988 0.8000 1.0000 2.0000 0.0000 Constraint 623 963 0.8000 1.0000 2.0000 0.0000 Constraint 623 690 0.8000 1.0000 2.0000 0.0000 Constraint 623 681 0.8000 1.0000 2.0000 0.0000 Constraint 623 673 0.8000 1.0000 2.0000 0.0000 Constraint 623 665 0.8000 1.0000 2.0000 0.0000 Constraint 623 657 0.8000 1.0000 2.0000 0.0000 Constraint 623 650 0.8000 1.0000 2.0000 0.0000 Constraint 623 639 0.8000 1.0000 2.0000 0.0000 Constraint 623 630 0.8000 1.0000 2.0000 0.0000 Constraint 616 1777 0.8000 1.0000 2.0000 0.0000 Constraint 616 1772 0.8000 1.0000 2.0000 0.0000 Constraint 616 1764 0.8000 1.0000 2.0000 0.0000 Constraint 616 1756 0.8000 1.0000 2.0000 0.0000 Constraint 616 1748 0.8000 1.0000 2.0000 0.0000 Constraint 616 1739 0.8000 1.0000 2.0000 0.0000 Constraint 616 1731 0.8000 1.0000 2.0000 0.0000 Constraint 616 1714 0.8000 1.0000 2.0000 0.0000 Constraint 616 1703 0.8000 1.0000 2.0000 0.0000 Constraint 616 1620 0.8000 1.0000 2.0000 0.0000 Constraint 616 1611 0.8000 1.0000 2.0000 0.0000 Constraint 616 1603 0.8000 1.0000 2.0000 0.0000 Constraint 616 1596 0.8000 1.0000 2.0000 0.0000 Constraint 616 1587 0.8000 1.0000 2.0000 0.0000 Constraint 616 1567 0.8000 1.0000 2.0000 0.0000 Constraint 616 1548 0.8000 1.0000 2.0000 0.0000 Constraint 616 1503 0.8000 1.0000 2.0000 0.0000 Constraint 616 1455 0.8000 1.0000 2.0000 0.0000 Constraint 616 1427 0.8000 1.0000 2.0000 0.0000 Constraint 616 1416 0.8000 1.0000 2.0000 0.0000 Constraint 616 1382 0.8000 1.0000 2.0000 0.0000 Constraint 616 1358 0.8000 1.0000 2.0000 0.0000 Constraint 616 1351 0.8000 1.0000 2.0000 0.0000 Constraint 616 1284 0.8000 1.0000 2.0000 0.0000 Constraint 616 1276 0.8000 1.0000 2.0000 0.0000 Constraint 616 1251 0.8000 1.0000 2.0000 0.0000 Constraint 616 1246 0.8000 1.0000 2.0000 0.0000 Constraint 616 1239 0.8000 1.0000 2.0000 0.0000 Constraint 616 1228 0.8000 1.0000 2.0000 0.0000 Constraint 616 1220 0.8000 1.0000 2.0000 0.0000 Constraint 616 1213 0.8000 1.0000 2.0000 0.0000 Constraint 616 1204 0.8000 1.0000 2.0000 0.0000 Constraint 616 1193 0.8000 1.0000 2.0000 0.0000 Constraint 616 1167 0.8000 1.0000 2.0000 0.0000 Constraint 616 1158 0.8000 1.0000 2.0000 0.0000 Constraint 616 1149 0.8000 1.0000 2.0000 0.0000 Constraint 616 1008 0.8000 1.0000 2.0000 0.0000 Constraint 616 980 0.8000 1.0000 2.0000 0.0000 Constraint 616 968 0.8000 1.0000 2.0000 0.0000 Constraint 616 963 0.8000 1.0000 2.0000 0.0000 Constraint 616 944 0.8000 1.0000 2.0000 0.0000 Constraint 616 681 0.8000 1.0000 2.0000 0.0000 Constraint 616 673 0.8000 1.0000 2.0000 0.0000 Constraint 616 665 0.8000 1.0000 2.0000 0.0000 Constraint 616 657 0.8000 1.0000 2.0000 0.0000 Constraint 616 650 0.8000 1.0000 2.0000 0.0000 Constraint 616 639 0.8000 1.0000 2.0000 0.0000 Constraint 616 630 0.8000 1.0000 2.0000 0.0000 Constraint 616 623 0.8000 1.0000 2.0000 0.0000 Constraint 608 1788 0.8000 1.0000 2.0000 0.0000 Constraint 608 1777 0.8000 1.0000 2.0000 0.0000 Constraint 608 1772 0.8000 1.0000 2.0000 0.0000 Constraint 608 1756 0.8000 1.0000 2.0000 0.0000 Constraint 608 1739 0.8000 1.0000 2.0000 0.0000 Constraint 608 1731 0.8000 1.0000 2.0000 0.0000 Constraint 608 1683 0.8000 1.0000 2.0000 0.0000 Constraint 608 1678 0.8000 1.0000 2.0000 0.0000 Constraint 608 1657 0.8000 1.0000 2.0000 0.0000 Constraint 608 1649 0.8000 1.0000 2.0000 0.0000 Constraint 608 1620 0.8000 1.0000 2.0000 0.0000 Constraint 608 1611 0.8000 1.0000 2.0000 0.0000 Constraint 608 1596 0.8000 1.0000 2.0000 0.0000 Constraint 608 1587 0.8000 1.0000 2.0000 0.0000 Constraint 608 1575 0.8000 1.0000 2.0000 0.0000 Constraint 608 1567 0.8000 1.0000 2.0000 0.0000 Constraint 608 1556 0.8000 1.0000 2.0000 0.0000 Constraint 608 1548 0.8000 1.0000 2.0000 0.0000 Constraint 608 1438 0.8000 1.0000 2.0000 0.0000 Constraint 608 1427 0.8000 1.0000 2.0000 0.0000 Constraint 608 1408 0.8000 1.0000 2.0000 0.0000 Constraint 608 1399 0.8000 1.0000 2.0000 0.0000 Constraint 608 1391 0.8000 1.0000 2.0000 0.0000 Constraint 608 1374 0.8000 1.0000 2.0000 0.0000 Constraint 608 1366 0.8000 1.0000 2.0000 0.0000 Constraint 608 1334 0.8000 1.0000 2.0000 0.0000 Constraint 608 1284 0.8000 1.0000 2.0000 0.0000 Constraint 608 1276 0.8000 1.0000 2.0000 0.0000 Constraint 608 1251 0.8000 1.0000 2.0000 0.0000 Constraint 608 1246 0.8000 1.0000 2.0000 0.0000 Constraint 608 1220 0.8000 1.0000 2.0000 0.0000 Constraint 608 1204 0.8000 1.0000 2.0000 0.0000 Constraint 608 1158 0.8000 1.0000 2.0000 0.0000 Constraint 608 859 0.8000 1.0000 2.0000 0.0000 Constraint 608 829 0.8000 1.0000 2.0000 0.0000 Constraint 608 808 0.8000 1.0000 2.0000 0.0000 Constraint 608 722 0.8000 1.0000 2.0000 0.0000 Constraint 608 673 0.8000 1.0000 2.0000 0.0000 Constraint 608 665 0.8000 1.0000 2.0000 0.0000 Constraint 608 657 0.8000 1.0000 2.0000 0.0000 Constraint 608 650 0.8000 1.0000 2.0000 0.0000 Constraint 608 639 0.8000 1.0000 2.0000 0.0000 Constraint 608 630 0.8000 1.0000 2.0000 0.0000 Constraint 608 623 0.8000 1.0000 2.0000 0.0000 Constraint 608 616 0.8000 1.0000 2.0000 0.0000 Constraint 597 1788 0.8000 1.0000 2.0000 0.0000 Constraint 597 1777 0.8000 1.0000 2.0000 0.0000 Constraint 597 1772 0.8000 1.0000 2.0000 0.0000 Constraint 597 1764 0.8000 1.0000 2.0000 0.0000 Constraint 597 1756 0.8000 1.0000 2.0000 0.0000 Constraint 597 1739 0.8000 1.0000 2.0000 0.0000 Constraint 597 1731 0.8000 1.0000 2.0000 0.0000 Constraint 597 1714 0.8000 1.0000 2.0000 0.0000 Constraint 597 1703 0.8000 1.0000 2.0000 0.0000 Constraint 597 1683 0.8000 1.0000 2.0000 0.0000 Constraint 597 1657 0.8000 1.0000 2.0000 0.0000 Constraint 597 1649 0.8000 1.0000 2.0000 0.0000 Constraint 597 1620 0.8000 1.0000 2.0000 0.0000 Constraint 597 1611 0.8000 1.0000 2.0000 0.0000 Constraint 597 1587 0.8000 1.0000 2.0000 0.0000 Constraint 597 1575 0.8000 1.0000 2.0000 0.0000 Constraint 597 1567 0.8000 1.0000 2.0000 0.0000 Constraint 597 1556 0.8000 1.0000 2.0000 0.0000 Constraint 597 1541 0.8000 1.0000 2.0000 0.0000 Constraint 597 1533 0.8000 1.0000 2.0000 0.0000 Constraint 597 1503 0.8000 1.0000 2.0000 0.0000 Constraint 597 1399 0.8000 1.0000 2.0000 0.0000 Constraint 597 1391 0.8000 1.0000 2.0000 0.0000 Constraint 597 1374 0.8000 1.0000 2.0000 0.0000 Constraint 597 1334 0.8000 1.0000 2.0000 0.0000 Constraint 597 1276 0.8000 1.0000 2.0000 0.0000 Constraint 597 1251 0.8000 1.0000 2.0000 0.0000 Constraint 597 1246 0.8000 1.0000 2.0000 0.0000 Constraint 597 1228 0.8000 1.0000 2.0000 0.0000 Constraint 597 1193 0.8000 1.0000 2.0000 0.0000 Constraint 597 1178 0.8000 1.0000 2.0000 0.0000 Constraint 597 1158 0.8000 1.0000 2.0000 0.0000 Constraint 597 1149 0.8000 1.0000 2.0000 0.0000 Constraint 597 1117 0.8000 1.0000 2.0000 0.0000 Constraint 597 1109 0.8000 1.0000 2.0000 0.0000 Constraint 597 1022 0.8000 1.0000 2.0000 0.0000 Constraint 597 1014 0.8000 1.0000 2.0000 0.0000 Constraint 597 980 0.8000 1.0000 2.0000 0.0000 Constraint 597 955 0.8000 1.0000 2.0000 0.0000 Constraint 597 930 0.8000 1.0000 2.0000 0.0000 Constraint 597 921 0.8000 1.0000 2.0000 0.0000 Constraint 597 783 0.8000 1.0000 2.0000 0.0000 Constraint 597 731 0.8000 1.0000 2.0000 0.0000 Constraint 597 665 0.8000 1.0000 2.0000 0.0000 Constraint 597 657 0.8000 1.0000 2.0000 0.0000 Constraint 597 650 0.8000 1.0000 2.0000 0.0000 Constraint 597 639 0.8000 1.0000 2.0000 0.0000 Constraint 597 630 0.8000 1.0000 2.0000 0.0000 Constraint 597 623 0.8000 1.0000 2.0000 0.0000 Constraint 597 616 0.8000 1.0000 2.0000 0.0000 Constraint 597 608 0.8000 1.0000 2.0000 0.0000 Constraint 589 1788 0.8000 1.0000 2.0000 0.0000 Constraint 589 1772 0.8000 1.0000 2.0000 0.0000 Constraint 589 1764 0.8000 1.0000 2.0000 0.0000 Constraint 589 1756 0.8000 1.0000 2.0000 0.0000 Constraint 589 1739 0.8000 1.0000 2.0000 0.0000 Constraint 589 1731 0.8000 1.0000 2.0000 0.0000 Constraint 589 1657 0.8000 1.0000 2.0000 0.0000 Constraint 589 1649 0.8000 1.0000 2.0000 0.0000 Constraint 589 1620 0.8000 1.0000 2.0000 0.0000 Constraint 589 1611 0.8000 1.0000 2.0000 0.0000 Constraint 589 1603 0.8000 1.0000 2.0000 0.0000 Constraint 589 1587 0.8000 1.0000 2.0000 0.0000 Constraint 589 1567 0.8000 1.0000 2.0000 0.0000 Constraint 589 1556 0.8000 1.0000 2.0000 0.0000 Constraint 589 1548 0.8000 1.0000 2.0000 0.0000 Constraint 589 1541 0.8000 1.0000 2.0000 0.0000 Constraint 589 1494 0.8000 1.0000 2.0000 0.0000 Constraint 589 1466 0.8000 1.0000 2.0000 0.0000 Constraint 589 1427 0.8000 1.0000 2.0000 0.0000 Constraint 589 1399 0.8000 1.0000 2.0000 0.0000 Constraint 589 1391 0.8000 1.0000 2.0000 0.0000 Constraint 589 1358 0.8000 1.0000 2.0000 0.0000 Constraint 589 1351 0.8000 1.0000 2.0000 0.0000 Constraint 589 1334 0.8000 1.0000 2.0000 0.0000 Constraint 589 1309 0.8000 1.0000 2.0000 0.0000 Constraint 589 1301 0.8000 1.0000 2.0000 0.0000 Constraint 589 1284 0.8000 1.0000 2.0000 0.0000 Constraint 589 1276 0.8000 1.0000 2.0000 0.0000 Constraint 589 1268 0.8000 1.0000 2.0000 0.0000 Constraint 589 1251 0.8000 1.0000 2.0000 0.0000 Constraint 589 1246 0.8000 1.0000 2.0000 0.0000 Constraint 589 1228 0.8000 1.0000 2.0000 0.0000 Constraint 589 1141 0.8000 1.0000 2.0000 0.0000 Constraint 589 1068 0.8000 1.0000 2.0000 0.0000 Constraint 589 657 0.8000 1.0000 2.0000 0.0000 Constraint 589 650 0.8000 1.0000 2.0000 0.0000 Constraint 589 639 0.8000 1.0000 2.0000 0.0000 Constraint 589 630 0.8000 1.0000 2.0000 0.0000 Constraint 589 623 0.8000 1.0000 2.0000 0.0000 Constraint 589 616 0.8000 1.0000 2.0000 0.0000 Constraint 589 608 0.8000 1.0000 2.0000 0.0000 Constraint 589 597 0.8000 1.0000 2.0000 0.0000 Constraint 579 1788 0.8000 1.0000 2.0000 0.0000 Constraint 579 1772 0.8000 1.0000 2.0000 0.0000 Constraint 579 1764 0.8000 1.0000 2.0000 0.0000 Constraint 579 1756 0.8000 1.0000 2.0000 0.0000 Constraint 579 1739 0.8000 1.0000 2.0000 0.0000 Constraint 579 1731 0.8000 1.0000 2.0000 0.0000 Constraint 579 1720 0.8000 1.0000 2.0000 0.0000 Constraint 579 1714 0.8000 1.0000 2.0000 0.0000 Constraint 579 1692 0.8000 1.0000 2.0000 0.0000 Constraint 579 1620 0.8000 1.0000 2.0000 0.0000 Constraint 579 1611 0.8000 1.0000 2.0000 0.0000 Constraint 579 1596 0.8000 1.0000 2.0000 0.0000 Constraint 579 1556 0.8000 1.0000 2.0000 0.0000 Constraint 579 1503 0.8000 1.0000 2.0000 0.0000 Constraint 579 1494 0.8000 1.0000 2.0000 0.0000 Constraint 579 1488 0.8000 1.0000 2.0000 0.0000 Constraint 579 1471 0.8000 1.0000 2.0000 0.0000 Constraint 579 1466 0.8000 1.0000 2.0000 0.0000 Constraint 579 1438 0.8000 1.0000 2.0000 0.0000 Constraint 579 1427 0.8000 1.0000 2.0000 0.0000 Constraint 579 1408 0.8000 1.0000 2.0000 0.0000 Constraint 579 1334 0.8000 1.0000 2.0000 0.0000 Constraint 579 1268 0.8000 1.0000 2.0000 0.0000 Constraint 579 1251 0.8000 1.0000 2.0000 0.0000 Constraint 579 1246 0.8000 1.0000 2.0000 0.0000 Constraint 579 1239 0.8000 1.0000 2.0000 0.0000 Constraint 579 1228 0.8000 1.0000 2.0000 0.0000 Constraint 579 1220 0.8000 1.0000 2.0000 0.0000 Constraint 579 1213 0.8000 1.0000 2.0000 0.0000 Constraint 579 1204 0.8000 1.0000 2.0000 0.0000 Constraint 579 1193 0.8000 1.0000 2.0000 0.0000 Constraint 579 1092 0.8000 1.0000 2.0000 0.0000 Constraint 579 1084 0.8000 1.0000 2.0000 0.0000 Constraint 579 1059 0.8000 1.0000 2.0000 0.0000 Constraint 579 1046 0.8000 1.0000 2.0000 0.0000 Constraint 579 1035 0.8000 1.0000 2.0000 0.0000 Constraint 579 1014 0.8000 1.0000 2.0000 0.0000 Constraint 579 1008 0.8000 1.0000 2.0000 0.0000 Constraint 579 988 0.8000 1.0000 2.0000 0.0000 Constraint 579 980 0.8000 1.0000 2.0000 0.0000 Constraint 579 955 0.8000 1.0000 2.0000 0.0000 Constraint 579 921 0.8000 1.0000 2.0000 0.0000 Constraint 579 908 0.8000 1.0000 2.0000 0.0000 Constraint 579 899 0.8000 1.0000 2.0000 0.0000 Constraint 579 829 0.8000 1.0000 2.0000 0.0000 Constraint 579 739 0.8000 1.0000 2.0000 0.0000 Constraint 579 639 0.8000 1.0000 2.0000 0.0000 Constraint 579 630 0.8000 1.0000 2.0000 0.0000 Constraint 579 623 0.8000 1.0000 2.0000 0.0000 Constraint 579 616 0.8000 1.0000 2.0000 0.0000 Constraint 579 608 0.8000 1.0000 2.0000 0.0000 Constraint 579 597 0.8000 1.0000 2.0000 0.0000 Constraint 579 589 0.8000 1.0000 2.0000 0.0000 Constraint 572 1772 0.8000 1.0000 2.0000 0.0000 Constraint 572 1764 0.8000 1.0000 2.0000 0.0000 Constraint 572 1731 0.8000 1.0000 2.0000 0.0000 Constraint 572 1714 0.8000 1.0000 2.0000 0.0000 Constraint 572 1703 0.8000 1.0000 2.0000 0.0000 Constraint 572 1692 0.8000 1.0000 2.0000 0.0000 Constraint 572 1683 0.8000 1.0000 2.0000 0.0000 Constraint 572 1678 0.8000 1.0000 2.0000 0.0000 Constraint 572 1670 0.8000 1.0000 2.0000 0.0000 Constraint 572 1662 0.8000 1.0000 2.0000 0.0000 Constraint 572 1649 0.8000 1.0000 2.0000 0.0000 Constraint 572 1611 0.8000 1.0000 2.0000 0.0000 Constraint 572 1603 0.8000 1.0000 2.0000 0.0000 Constraint 572 1596 0.8000 1.0000 2.0000 0.0000 Constraint 572 1587 0.8000 1.0000 2.0000 0.0000 Constraint 572 1575 0.8000 1.0000 2.0000 0.0000 Constraint 572 1526 0.8000 1.0000 2.0000 0.0000 Constraint 572 1511 0.8000 1.0000 2.0000 0.0000 Constraint 572 1503 0.8000 1.0000 2.0000 0.0000 Constraint 572 1471 0.8000 1.0000 2.0000 0.0000 Constraint 572 1466 0.8000 1.0000 2.0000 0.0000 Constraint 572 1455 0.8000 1.0000 2.0000 0.0000 Constraint 572 1438 0.8000 1.0000 2.0000 0.0000 Constraint 572 1427 0.8000 1.0000 2.0000 0.0000 Constraint 572 1399 0.8000 1.0000 2.0000 0.0000 Constraint 572 1358 0.8000 1.0000 2.0000 0.0000 Constraint 572 1334 0.8000 1.0000 2.0000 0.0000 Constraint 572 1309 0.8000 1.0000 2.0000 0.0000 Constraint 572 1301 0.8000 1.0000 2.0000 0.0000 Constraint 572 1293 0.8000 1.0000 2.0000 0.0000 Constraint 572 1276 0.8000 1.0000 2.0000 0.0000 Constraint 572 1260 0.8000 1.0000 2.0000 0.0000 Constraint 572 1239 0.8000 1.0000 2.0000 0.0000 Constraint 572 1213 0.8000 1.0000 2.0000 0.0000 Constraint 572 1193 0.8000 1.0000 2.0000 0.0000 Constraint 572 1059 0.8000 1.0000 2.0000 0.0000 Constraint 572 988 0.8000 1.0000 2.0000 0.0000 Constraint 572 630 0.8000 1.0000 2.0000 0.0000 Constraint 572 623 0.8000 1.0000 2.0000 0.0000 Constraint 572 616 0.8000 1.0000 2.0000 0.0000 Constraint 572 608 0.8000 1.0000 2.0000 0.0000 Constraint 572 597 0.8000 1.0000 2.0000 0.0000 Constraint 572 589 0.8000 1.0000 2.0000 0.0000 Constraint 572 579 0.8000 1.0000 2.0000 0.0000 Constraint 564 1788 0.8000 1.0000 2.0000 0.0000 Constraint 564 1772 0.8000 1.0000 2.0000 0.0000 Constraint 564 1764 0.8000 1.0000 2.0000 0.0000 Constraint 564 1756 0.8000 1.0000 2.0000 0.0000 Constraint 564 1739 0.8000 1.0000 2.0000 0.0000 Constraint 564 1731 0.8000 1.0000 2.0000 0.0000 Constraint 564 1720 0.8000 1.0000 2.0000 0.0000 Constraint 564 1714 0.8000 1.0000 2.0000 0.0000 Constraint 564 1703 0.8000 1.0000 2.0000 0.0000 Constraint 564 1692 0.8000 1.0000 2.0000 0.0000 Constraint 564 1662 0.8000 1.0000 2.0000 0.0000 Constraint 564 1657 0.8000 1.0000 2.0000 0.0000 Constraint 564 1649 0.8000 1.0000 2.0000 0.0000 Constraint 564 1611 0.8000 1.0000 2.0000 0.0000 Constraint 564 1603 0.8000 1.0000 2.0000 0.0000 Constraint 564 1587 0.8000 1.0000 2.0000 0.0000 Constraint 564 1575 0.8000 1.0000 2.0000 0.0000 Constraint 564 1548 0.8000 1.0000 2.0000 0.0000 Constraint 564 1541 0.8000 1.0000 2.0000 0.0000 Constraint 564 1533 0.8000 1.0000 2.0000 0.0000 Constraint 564 1526 0.8000 1.0000 2.0000 0.0000 Constraint 564 1519 0.8000 1.0000 2.0000 0.0000 Constraint 564 1511 0.8000 1.0000 2.0000 0.0000 Constraint 564 1503 0.8000 1.0000 2.0000 0.0000 Constraint 564 1494 0.8000 1.0000 2.0000 0.0000 Constraint 564 1488 0.8000 1.0000 2.0000 0.0000 Constraint 564 1466 0.8000 1.0000 2.0000 0.0000 Constraint 564 1438 0.8000 1.0000 2.0000 0.0000 Constraint 564 1427 0.8000 1.0000 2.0000 0.0000 Constraint 564 1391 0.8000 1.0000 2.0000 0.0000 Constraint 564 1358 0.8000 1.0000 2.0000 0.0000 Constraint 564 1343 0.8000 1.0000 2.0000 0.0000 Constraint 564 1334 0.8000 1.0000 2.0000 0.0000 Constraint 564 1325 0.8000 1.0000 2.0000 0.0000 Constraint 564 1309 0.8000 1.0000 2.0000 0.0000 Constraint 564 1301 0.8000 1.0000 2.0000 0.0000 Constraint 564 1276 0.8000 1.0000 2.0000 0.0000 Constraint 564 1251 0.8000 1.0000 2.0000 0.0000 Constraint 564 1246 0.8000 1.0000 2.0000 0.0000 Constraint 564 1213 0.8000 1.0000 2.0000 0.0000 Constraint 564 1204 0.8000 1.0000 2.0000 0.0000 Constraint 564 1193 0.8000 1.0000 2.0000 0.0000 Constraint 564 1117 0.8000 1.0000 2.0000 0.0000 Constraint 564 1068 0.8000 1.0000 2.0000 0.0000 Constraint 564 706 0.8000 1.0000 2.0000 0.0000 Constraint 564 623 0.8000 1.0000 2.0000 0.0000 Constraint 564 616 0.8000 1.0000 2.0000 0.0000 Constraint 564 608 0.8000 1.0000 2.0000 0.0000 Constraint 564 597 0.8000 1.0000 2.0000 0.0000 Constraint 564 589 0.8000 1.0000 2.0000 0.0000 Constraint 564 579 0.8000 1.0000 2.0000 0.0000 Constraint 564 572 0.8000 1.0000 2.0000 0.0000 Constraint 557 1788 0.8000 1.0000 2.0000 0.0000 Constraint 557 1777 0.8000 1.0000 2.0000 0.0000 Constraint 557 1764 0.8000 1.0000 2.0000 0.0000 Constraint 557 1739 0.8000 1.0000 2.0000 0.0000 Constraint 557 1720 0.8000 1.0000 2.0000 0.0000 Constraint 557 1714 0.8000 1.0000 2.0000 0.0000 Constraint 557 1662 0.8000 1.0000 2.0000 0.0000 Constraint 557 1611 0.8000 1.0000 2.0000 0.0000 Constraint 557 1603 0.8000 1.0000 2.0000 0.0000 Constraint 557 1596 0.8000 1.0000 2.0000 0.0000 Constraint 557 1587 0.8000 1.0000 2.0000 0.0000 Constraint 557 1575 0.8000 1.0000 2.0000 0.0000 Constraint 557 1567 0.8000 1.0000 2.0000 0.0000 Constraint 557 1548 0.8000 1.0000 2.0000 0.0000 Constraint 557 1541 0.8000 1.0000 2.0000 0.0000 Constraint 557 1533 0.8000 1.0000 2.0000 0.0000 Constraint 557 1519 0.8000 1.0000 2.0000 0.0000 Constraint 557 1511 0.8000 1.0000 2.0000 0.0000 Constraint 557 1503 0.8000 1.0000 2.0000 0.0000 Constraint 557 1488 0.8000 1.0000 2.0000 0.0000 Constraint 557 1479 0.8000 1.0000 2.0000 0.0000 Constraint 557 1466 0.8000 1.0000 2.0000 0.0000 Constraint 557 1455 0.8000 1.0000 2.0000 0.0000 Constraint 557 1438 0.8000 1.0000 2.0000 0.0000 Constraint 557 1382 0.8000 1.0000 2.0000 0.0000 Constraint 557 1374 0.8000 1.0000 2.0000 0.0000 Constraint 557 1351 0.8000 1.0000 2.0000 0.0000 Constraint 557 1334 0.8000 1.0000 2.0000 0.0000 Constraint 557 1317 0.8000 1.0000 2.0000 0.0000 Constraint 557 1309 0.8000 1.0000 2.0000 0.0000 Constraint 557 1301 0.8000 1.0000 2.0000 0.0000 Constraint 557 1293 0.8000 1.0000 2.0000 0.0000 Constraint 557 1284 0.8000 1.0000 2.0000 0.0000 Constraint 557 1276 0.8000 1.0000 2.0000 0.0000 Constraint 557 1268 0.8000 1.0000 2.0000 0.0000 Constraint 557 1133 0.8000 1.0000 2.0000 0.0000 Constraint 557 1117 0.8000 1.0000 2.0000 0.0000 Constraint 557 1109 0.8000 1.0000 2.0000 0.0000 Constraint 557 1100 0.8000 1.0000 2.0000 0.0000 Constraint 557 1092 0.8000 1.0000 2.0000 0.0000 Constraint 557 1059 0.8000 1.0000 2.0000 0.0000 Constraint 557 731 0.8000 1.0000 2.0000 0.0000 Constraint 557 722 0.8000 1.0000 2.0000 0.0000 Constraint 557 616 0.8000 1.0000 2.0000 0.0000 Constraint 557 608 0.8000 1.0000 2.0000 0.0000 Constraint 557 597 0.8000 1.0000 2.0000 0.0000 Constraint 557 589 0.8000 1.0000 2.0000 0.0000 Constraint 557 579 0.8000 1.0000 2.0000 0.0000 Constraint 557 572 0.8000 1.0000 2.0000 0.0000 Constraint 557 564 0.8000 1.0000 2.0000 0.0000 Constraint 549 1772 0.8000 1.0000 2.0000 0.0000 Constraint 549 1739 0.8000 1.0000 2.0000 0.0000 Constraint 549 1731 0.8000 1.0000 2.0000 0.0000 Constraint 549 1720 0.8000 1.0000 2.0000 0.0000 Constraint 549 1714 0.8000 1.0000 2.0000 0.0000 Constraint 549 1683 0.8000 1.0000 2.0000 0.0000 Constraint 549 1662 0.8000 1.0000 2.0000 0.0000 Constraint 549 1620 0.8000 1.0000 2.0000 0.0000 Constraint 549 1611 0.8000 1.0000 2.0000 0.0000 Constraint 549 1603 0.8000 1.0000 2.0000 0.0000 Constraint 549 1596 0.8000 1.0000 2.0000 0.0000 Constraint 549 1587 0.8000 1.0000 2.0000 0.0000 Constraint 549 1575 0.8000 1.0000 2.0000 0.0000 Constraint 549 1567 0.8000 1.0000 2.0000 0.0000 Constraint 549 1556 0.8000 1.0000 2.0000 0.0000 Constraint 549 1548 0.8000 1.0000 2.0000 0.0000 Constraint 549 1541 0.8000 1.0000 2.0000 0.0000 Constraint 549 1533 0.8000 1.0000 2.0000 0.0000 Constraint 549 1511 0.8000 1.0000 2.0000 0.0000 Constraint 549 1503 0.8000 1.0000 2.0000 0.0000 Constraint 549 1494 0.8000 1.0000 2.0000 0.0000 Constraint 549 1471 0.8000 1.0000 2.0000 0.0000 Constraint 549 1466 0.8000 1.0000 2.0000 0.0000 Constraint 549 1447 0.8000 1.0000 2.0000 0.0000 Constraint 549 1438 0.8000 1.0000 2.0000 0.0000 Constraint 549 1408 0.8000 1.0000 2.0000 0.0000 Constraint 549 1399 0.8000 1.0000 2.0000 0.0000 Constraint 549 1374 0.8000 1.0000 2.0000 0.0000 Constraint 549 1334 0.8000 1.0000 2.0000 0.0000 Constraint 549 1309 0.8000 1.0000 2.0000 0.0000 Constraint 549 1301 0.8000 1.0000 2.0000 0.0000 Constraint 549 1293 0.8000 1.0000 2.0000 0.0000 Constraint 549 1284 0.8000 1.0000 2.0000 0.0000 Constraint 549 1276 0.8000 1.0000 2.0000 0.0000 Constraint 549 1260 0.8000 1.0000 2.0000 0.0000 Constraint 549 1251 0.8000 1.0000 2.0000 0.0000 Constraint 549 1246 0.8000 1.0000 2.0000 0.0000 Constraint 549 1239 0.8000 1.0000 2.0000 0.0000 Constraint 549 1213 0.8000 1.0000 2.0000 0.0000 Constraint 549 1204 0.8000 1.0000 2.0000 0.0000 Constraint 549 1178 0.8000 1.0000 2.0000 0.0000 Constraint 549 1100 0.8000 1.0000 2.0000 0.0000 Constraint 549 1092 0.8000 1.0000 2.0000 0.0000 Constraint 549 1084 0.8000 1.0000 2.0000 0.0000 Constraint 549 1046 0.8000 1.0000 2.0000 0.0000 Constraint 549 1035 0.8000 1.0000 2.0000 0.0000 Constraint 549 1014 0.8000 1.0000 2.0000 0.0000 Constraint 549 930 0.8000 1.0000 2.0000 0.0000 Constraint 549 818 0.8000 1.0000 2.0000 0.0000 Constraint 549 731 0.8000 1.0000 2.0000 0.0000 Constraint 549 608 0.8000 1.0000 2.0000 0.0000 Constraint 549 597 0.8000 1.0000 2.0000 0.0000 Constraint 549 589 0.8000 1.0000 2.0000 0.0000 Constraint 549 579 0.8000 1.0000 2.0000 0.0000 Constraint 549 572 0.8000 1.0000 2.0000 0.0000 Constraint 549 564 0.8000 1.0000 2.0000 0.0000 Constraint 549 557 0.8000 1.0000 2.0000 0.0000 Constraint 538 1772 0.8000 1.0000 2.0000 0.0000 Constraint 538 1764 0.8000 1.0000 2.0000 0.0000 Constraint 538 1731 0.8000 1.0000 2.0000 0.0000 Constraint 538 1720 0.8000 1.0000 2.0000 0.0000 Constraint 538 1714 0.8000 1.0000 2.0000 0.0000 Constraint 538 1703 0.8000 1.0000 2.0000 0.0000 Constraint 538 1692 0.8000 1.0000 2.0000 0.0000 Constraint 538 1683 0.8000 1.0000 2.0000 0.0000 Constraint 538 1670 0.8000 1.0000 2.0000 0.0000 Constraint 538 1662 0.8000 1.0000 2.0000 0.0000 Constraint 538 1649 0.8000 1.0000 2.0000 0.0000 Constraint 538 1611 0.8000 1.0000 2.0000 0.0000 Constraint 538 1575 0.8000 1.0000 2.0000 0.0000 Constraint 538 1567 0.8000 1.0000 2.0000 0.0000 Constraint 538 1548 0.8000 1.0000 2.0000 0.0000 Constraint 538 1541 0.8000 1.0000 2.0000 0.0000 Constraint 538 1533 0.8000 1.0000 2.0000 0.0000 Constraint 538 1526 0.8000 1.0000 2.0000 0.0000 Constraint 538 1511 0.8000 1.0000 2.0000 0.0000 Constraint 538 1503 0.8000 1.0000 2.0000 0.0000 Constraint 538 1494 0.8000 1.0000 2.0000 0.0000 Constraint 538 1488 0.8000 1.0000 2.0000 0.0000 Constraint 538 1479 0.8000 1.0000 2.0000 0.0000 Constraint 538 1447 0.8000 1.0000 2.0000 0.0000 Constraint 538 1427 0.8000 1.0000 2.0000 0.0000 Constraint 538 1399 0.8000 1.0000 2.0000 0.0000 Constraint 538 1366 0.8000 1.0000 2.0000 0.0000 Constraint 538 1358 0.8000 1.0000 2.0000 0.0000 Constraint 538 1334 0.8000 1.0000 2.0000 0.0000 Constraint 538 1325 0.8000 1.0000 2.0000 0.0000 Constraint 538 1309 0.8000 1.0000 2.0000 0.0000 Constraint 538 1276 0.8000 1.0000 2.0000 0.0000 Constraint 538 1268 0.8000 1.0000 2.0000 0.0000 Constraint 538 1246 0.8000 1.0000 2.0000 0.0000 Constraint 538 1220 0.8000 1.0000 2.0000 0.0000 Constraint 538 1213 0.8000 1.0000 2.0000 0.0000 Constraint 538 1178 0.8000 1.0000 2.0000 0.0000 Constraint 538 1100 0.8000 1.0000 2.0000 0.0000 Constraint 538 1092 0.8000 1.0000 2.0000 0.0000 Constraint 538 1035 0.8000 1.0000 2.0000 0.0000 Constraint 538 899 0.8000 1.0000 2.0000 0.0000 Constraint 538 706 0.8000 1.0000 2.0000 0.0000 Constraint 538 597 0.8000 1.0000 2.0000 0.0000 Constraint 538 589 0.8000 1.0000 2.0000 0.0000 Constraint 538 579 0.8000 1.0000 2.0000 0.0000 Constraint 538 572 0.8000 1.0000 2.0000 0.0000 Constraint 538 564 0.8000 1.0000 2.0000 0.0000 Constraint 538 557 0.8000 1.0000 2.0000 0.0000 Constraint 538 549 0.8000 1.0000 2.0000 0.0000 Constraint 530 1788 0.8000 1.0000 2.0000 0.0000 Constraint 530 1777 0.8000 1.0000 2.0000 0.0000 Constraint 530 1772 0.8000 1.0000 2.0000 0.0000 Constraint 530 1764 0.8000 1.0000 2.0000 0.0000 Constraint 530 1756 0.8000 1.0000 2.0000 0.0000 Constraint 530 1714 0.8000 1.0000 2.0000 0.0000 Constraint 530 1657 0.8000 1.0000 2.0000 0.0000 Constraint 530 1649 0.8000 1.0000 2.0000 0.0000 Constraint 530 1603 0.8000 1.0000 2.0000 0.0000 Constraint 530 1541 0.8000 1.0000 2.0000 0.0000 Constraint 530 1526 0.8000 1.0000 2.0000 0.0000 Constraint 530 1519 0.8000 1.0000 2.0000 0.0000 Constraint 530 1511 0.8000 1.0000 2.0000 0.0000 Constraint 530 1488 0.8000 1.0000 2.0000 0.0000 Constraint 530 1479 0.8000 1.0000 2.0000 0.0000 Constraint 530 1466 0.8000 1.0000 2.0000 0.0000 Constraint 530 1438 0.8000 1.0000 2.0000 0.0000 Constraint 530 1391 0.8000 1.0000 2.0000 0.0000 Constraint 530 1358 0.8000 1.0000 2.0000 0.0000 Constraint 530 1334 0.8000 1.0000 2.0000 0.0000 Constraint 530 1325 0.8000 1.0000 2.0000 0.0000 Constraint 530 1317 0.8000 1.0000 2.0000 0.0000 Constraint 530 1301 0.8000 1.0000 2.0000 0.0000 Constraint 530 1268 0.8000 1.0000 2.0000 0.0000 Constraint 530 1239 0.8000 1.0000 2.0000 0.0000 Constraint 530 1133 0.8000 1.0000 2.0000 0.0000 Constraint 530 1109 0.8000 1.0000 2.0000 0.0000 Constraint 530 1059 0.8000 1.0000 2.0000 0.0000 Constraint 530 1014 0.8000 1.0000 2.0000 0.0000 Constraint 530 955 0.8000 1.0000 2.0000 0.0000 Constraint 530 930 0.8000 1.0000 2.0000 0.0000 Constraint 530 921 0.8000 1.0000 2.0000 0.0000 Constraint 530 908 0.8000 1.0000 2.0000 0.0000 Constraint 530 899 0.8000 1.0000 2.0000 0.0000 Constraint 530 876 0.8000 1.0000 2.0000 0.0000 Constraint 530 792 0.8000 1.0000 2.0000 0.0000 Constraint 530 731 0.8000 1.0000 2.0000 0.0000 Constraint 530 589 0.8000 1.0000 2.0000 0.0000 Constraint 530 579 0.8000 1.0000 2.0000 0.0000 Constraint 530 572 0.8000 1.0000 2.0000 0.0000 Constraint 530 564 0.8000 1.0000 2.0000 0.0000 Constraint 530 557 0.8000 1.0000 2.0000 0.0000 Constraint 530 549 0.8000 1.0000 2.0000 0.0000 Constraint 530 538 0.8000 1.0000 2.0000 0.0000 Constraint 521 1788 0.8000 1.0000 2.0000 0.0000 Constraint 521 1777 0.8000 1.0000 2.0000 0.0000 Constraint 521 1772 0.8000 1.0000 2.0000 0.0000 Constraint 521 1764 0.8000 1.0000 2.0000 0.0000 Constraint 521 1756 0.8000 1.0000 2.0000 0.0000 Constraint 521 1748 0.8000 1.0000 2.0000 0.0000 Constraint 521 1739 0.8000 1.0000 2.0000 0.0000 Constraint 521 1714 0.8000 1.0000 2.0000 0.0000 Constraint 521 1683 0.8000 1.0000 2.0000 0.0000 Constraint 521 1678 0.8000 1.0000 2.0000 0.0000 Constraint 521 1662 0.8000 1.0000 2.0000 0.0000 Constraint 521 1657 0.8000 1.0000 2.0000 0.0000 Constraint 521 1634 0.8000 1.0000 2.0000 0.0000 Constraint 521 1620 0.8000 1.0000 2.0000 0.0000 Constraint 521 1611 0.8000 1.0000 2.0000 0.0000 Constraint 521 1603 0.8000 1.0000 2.0000 0.0000 Constraint 521 1596 0.8000 1.0000 2.0000 0.0000 Constraint 521 1575 0.8000 1.0000 2.0000 0.0000 Constraint 521 1567 0.8000 1.0000 2.0000 0.0000 Constraint 521 1556 0.8000 1.0000 2.0000 0.0000 Constraint 521 1541 0.8000 1.0000 2.0000 0.0000 Constraint 521 1526 0.8000 1.0000 2.0000 0.0000 Constraint 521 1519 0.8000 1.0000 2.0000 0.0000 Constraint 521 1511 0.8000 1.0000 2.0000 0.0000 Constraint 521 1503 0.8000 1.0000 2.0000 0.0000 Constraint 521 1494 0.8000 1.0000 2.0000 0.0000 Constraint 521 1488 0.8000 1.0000 2.0000 0.0000 Constraint 521 1479 0.8000 1.0000 2.0000 0.0000 Constraint 521 1471 0.8000 1.0000 2.0000 0.0000 Constraint 521 1466 0.8000 1.0000 2.0000 0.0000 Constraint 521 1455 0.8000 1.0000 2.0000 0.0000 Constraint 521 1343 0.8000 1.0000 2.0000 0.0000 Constraint 521 1334 0.8000 1.0000 2.0000 0.0000 Constraint 521 1325 0.8000 1.0000 2.0000 0.0000 Constraint 521 1317 0.8000 1.0000 2.0000 0.0000 Constraint 521 1309 0.8000 1.0000 2.0000 0.0000 Constraint 521 1301 0.8000 1.0000 2.0000 0.0000 Constraint 521 1268 0.8000 1.0000 2.0000 0.0000 Constraint 521 1246 0.8000 1.0000 2.0000 0.0000 Constraint 521 1239 0.8000 1.0000 2.0000 0.0000 Constraint 521 1228 0.8000 1.0000 2.0000 0.0000 Constraint 521 1178 0.8000 1.0000 2.0000 0.0000 Constraint 521 1149 0.8000 1.0000 2.0000 0.0000 Constraint 521 1141 0.8000 1.0000 2.0000 0.0000 Constraint 521 1133 0.8000 1.0000 2.0000 0.0000 Constraint 521 1109 0.8000 1.0000 2.0000 0.0000 Constraint 521 1100 0.8000 1.0000 2.0000 0.0000 Constraint 521 1035 0.8000 1.0000 2.0000 0.0000 Constraint 521 1014 0.8000 1.0000 2.0000 0.0000 Constraint 521 1008 0.8000 1.0000 2.0000 0.0000 Constraint 521 988 0.8000 1.0000 2.0000 0.0000 Constraint 521 944 0.8000 1.0000 2.0000 0.0000 Constraint 521 884 0.8000 1.0000 2.0000 0.0000 Constraint 521 579 0.8000 1.0000 2.0000 0.0000 Constraint 521 572 0.8000 1.0000 2.0000 0.0000 Constraint 521 564 0.8000 1.0000 2.0000 0.0000 Constraint 521 557 0.8000 1.0000 2.0000 0.0000 Constraint 521 549 0.8000 1.0000 2.0000 0.0000 Constraint 521 538 0.8000 1.0000 2.0000 0.0000 Constraint 521 530 0.8000 1.0000 2.0000 0.0000 Constraint 510 1772 0.8000 1.0000 2.0000 0.0000 Constraint 510 1764 0.8000 1.0000 2.0000 0.0000 Constraint 510 1739 0.8000 1.0000 2.0000 0.0000 Constraint 510 1731 0.8000 1.0000 2.0000 0.0000 Constraint 510 1683 0.8000 1.0000 2.0000 0.0000 Constraint 510 1678 0.8000 1.0000 2.0000 0.0000 Constraint 510 1662 0.8000 1.0000 2.0000 0.0000 Constraint 510 1649 0.8000 1.0000 2.0000 0.0000 Constraint 510 1634 0.8000 1.0000 2.0000 0.0000 Constraint 510 1611 0.8000 1.0000 2.0000 0.0000 Constraint 510 1603 0.8000 1.0000 2.0000 0.0000 Constraint 510 1596 0.8000 1.0000 2.0000 0.0000 Constraint 510 1587 0.8000 1.0000 2.0000 0.0000 Constraint 510 1575 0.8000 1.0000 2.0000 0.0000 Constraint 510 1567 0.8000 1.0000 2.0000 0.0000 Constraint 510 1556 0.8000 1.0000 2.0000 0.0000 Constraint 510 1533 0.8000 1.0000 2.0000 0.0000 Constraint 510 1526 0.8000 1.0000 2.0000 0.0000 Constraint 510 1503 0.8000 1.0000 2.0000 0.0000 Constraint 510 1494 0.8000 1.0000 2.0000 0.0000 Constraint 510 1471 0.8000 1.0000 2.0000 0.0000 Constraint 510 1466 0.8000 1.0000 2.0000 0.0000 Constraint 510 1455 0.8000 1.0000 2.0000 0.0000 Constraint 510 1447 0.8000 1.0000 2.0000 0.0000 Constraint 510 1438 0.8000 1.0000 2.0000 0.0000 Constraint 510 1427 0.8000 1.0000 2.0000 0.0000 Constraint 510 1408 0.8000 1.0000 2.0000 0.0000 Constraint 510 1399 0.8000 1.0000 2.0000 0.0000 Constraint 510 1358 0.8000 1.0000 2.0000 0.0000 Constraint 510 1351 0.8000 1.0000 2.0000 0.0000 Constraint 510 1343 0.8000 1.0000 2.0000 0.0000 Constraint 510 1317 0.8000 1.0000 2.0000 0.0000 Constraint 510 1309 0.8000 1.0000 2.0000 0.0000 Constraint 510 1293 0.8000 1.0000 2.0000 0.0000 Constraint 510 1260 0.8000 1.0000 2.0000 0.0000 Constraint 510 1251 0.8000 1.0000 2.0000 0.0000 Constraint 510 1220 0.8000 1.0000 2.0000 0.0000 Constraint 510 1213 0.8000 1.0000 2.0000 0.0000 Constraint 510 1133 0.8000 1.0000 2.0000 0.0000 Constraint 510 1125 0.8000 1.0000 2.0000 0.0000 Constraint 510 1059 0.8000 1.0000 2.0000 0.0000 Constraint 510 1022 0.8000 1.0000 2.0000 0.0000 Constraint 510 1014 0.8000 1.0000 2.0000 0.0000 Constraint 510 930 0.8000 1.0000 2.0000 0.0000 Constraint 510 899 0.8000 1.0000 2.0000 0.0000 Constraint 510 761 0.8000 1.0000 2.0000 0.0000 Constraint 510 608 0.8000 1.0000 2.0000 0.0000 Constraint 510 579 0.8000 1.0000 2.0000 0.0000 Constraint 510 572 0.8000 1.0000 2.0000 0.0000 Constraint 510 564 0.8000 1.0000 2.0000 0.0000 Constraint 510 557 0.8000 1.0000 2.0000 0.0000 Constraint 510 549 0.8000 1.0000 2.0000 0.0000 Constraint 510 538 0.8000 1.0000 2.0000 0.0000 Constraint 510 530 0.8000 1.0000 2.0000 0.0000 Constraint 510 521 0.8000 1.0000 2.0000 0.0000 Constraint 501 1772 0.8000 1.0000 2.0000 0.0000 Constraint 501 1764 0.8000 1.0000 2.0000 0.0000 Constraint 501 1731 0.8000 1.0000 2.0000 0.0000 Constraint 501 1720 0.8000 1.0000 2.0000 0.0000 Constraint 501 1714 0.8000 1.0000 2.0000 0.0000 Constraint 501 1662 0.8000 1.0000 2.0000 0.0000 Constraint 501 1657 0.8000 1.0000 2.0000 0.0000 Constraint 501 1620 0.8000 1.0000 2.0000 0.0000 Constraint 501 1603 0.8000 1.0000 2.0000 0.0000 Constraint 501 1575 0.8000 1.0000 2.0000 0.0000 Constraint 501 1548 0.8000 1.0000 2.0000 0.0000 Constraint 501 1541 0.8000 1.0000 2.0000 0.0000 Constraint 501 1526 0.8000 1.0000 2.0000 0.0000 Constraint 501 1511 0.8000 1.0000 2.0000 0.0000 Constraint 501 1488 0.8000 1.0000 2.0000 0.0000 Constraint 501 1479 0.8000 1.0000 2.0000 0.0000 Constraint 501 1466 0.8000 1.0000 2.0000 0.0000 Constraint 501 1455 0.8000 1.0000 2.0000 0.0000 Constraint 501 1438 0.8000 1.0000 2.0000 0.0000 Constraint 501 1427 0.8000 1.0000 2.0000 0.0000 Constraint 501 1416 0.8000 1.0000 2.0000 0.0000 Constraint 501 1408 0.8000 1.0000 2.0000 0.0000 Constraint 501 1399 0.8000 1.0000 2.0000 0.0000 Constraint 501 1391 0.8000 1.0000 2.0000 0.0000 Constraint 501 1374 0.8000 1.0000 2.0000 0.0000 Constraint 501 1366 0.8000 1.0000 2.0000 0.0000 Constraint 501 1358 0.8000 1.0000 2.0000 0.0000 Constraint 501 1351 0.8000 1.0000 2.0000 0.0000 Constraint 501 1343 0.8000 1.0000 2.0000 0.0000 Constraint 501 1334 0.8000 1.0000 2.0000 0.0000 Constraint 501 1325 0.8000 1.0000 2.0000 0.0000 Constraint 501 1317 0.8000 1.0000 2.0000 0.0000 Constraint 501 1309 0.8000 1.0000 2.0000 0.0000 Constraint 501 1268 0.8000 1.0000 2.0000 0.0000 Constraint 501 1246 0.8000 1.0000 2.0000 0.0000 Constraint 501 1204 0.8000 1.0000 2.0000 0.0000 Constraint 501 1178 0.8000 1.0000 2.0000 0.0000 Constraint 501 1167 0.8000 1.0000 2.0000 0.0000 Constraint 501 1149 0.8000 1.0000 2.0000 0.0000 Constraint 501 1133 0.8000 1.0000 2.0000 0.0000 Constraint 501 1117 0.8000 1.0000 2.0000 0.0000 Constraint 501 1068 0.8000 1.0000 2.0000 0.0000 Constraint 501 1059 0.8000 1.0000 2.0000 0.0000 Constraint 501 1035 0.8000 1.0000 2.0000 0.0000 Constraint 501 1022 0.8000 1.0000 2.0000 0.0000 Constraint 501 1014 0.8000 1.0000 2.0000 0.0000 Constraint 501 808 0.8000 1.0000 2.0000 0.0000 Constraint 501 792 0.8000 1.0000 2.0000 0.0000 Constraint 501 572 0.8000 1.0000 2.0000 0.0000 Constraint 501 564 0.8000 1.0000 2.0000 0.0000 Constraint 501 557 0.8000 1.0000 2.0000 0.0000 Constraint 501 549 0.8000 1.0000 2.0000 0.0000 Constraint 501 538 0.8000 1.0000 2.0000 0.0000 Constraint 501 530 0.8000 1.0000 2.0000 0.0000 Constraint 501 521 0.8000 1.0000 2.0000 0.0000 Constraint 501 510 0.8000 1.0000 2.0000 0.0000 Constraint 493 1788 0.8000 1.0000 2.0000 0.0000 Constraint 493 1777 0.8000 1.0000 2.0000 0.0000 Constraint 493 1772 0.8000 1.0000 2.0000 0.0000 Constraint 493 1764 0.8000 1.0000 2.0000 0.0000 Constraint 493 1748 0.8000 1.0000 2.0000 0.0000 Constraint 493 1739 0.8000 1.0000 2.0000 0.0000 Constraint 493 1731 0.8000 1.0000 2.0000 0.0000 Constraint 493 1720 0.8000 1.0000 2.0000 0.0000 Constraint 493 1714 0.8000 1.0000 2.0000 0.0000 Constraint 493 1703 0.8000 1.0000 2.0000 0.0000 Constraint 493 1683 0.8000 1.0000 2.0000 0.0000 Constraint 493 1678 0.8000 1.0000 2.0000 0.0000 Constraint 493 1662 0.8000 1.0000 2.0000 0.0000 Constraint 493 1657 0.8000 1.0000 2.0000 0.0000 Constraint 493 1634 0.8000 1.0000 2.0000 0.0000 Constraint 493 1620 0.8000 1.0000 2.0000 0.0000 Constraint 493 1611 0.8000 1.0000 2.0000 0.0000 Constraint 493 1603 0.8000 1.0000 2.0000 0.0000 Constraint 493 1596 0.8000 1.0000 2.0000 0.0000 Constraint 493 1587 0.8000 1.0000 2.0000 0.0000 Constraint 493 1575 0.8000 1.0000 2.0000 0.0000 Constraint 493 1567 0.8000 1.0000 2.0000 0.0000 Constraint 493 1556 0.8000 1.0000 2.0000 0.0000 Constraint 493 1526 0.8000 1.0000 2.0000 0.0000 Constraint 493 1503 0.8000 1.0000 2.0000 0.0000 Constraint 493 1494 0.8000 1.0000 2.0000 0.0000 Constraint 493 1466 0.8000 1.0000 2.0000 0.0000 Constraint 493 1427 0.8000 1.0000 2.0000 0.0000 Constraint 493 1391 0.8000 1.0000 2.0000 0.0000 Constraint 493 1325 0.8000 1.0000 2.0000 0.0000 Constraint 493 1309 0.8000 1.0000 2.0000 0.0000 Constraint 493 1301 0.8000 1.0000 2.0000 0.0000 Constraint 493 1268 0.8000 1.0000 2.0000 0.0000 Constraint 493 1260 0.8000 1.0000 2.0000 0.0000 Constraint 493 1204 0.8000 1.0000 2.0000 0.0000 Constraint 493 1149 0.8000 1.0000 2.0000 0.0000 Constraint 493 1133 0.8000 1.0000 2.0000 0.0000 Constraint 493 1125 0.8000 1.0000 2.0000 0.0000 Constraint 493 1117 0.8000 1.0000 2.0000 0.0000 Constraint 493 1092 0.8000 1.0000 2.0000 0.0000 Constraint 493 761 0.8000 1.0000 2.0000 0.0000 Constraint 493 579 0.8000 1.0000 2.0000 0.0000 Constraint 493 572 0.8000 1.0000 2.0000 0.0000 Constraint 493 564 0.8000 1.0000 2.0000 0.0000 Constraint 493 557 0.8000 1.0000 2.0000 0.0000 Constraint 493 549 0.8000 1.0000 2.0000 0.0000 Constraint 493 538 0.8000 1.0000 2.0000 0.0000 Constraint 493 530 0.8000 1.0000 2.0000 0.0000 Constraint 493 521 0.8000 1.0000 2.0000 0.0000 Constraint 493 510 0.8000 1.0000 2.0000 0.0000 Constraint 493 501 0.8000 1.0000 2.0000 0.0000 Constraint 487 1788 0.8000 1.0000 2.0000 0.0000 Constraint 487 1777 0.8000 1.0000 2.0000 0.0000 Constraint 487 1772 0.8000 1.0000 2.0000 0.0000 Constraint 487 1764 0.8000 1.0000 2.0000 0.0000 Constraint 487 1739 0.8000 1.0000 2.0000 0.0000 Constraint 487 1714 0.8000 1.0000 2.0000 0.0000 Constraint 487 1703 0.8000 1.0000 2.0000 0.0000 Constraint 487 1692 0.8000 1.0000 2.0000 0.0000 Constraint 487 1683 0.8000 1.0000 2.0000 0.0000 Constraint 487 1678 0.8000 1.0000 2.0000 0.0000 Constraint 487 1649 0.8000 1.0000 2.0000 0.0000 Constraint 487 1634 0.8000 1.0000 2.0000 0.0000 Constraint 487 1620 0.8000 1.0000 2.0000 0.0000 Constraint 487 1611 0.8000 1.0000 2.0000 0.0000 Constraint 487 1603 0.8000 1.0000 2.0000 0.0000 Constraint 487 1596 0.8000 1.0000 2.0000 0.0000 Constraint 487 1587 0.8000 1.0000 2.0000 0.0000 Constraint 487 1575 0.8000 1.0000 2.0000 0.0000 Constraint 487 1567 0.8000 1.0000 2.0000 0.0000 Constraint 487 1556 0.8000 1.0000 2.0000 0.0000 Constraint 487 1533 0.8000 1.0000 2.0000 0.0000 Constraint 487 1526 0.8000 1.0000 2.0000 0.0000 Constraint 487 1511 0.8000 1.0000 2.0000 0.0000 Constraint 487 1503 0.8000 1.0000 2.0000 0.0000 Constraint 487 1494 0.8000 1.0000 2.0000 0.0000 Constraint 487 1455 0.8000 1.0000 2.0000 0.0000 Constraint 487 1334 0.8000 1.0000 2.0000 0.0000 Constraint 487 1325 0.8000 1.0000 2.0000 0.0000 Constraint 487 1317 0.8000 1.0000 2.0000 0.0000 Constraint 487 1309 0.8000 1.0000 2.0000 0.0000 Constraint 487 1293 0.8000 1.0000 2.0000 0.0000 Constraint 487 1284 0.8000 1.0000 2.0000 0.0000 Constraint 487 1276 0.8000 1.0000 2.0000 0.0000 Constraint 487 1268 0.8000 1.0000 2.0000 0.0000 Constraint 487 1260 0.8000 1.0000 2.0000 0.0000 Constraint 487 1251 0.8000 1.0000 2.0000 0.0000 Constraint 487 1246 0.8000 1.0000 2.0000 0.0000 Constraint 487 1239 0.8000 1.0000 2.0000 0.0000 Constraint 487 1228 0.8000 1.0000 2.0000 0.0000 Constraint 487 1167 0.8000 1.0000 2.0000 0.0000 Constraint 487 1133 0.8000 1.0000 2.0000 0.0000 Constraint 487 1117 0.8000 1.0000 2.0000 0.0000 Constraint 487 1109 0.8000 1.0000 2.0000 0.0000 Constraint 487 1092 0.8000 1.0000 2.0000 0.0000 Constraint 487 1084 0.8000 1.0000 2.0000 0.0000 Constraint 487 1035 0.8000 1.0000 2.0000 0.0000 Constraint 487 1030 0.8000 1.0000 2.0000 0.0000 Constraint 487 1022 0.8000 1.0000 2.0000 0.0000 Constraint 487 1008 0.8000 1.0000 2.0000 0.0000 Constraint 487 997 0.8000 1.0000 2.0000 0.0000 Constraint 487 980 0.8000 1.0000 2.0000 0.0000 Constraint 487 968 0.8000 1.0000 2.0000 0.0000 Constraint 487 963 0.8000 1.0000 2.0000 0.0000 Constraint 487 868 0.8000 1.0000 2.0000 0.0000 Constraint 487 818 0.8000 1.0000 2.0000 0.0000 Constraint 487 800 0.8000 1.0000 2.0000 0.0000 Constraint 487 783 0.8000 1.0000 2.0000 0.0000 Constraint 487 778 0.8000 1.0000 2.0000 0.0000 Constraint 487 761 0.8000 1.0000 2.0000 0.0000 Constraint 487 665 0.8000 1.0000 2.0000 0.0000 Constraint 487 623 0.8000 1.0000 2.0000 0.0000 Constraint 487 597 0.8000 1.0000 2.0000 0.0000 Constraint 487 579 0.8000 1.0000 2.0000 0.0000 Constraint 487 572 0.8000 1.0000 2.0000 0.0000 Constraint 487 564 0.8000 1.0000 2.0000 0.0000 Constraint 487 557 0.8000 1.0000 2.0000 0.0000 Constraint 487 549 0.8000 1.0000 2.0000 0.0000 Constraint 487 538 0.8000 1.0000 2.0000 0.0000 Constraint 487 530 0.8000 1.0000 2.0000 0.0000 Constraint 487 521 0.8000 1.0000 2.0000 0.0000 Constraint 487 510 0.8000 1.0000 2.0000 0.0000 Constraint 487 501 0.8000 1.0000 2.0000 0.0000 Constraint 487 493 0.8000 1.0000 2.0000 0.0000 Constraint 479 1777 0.8000 1.0000 2.0000 0.0000 Constraint 479 1772 0.8000 1.0000 2.0000 0.0000 Constraint 479 1764 0.8000 1.0000 2.0000 0.0000 Constraint 479 1756 0.8000 1.0000 2.0000 0.0000 Constraint 479 1748 0.8000 1.0000 2.0000 0.0000 Constraint 479 1739 0.8000 1.0000 2.0000 0.0000 Constraint 479 1731 0.8000 1.0000 2.0000 0.0000 Constraint 479 1714 0.8000 1.0000 2.0000 0.0000 Constraint 479 1683 0.8000 1.0000 2.0000 0.0000 Constraint 479 1678 0.8000 1.0000 2.0000 0.0000 Constraint 479 1670 0.8000 1.0000 2.0000 0.0000 Constraint 479 1662 0.8000 1.0000 2.0000 0.0000 Constraint 479 1657 0.8000 1.0000 2.0000 0.0000 Constraint 479 1634 0.8000 1.0000 2.0000 0.0000 Constraint 479 1620 0.8000 1.0000 2.0000 0.0000 Constraint 479 1611 0.8000 1.0000 2.0000 0.0000 Constraint 479 1603 0.8000 1.0000 2.0000 0.0000 Constraint 479 1587 0.8000 1.0000 2.0000 0.0000 Constraint 479 1575 0.8000 1.0000 2.0000 0.0000 Constraint 479 1548 0.8000 1.0000 2.0000 0.0000 Constraint 479 1526 0.8000 1.0000 2.0000 0.0000 Constraint 479 1511 0.8000 1.0000 2.0000 0.0000 Constraint 479 1503 0.8000 1.0000 2.0000 0.0000 Constraint 479 1494 0.8000 1.0000 2.0000 0.0000 Constraint 479 1488 0.8000 1.0000 2.0000 0.0000 Constraint 479 1479 0.8000 1.0000 2.0000 0.0000 Constraint 479 1471 0.8000 1.0000 2.0000 0.0000 Constraint 479 1466 0.8000 1.0000 2.0000 0.0000 Constraint 479 1455 0.8000 1.0000 2.0000 0.0000 Constraint 479 1447 0.8000 1.0000 2.0000 0.0000 Constraint 479 1438 0.8000 1.0000 2.0000 0.0000 Constraint 479 1427 0.8000 1.0000 2.0000 0.0000 Constraint 479 1416 0.8000 1.0000 2.0000 0.0000 Constraint 479 1408 0.8000 1.0000 2.0000 0.0000 Constraint 479 1399 0.8000 1.0000 2.0000 0.0000 Constraint 479 1391 0.8000 1.0000 2.0000 0.0000 Constraint 479 1382 0.8000 1.0000 2.0000 0.0000 Constraint 479 1374 0.8000 1.0000 2.0000 0.0000 Constraint 479 1366 0.8000 1.0000 2.0000 0.0000 Constraint 479 1358 0.8000 1.0000 2.0000 0.0000 Constraint 479 1351 0.8000 1.0000 2.0000 0.0000 Constraint 479 1343 0.8000 1.0000 2.0000 0.0000 Constraint 479 1334 0.8000 1.0000 2.0000 0.0000 Constraint 479 1325 0.8000 1.0000 2.0000 0.0000 Constraint 479 1317 0.8000 1.0000 2.0000 0.0000 Constraint 479 1309 0.8000 1.0000 2.0000 0.0000 Constraint 479 1284 0.8000 1.0000 2.0000 0.0000 Constraint 479 1276 0.8000 1.0000 2.0000 0.0000 Constraint 479 1268 0.8000 1.0000 2.0000 0.0000 Constraint 479 1260 0.8000 1.0000 2.0000 0.0000 Constraint 479 1251 0.8000 1.0000 2.0000 0.0000 Constraint 479 1220 0.8000 1.0000 2.0000 0.0000 Constraint 479 1167 0.8000 1.0000 2.0000 0.0000 Constraint 479 1158 0.8000 1.0000 2.0000 0.0000 Constraint 479 1149 0.8000 1.0000 2.0000 0.0000 Constraint 479 1117 0.8000 1.0000 2.0000 0.0000 Constraint 479 1109 0.8000 1.0000 2.0000 0.0000 Constraint 479 1100 0.8000 1.0000 2.0000 0.0000 Constraint 479 1092 0.8000 1.0000 2.0000 0.0000 Constraint 479 1014 0.8000 1.0000 2.0000 0.0000 Constraint 479 963 0.8000 1.0000 2.0000 0.0000 Constraint 479 930 0.8000 1.0000 2.0000 0.0000 Constraint 479 899 0.8000 1.0000 2.0000 0.0000 Constraint 479 848 0.8000 1.0000 2.0000 0.0000 Constraint 479 836 0.8000 1.0000 2.0000 0.0000 Constraint 479 829 0.8000 1.0000 2.0000 0.0000 Constraint 479 792 0.8000 1.0000 2.0000 0.0000 Constraint 479 769 0.8000 1.0000 2.0000 0.0000 Constraint 479 748 0.8000 1.0000 2.0000 0.0000 Constraint 479 739 0.8000 1.0000 2.0000 0.0000 Constraint 479 650 0.8000 1.0000 2.0000 0.0000 Constraint 479 579 0.8000 1.0000 2.0000 0.0000 Constraint 479 549 0.8000 1.0000 2.0000 0.0000 Constraint 479 538 0.8000 1.0000 2.0000 0.0000 Constraint 479 530 0.8000 1.0000 2.0000 0.0000 Constraint 479 521 0.8000 1.0000 2.0000 0.0000 Constraint 479 510 0.8000 1.0000 2.0000 0.0000 Constraint 479 501 0.8000 1.0000 2.0000 0.0000 Constraint 479 493 0.8000 1.0000 2.0000 0.0000 Constraint 479 487 0.8000 1.0000 2.0000 0.0000 Constraint 466 1788 0.8000 1.0000 2.0000 0.0000 Constraint 466 1777 0.8000 1.0000 2.0000 0.0000 Constraint 466 1772 0.8000 1.0000 2.0000 0.0000 Constraint 466 1764 0.8000 1.0000 2.0000 0.0000 Constraint 466 1756 0.8000 1.0000 2.0000 0.0000 Constraint 466 1739 0.8000 1.0000 2.0000 0.0000 Constraint 466 1683 0.8000 1.0000 2.0000 0.0000 Constraint 466 1678 0.8000 1.0000 2.0000 0.0000 Constraint 466 1657 0.8000 1.0000 2.0000 0.0000 Constraint 466 1634 0.8000 1.0000 2.0000 0.0000 Constraint 466 1620 0.8000 1.0000 2.0000 0.0000 Constraint 466 1611 0.8000 1.0000 2.0000 0.0000 Constraint 466 1603 0.8000 1.0000 2.0000 0.0000 Constraint 466 1548 0.8000 1.0000 2.0000 0.0000 Constraint 466 1533 0.8000 1.0000 2.0000 0.0000 Constraint 466 1526 0.8000 1.0000 2.0000 0.0000 Constraint 466 1519 0.8000 1.0000 2.0000 0.0000 Constraint 466 1511 0.8000 1.0000 2.0000 0.0000 Constraint 466 1455 0.8000 1.0000 2.0000 0.0000 Constraint 466 1427 0.8000 1.0000 2.0000 0.0000 Constraint 466 1416 0.8000 1.0000 2.0000 0.0000 Constraint 466 1408 0.8000 1.0000 2.0000 0.0000 Constraint 466 1399 0.8000 1.0000 2.0000 0.0000 Constraint 466 1391 0.8000 1.0000 2.0000 0.0000 Constraint 466 1366 0.8000 1.0000 2.0000 0.0000 Constraint 466 1343 0.8000 1.0000 2.0000 0.0000 Constraint 466 1334 0.8000 1.0000 2.0000 0.0000 Constraint 466 1325 0.8000 1.0000 2.0000 0.0000 Constraint 466 1317 0.8000 1.0000 2.0000 0.0000 Constraint 466 1301 0.8000 1.0000 2.0000 0.0000 Constraint 466 1293 0.8000 1.0000 2.0000 0.0000 Constraint 466 1284 0.8000 1.0000 2.0000 0.0000 Constraint 466 1268 0.8000 1.0000 2.0000 0.0000 Constraint 466 1260 0.8000 1.0000 2.0000 0.0000 Constraint 466 1251 0.8000 1.0000 2.0000 0.0000 Constraint 466 1149 0.8000 1.0000 2.0000 0.0000 Constraint 466 1141 0.8000 1.0000 2.0000 0.0000 Constraint 466 1133 0.8000 1.0000 2.0000 0.0000 Constraint 466 1125 0.8000 1.0000 2.0000 0.0000 Constraint 466 1117 0.8000 1.0000 2.0000 0.0000 Constraint 466 1109 0.8000 1.0000 2.0000 0.0000 Constraint 466 1092 0.8000 1.0000 2.0000 0.0000 Constraint 466 1077 0.8000 1.0000 2.0000 0.0000 Constraint 466 988 0.8000 1.0000 2.0000 0.0000 Constraint 466 955 0.8000 1.0000 2.0000 0.0000 Constraint 466 930 0.8000 1.0000 2.0000 0.0000 Constraint 466 731 0.8000 1.0000 2.0000 0.0000 Constraint 466 623 0.8000 1.0000 2.0000 0.0000 Constraint 466 608 0.8000 1.0000 2.0000 0.0000 Constraint 466 589 0.8000 1.0000 2.0000 0.0000 Constraint 466 572 0.8000 1.0000 2.0000 0.0000 Constraint 466 530 0.8000 1.0000 2.0000 0.0000 Constraint 466 521 0.8000 1.0000 2.0000 0.0000 Constraint 466 510 0.8000 1.0000 2.0000 0.0000 Constraint 466 501 0.8000 1.0000 2.0000 0.0000 Constraint 466 493 0.8000 1.0000 2.0000 0.0000 Constraint 466 487 0.8000 1.0000 2.0000 0.0000 Constraint 466 479 0.8000 1.0000 2.0000 0.0000 Constraint 457 1788 0.8000 1.0000 2.0000 0.0000 Constraint 457 1777 0.8000 1.0000 2.0000 0.0000 Constraint 457 1764 0.8000 1.0000 2.0000 0.0000 Constraint 457 1748 0.8000 1.0000 2.0000 0.0000 Constraint 457 1739 0.8000 1.0000 2.0000 0.0000 Constraint 457 1720 0.8000 1.0000 2.0000 0.0000 Constraint 457 1714 0.8000 1.0000 2.0000 0.0000 Constraint 457 1692 0.8000 1.0000 2.0000 0.0000 Constraint 457 1683 0.8000 1.0000 2.0000 0.0000 Constraint 457 1678 0.8000 1.0000 2.0000 0.0000 Constraint 457 1670 0.8000 1.0000 2.0000 0.0000 Constraint 457 1662 0.8000 1.0000 2.0000 0.0000 Constraint 457 1657 0.8000 1.0000 2.0000 0.0000 Constraint 457 1649 0.8000 1.0000 2.0000 0.0000 Constraint 457 1634 0.8000 1.0000 2.0000 0.0000 Constraint 457 1620 0.8000 1.0000 2.0000 0.0000 Constraint 457 1611 0.8000 1.0000 2.0000 0.0000 Constraint 457 1603 0.8000 1.0000 2.0000 0.0000 Constraint 457 1596 0.8000 1.0000 2.0000 0.0000 Constraint 457 1587 0.8000 1.0000 2.0000 0.0000 Constraint 457 1575 0.8000 1.0000 2.0000 0.0000 Constraint 457 1548 0.8000 1.0000 2.0000 0.0000 Constraint 457 1541 0.8000 1.0000 2.0000 0.0000 Constraint 457 1533 0.8000 1.0000 2.0000 0.0000 Constraint 457 1526 0.8000 1.0000 2.0000 0.0000 Constraint 457 1519 0.8000 1.0000 2.0000 0.0000 Constraint 457 1511 0.8000 1.0000 2.0000 0.0000 Constraint 457 1503 0.8000 1.0000 2.0000 0.0000 Constraint 457 1494 0.8000 1.0000 2.0000 0.0000 Constraint 457 1488 0.8000 1.0000 2.0000 0.0000 Constraint 457 1479 0.8000 1.0000 2.0000 0.0000 Constraint 457 1471 0.8000 1.0000 2.0000 0.0000 Constraint 457 1447 0.8000 1.0000 2.0000 0.0000 Constraint 457 1427 0.8000 1.0000 2.0000 0.0000 Constraint 457 1416 0.8000 1.0000 2.0000 0.0000 Constraint 457 1408 0.8000 1.0000 2.0000 0.0000 Constraint 457 1399 0.8000 1.0000 2.0000 0.0000 Constraint 457 1391 0.8000 1.0000 2.0000 0.0000 Constraint 457 1382 0.8000 1.0000 2.0000 0.0000 Constraint 457 1374 0.8000 1.0000 2.0000 0.0000 Constraint 457 1366 0.8000 1.0000 2.0000 0.0000 Constraint 457 1358 0.8000 1.0000 2.0000 0.0000 Constraint 457 1351 0.8000 1.0000 2.0000 0.0000 Constraint 457 1343 0.8000 1.0000 2.0000 0.0000 Constraint 457 1334 0.8000 1.0000 2.0000 0.0000 Constraint 457 1317 0.8000 1.0000 2.0000 0.0000 Constraint 457 1309 0.8000 1.0000 2.0000 0.0000 Constraint 457 1301 0.8000 1.0000 2.0000 0.0000 Constraint 457 1293 0.8000 1.0000 2.0000 0.0000 Constraint 457 1284 0.8000 1.0000 2.0000 0.0000 Constraint 457 1276 0.8000 1.0000 2.0000 0.0000 Constraint 457 1268 0.8000 1.0000 2.0000 0.0000 Constraint 457 1260 0.8000 1.0000 2.0000 0.0000 Constraint 457 1251 0.8000 1.0000 2.0000 0.0000 Constraint 457 1246 0.8000 1.0000 2.0000 0.0000 Constraint 457 1239 0.8000 1.0000 2.0000 0.0000 Constraint 457 1220 0.8000 1.0000 2.0000 0.0000 Constraint 457 1213 0.8000 1.0000 2.0000 0.0000 Constraint 457 1204 0.8000 1.0000 2.0000 0.0000 Constraint 457 1149 0.8000 1.0000 2.0000 0.0000 Constraint 457 1141 0.8000 1.0000 2.0000 0.0000 Constraint 457 1133 0.8000 1.0000 2.0000 0.0000 Constraint 457 1125 0.8000 1.0000 2.0000 0.0000 Constraint 457 1117 0.8000 1.0000 2.0000 0.0000 Constraint 457 1109 0.8000 1.0000 2.0000 0.0000 Constraint 457 1100 0.8000 1.0000 2.0000 0.0000 Constraint 457 1092 0.8000 1.0000 2.0000 0.0000 Constraint 457 1054 0.8000 1.0000 2.0000 0.0000 Constraint 457 1046 0.8000 1.0000 2.0000 0.0000 Constraint 457 1030 0.8000 1.0000 2.0000 0.0000 Constraint 457 1008 0.8000 1.0000 2.0000 0.0000 Constraint 457 997 0.8000 1.0000 2.0000 0.0000 Constraint 457 988 0.8000 1.0000 2.0000 0.0000 Constraint 457 980 0.8000 1.0000 2.0000 0.0000 Constraint 457 968 0.8000 1.0000 2.0000 0.0000 Constraint 457 963 0.8000 1.0000 2.0000 0.0000 Constraint 457 955 0.8000 1.0000 2.0000 0.0000 Constraint 457 944 0.8000 1.0000 2.0000 0.0000 Constraint 457 930 0.8000 1.0000 2.0000 0.0000 Constraint 457 921 0.8000 1.0000 2.0000 0.0000 Constraint 457 818 0.8000 1.0000 2.0000 0.0000 Constraint 457 792 0.8000 1.0000 2.0000 0.0000 Constraint 457 748 0.8000 1.0000 2.0000 0.0000 Constraint 457 739 0.8000 1.0000 2.0000 0.0000 Constraint 457 665 0.8000 1.0000 2.0000 0.0000 Constraint 457 657 0.8000 1.0000 2.0000 0.0000 Constraint 457 616 0.8000 1.0000 2.0000 0.0000 Constraint 457 564 0.8000 1.0000 2.0000 0.0000 Constraint 457 521 0.8000 1.0000 2.0000 0.0000 Constraint 457 510 0.8000 1.0000 2.0000 0.0000 Constraint 457 501 0.8000 1.0000 2.0000 0.0000 Constraint 457 493 0.8000 1.0000 2.0000 0.0000 Constraint 457 487 0.8000 1.0000 2.0000 0.0000 Constraint 457 479 0.8000 1.0000 2.0000 0.0000 Constraint 457 466 0.8000 1.0000 2.0000 0.0000 Constraint 448 1788 0.8000 1.0000 2.0000 0.0000 Constraint 448 1777 0.8000 1.0000 2.0000 0.0000 Constraint 448 1772 0.8000 1.0000 2.0000 0.0000 Constraint 448 1764 0.8000 1.0000 2.0000 0.0000 Constraint 448 1756 0.8000 1.0000 2.0000 0.0000 Constraint 448 1748 0.8000 1.0000 2.0000 0.0000 Constraint 448 1739 0.8000 1.0000 2.0000 0.0000 Constraint 448 1731 0.8000 1.0000 2.0000 0.0000 Constraint 448 1720 0.8000 1.0000 2.0000 0.0000 Constraint 448 1714 0.8000 1.0000 2.0000 0.0000 Constraint 448 1703 0.8000 1.0000 2.0000 0.0000 Constraint 448 1692 0.8000 1.0000 2.0000 0.0000 Constraint 448 1683 0.8000 1.0000 2.0000 0.0000 Constraint 448 1678 0.8000 1.0000 2.0000 0.0000 Constraint 448 1670 0.8000 1.0000 2.0000 0.0000 Constraint 448 1662 0.8000 1.0000 2.0000 0.0000 Constraint 448 1649 0.8000 1.0000 2.0000 0.0000 Constraint 448 1634 0.8000 1.0000 2.0000 0.0000 Constraint 448 1620 0.8000 1.0000 2.0000 0.0000 Constraint 448 1611 0.8000 1.0000 2.0000 0.0000 Constraint 448 1533 0.8000 1.0000 2.0000 0.0000 Constraint 448 1519 0.8000 1.0000 2.0000 0.0000 Constraint 448 1511 0.8000 1.0000 2.0000 0.0000 Constraint 448 1503 0.8000 1.0000 2.0000 0.0000 Constraint 448 1494 0.8000 1.0000 2.0000 0.0000 Constraint 448 1488 0.8000 1.0000 2.0000 0.0000 Constraint 448 1479 0.8000 1.0000 2.0000 0.0000 Constraint 448 1471 0.8000 1.0000 2.0000 0.0000 Constraint 448 1466 0.8000 1.0000 2.0000 0.0000 Constraint 448 1455 0.8000 1.0000 2.0000 0.0000 Constraint 448 1447 0.8000 1.0000 2.0000 0.0000 Constraint 448 1438 0.8000 1.0000 2.0000 0.0000 Constraint 448 1427 0.8000 1.0000 2.0000 0.0000 Constraint 448 1416 0.8000 1.0000 2.0000 0.0000 Constraint 448 1408 0.8000 1.0000 2.0000 0.0000 Constraint 448 1399 0.8000 1.0000 2.0000 0.0000 Constraint 448 1391 0.8000 1.0000 2.0000 0.0000 Constraint 448 1382 0.8000 1.0000 2.0000 0.0000 Constraint 448 1374 0.8000 1.0000 2.0000 0.0000 Constraint 448 1366 0.8000 1.0000 2.0000 0.0000 Constraint 448 1351 0.8000 1.0000 2.0000 0.0000 Constraint 448 1334 0.8000 1.0000 2.0000 0.0000 Constraint 448 1309 0.8000 1.0000 2.0000 0.0000 Constraint 448 1284 0.8000 1.0000 2.0000 0.0000 Constraint 448 1276 0.8000 1.0000 2.0000 0.0000 Constraint 448 1268 0.8000 1.0000 2.0000 0.0000 Constraint 448 1260 0.8000 1.0000 2.0000 0.0000 Constraint 448 1251 0.8000 1.0000 2.0000 0.0000 Constraint 448 1246 0.8000 1.0000 2.0000 0.0000 Constraint 448 1239 0.8000 1.0000 2.0000 0.0000 Constraint 448 1228 0.8000 1.0000 2.0000 0.0000 Constraint 448 1220 0.8000 1.0000 2.0000 0.0000 Constraint 448 1213 0.8000 1.0000 2.0000 0.0000 Constraint 448 1204 0.8000 1.0000 2.0000 0.0000 Constraint 448 1178 0.8000 1.0000 2.0000 0.0000 Constraint 448 1167 0.8000 1.0000 2.0000 0.0000 Constraint 448 1158 0.8000 1.0000 2.0000 0.0000 Constraint 448 1149 0.8000 1.0000 2.0000 0.0000 Constraint 448 1141 0.8000 1.0000 2.0000 0.0000 Constraint 448 1133 0.8000 1.0000 2.0000 0.0000 Constraint 448 1125 0.8000 1.0000 2.0000 0.0000 Constraint 448 1117 0.8000 1.0000 2.0000 0.0000 Constraint 448 1109 0.8000 1.0000 2.0000 0.0000 Constraint 448 1022 0.8000 1.0000 2.0000 0.0000 Constraint 448 1014 0.8000 1.0000 2.0000 0.0000 Constraint 448 930 0.8000 1.0000 2.0000 0.0000 Constraint 448 921 0.8000 1.0000 2.0000 0.0000 Constraint 448 739 0.8000 1.0000 2.0000 0.0000 Constraint 448 713 0.8000 1.0000 2.0000 0.0000 Constraint 448 510 0.8000 1.0000 2.0000 0.0000 Constraint 448 501 0.8000 1.0000 2.0000 0.0000 Constraint 448 493 0.8000 1.0000 2.0000 0.0000 Constraint 448 487 0.8000 1.0000 2.0000 0.0000 Constraint 448 479 0.8000 1.0000 2.0000 0.0000 Constraint 448 466 0.8000 1.0000 2.0000 0.0000 Constraint 448 457 0.8000 1.0000 2.0000 0.0000 Constraint 443 1788 0.8000 1.0000 2.0000 0.0000 Constraint 443 1777 0.8000 1.0000 2.0000 0.0000 Constraint 443 1772 0.8000 1.0000 2.0000 0.0000 Constraint 443 1764 0.8000 1.0000 2.0000 0.0000 Constraint 443 1756 0.8000 1.0000 2.0000 0.0000 Constraint 443 1748 0.8000 1.0000 2.0000 0.0000 Constraint 443 1739 0.8000 1.0000 2.0000 0.0000 Constraint 443 1731 0.8000 1.0000 2.0000 0.0000 Constraint 443 1714 0.8000 1.0000 2.0000 0.0000 Constraint 443 1683 0.8000 1.0000 2.0000 0.0000 Constraint 443 1678 0.8000 1.0000 2.0000 0.0000 Constraint 443 1662 0.8000 1.0000 2.0000 0.0000 Constraint 443 1657 0.8000 1.0000 2.0000 0.0000 Constraint 443 1649 0.8000 1.0000 2.0000 0.0000 Constraint 443 1634 0.8000 1.0000 2.0000 0.0000 Constraint 443 1620 0.8000 1.0000 2.0000 0.0000 Constraint 443 1611 0.8000 1.0000 2.0000 0.0000 Constraint 443 1596 0.8000 1.0000 2.0000 0.0000 Constraint 443 1587 0.8000 1.0000 2.0000 0.0000 Constraint 443 1575 0.8000 1.0000 2.0000 0.0000 Constraint 443 1548 0.8000 1.0000 2.0000 0.0000 Constraint 443 1533 0.8000 1.0000 2.0000 0.0000 Constraint 443 1519 0.8000 1.0000 2.0000 0.0000 Constraint 443 1511 0.8000 1.0000 2.0000 0.0000 Constraint 443 1503 0.8000 1.0000 2.0000 0.0000 Constraint 443 1488 0.8000 1.0000 2.0000 0.0000 Constraint 443 1466 0.8000 1.0000 2.0000 0.0000 Constraint 443 1455 0.8000 1.0000 2.0000 0.0000 Constraint 443 1427 0.8000 1.0000 2.0000 0.0000 Constraint 443 1416 0.8000 1.0000 2.0000 0.0000 Constraint 443 1391 0.8000 1.0000 2.0000 0.0000 Constraint 443 1382 0.8000 1.0000 2.0000 0.0000 Constraint 443 1358 0.8000 1.0000 2.0000 0.0000 Constraint 443 1317 0.8000 1.0000 2.0000 0.0000 Constraint 443 1301 0.8000 1.0000 2.0000 0.0000 Constraint 443 1293 0.8000 1.0000 2.0000 0.0000 Constraint 443 1284 0.8000 1.0000 2.0000 0.0000 Constraint 443 1276 0.8000 1.0000 2.0000 0.0000 Constraint 443 1260 0.8000 1.0000 2.0000 0.0000 Constraint 443 1251 0.8000 1.0000 2.0000 0.0000 Constraint 443 1220 0.8000 1.0000 2.0000 0.0000 Constraint 443 1178 0.8000 1.0000 2.0000 0.0000 Constraint 443 1167 0.8000 1.0000 2.0000 0.0000 Constraint 443 1149 0.8000 1.0000 2.0000 0.0000 Constraint 443 1141 0.8000 1.0000 2.0000 0.0000 Constraint 443 1109 0.8000 1.0000 2.0000 0.0000 Constraint 443 1035 0.8000 1.0000 2.0000 0.0000 Constraint 443 1014 0.8000 1.0000 2.0000 0.0000 Constraint 443 963 0.8000 1.0000 2.0000 0.0000 Constraint 443 930 0.8000 1.0000 2.0000 0.0000 Constraint 443 908 0.8000 1.0000 2.0000 0.0000 Constraint 443 899 0.8000 1.0000 2.0000 0.0000 Constraint 443 876 0.8000 1.0000 2.0000 0.0000 Constraint 443 761 0.8000 1.0000 2.0000 0.0000 Constraint 443 616 0.8000 1.0000 2.0000 0.0000 Constraint 443 501 0.8000 1.0000 2.0000 0.0000 Constraint 443 493 0.8000 1.0000 2.0000 0.0000 Constraint 443 487 0.8000 1.0000 2.0000 0.0000 Constraint 443 479 0.8000 1.0000 2.0000 0.0000 Constraint 443 466 0.8000 1.0000 2.0000 0.0000 Constraint 443 457 0.8000 1.0000 2.0000 0.0000 Constraint 443 448 0.8000 1.0000 2.0000 0.0000 Constraint 435 1788 0.8000 1.0000 2.0000 0.0000 Constraint 435 1777 0.8000 1.0000 2.0000 0.0000 Constraint 435 1772 0.8000 1.0000 2.0000 0.0000 Constraint 435 1764 0.8000 1.0000 2.0000 0.0000 Constraint 435 1756 0.8000 1.0000 2.0000 0.0000 Constraint 435 1748 0.8000 1.0000 2.0000 0.0000 Constraint 435 1739 0.8000 1.0000 2.0000 0.0000 Constraint 435 1720 0.8000 1.0000 2.0000 0.0000 Constraint 435 1714 0.8000 1.0000 2.0000 0.0000 Constraint 435 1692 0.8000 1.0000 2.0000 0.0000 Constraint 435 1683 0.8000 1.0000 2.0000 0.0000 Constraint 435 1649 0.8000 1.0000 2.0000 0.0000 Constraint 435 1620 0.8000 1.0000 2.0000 0.0000 Constraint 435 1611 0.8000 1.0000 2.0000 0.0000 Constraint 435 1603 0.8000 1.0000 2.0000 0.0000 Constraint 435 1596 0.8000 1.0000 2.0000 0.0000 Constraint 435 1587 0.8000 1.0000 2.0000 0.0000 Constraint 435 1575 0.8000 1.0000 2.0000 0.0000 Constraint 435 1567 0.8000 1.0000 2.0000 0.0000 Constraint 435 1556 0.8000 1.0000 2.0000 0.0000 Constraint 435 1548 0.8000 1.0000 2.0000 0.0000 Constraint 435 1541 0.8000 1.0000 2.0000 0.0000 Constraint 435 1533 0.8000 1.0000 2.0000 0.0000 Constraint 435 1526 0.8000 1.0000 2.0000 0.0000 Constraint 435 1519 0.8000 1.0000 2.0000 0.0000 Constraint 435 1511 0.8000 1.0000 2.0000 0.0000 Constraint 435 1503 0.8000 1.0000 2.0000 0.0000 Constraint 435 1488 0.8000 1.0000 2.0000 0.0000 Constraint 435 1479 0.8000 1.0000 2.0000 0.0000 Constraint 435 1471 0.8000 1.0000 2.0000 0.0000 Constraint 435 1466 0.8000 1.0000 2.0000 0.0000 Constraint 435 1455 0.8000 1.0000 2.0000 0.0000 Constraint 435 1447 0.8000 1.0000 2.0000 0.0000 Constraint 435 1438 0.8000 1.0000 2.0000 0.0000 Constraint 435 1427 0.8000 1.0000 2.0000 0.0000 Constraint 435 1416 0.8000 1.0000 2.0000 0.0000 Constraint 435 1408 0.8000 1.0000 2.0000 0.0000 Constraint 435 1399 0.8000 1.0000 2.0000 0.0000 Constraint 435 1391 0.8000 1.0000 2.0000 0.0000 Constraint 435 1382 0.8000 1.0000 2.0000 0.0000 Constraint 435 1374 0.8000 1.0000 2.0000 0.0000 Constraint 435 1366 0.8000 1.0000 2.0000 0.0000 Constraint 435 1358 0.8000 1.0000 2.0000 0.0000 Constraint 435 1351 0.8000 1.0000 2.0000 0.0000 Constraint 435 1343 0.8000 1.0000 2.0000 0.0000 Constraint 435 1334 0.8000 1.0000 2.0000 0.0000 Constraint 435 1325 0.8000 1.0000 2.0000 0.0000 Constraint 435 1317 0.8000 1.0000 2.0000 0.0000 Constraint 435 1309 0.8000 1.0000 2.0000 0.0000 Constraint 435 1301 0.8000 1.0000 2.0000 0.0000 Constraint 435 1293 0.8000 1.0000 2.0000 0.0000 Constraint 435 1284 0.8000 1.0000 2.0000 0.0000 Constraint 435 1276 0.8000 1.0000 2.0000 0.0000 Constraint 435 1268 0.8000 1.0000 2.0000 0.0000 Constraint 435 1260 0.8000 1.0000 2.0000 0.0000 Constraint 435 1251 0.8000 1.0000 2.0000 0.0000 Constraint 435 1220 0.8000 1.0000 2.0000 0.0000 Constraint 435 1178 0.8000 1.0000 2.0000 0.0000 Constraint 435 1158 0.8000 1.0000 2.0000 0.0000 Constraint 435 1149 0.8000 1.0000 2.0000 0.0000 Constraint 435 1141 0.8000 1.0000 2.0000 0.0000 Constraint 435 1133 0.8000 1.0000 2.0000 0.0000 Constraint 435 1125 0.8000 1.0000 2.0000 0.0000 Constraint 435 1100 0.8000 1.0000 2.0000 0.0000 Constraint 435 1092 0.8000 1.0000 2.0000 0.0000 Constraint 435 1059 0.8000 1.0000 2.0000 0.0000 Constraint 435 1054 0.8000 1.0000 2.0000 0.0000 Constraint 435 1022 0.8000 1.0000 2.0000 0.0000 Constraint 435 963 0.8000 1.0000 2.0000 0.0000 Constraint 435 955 0.8000 1.0000 2.0000 0.0000 Constraint 435 913 0.8000 1.0000 2.0000 0.0000 Constraint 435 876 0.8000 1.0000 2.0000 0.0000 Constraint 435 836 0.8000 1.0000 2.0000 0.0000 Constraint 435 761 0.8000 1.0000 2.0000 0.0000 Constraint 435 739 0.8000 1.0000 2.0000 0.0000 Constraint 435 731 0.8000 1.0000 2.0000 0.0000 Constraint 435 681 0.8000 1.0000 2.0000 0.0000 Constraint 435 665 0.8000 1.0000 2.0000 0.0000 Constraint 435 493 0.8000 1.0000 2.0000 0.0000 Constraint 435 487 0.8000 1.0000 2.0000 0.0000 Constraint 435 479 0.8000 1.0000 2.0000 0.0000 Constraint 435 466 0.8000 1.0000 2.0000 0.0000 Constraint 435 457 0.8000 1.0000 2.0000 0.0000 Constraint 435 448 0.8000 1.0000 2.0000 0.0000 Constraint 435 443 0.8000 1.0000 2.0000 0.0000 Constraint 429 1788 0.8000 1.0000 2.0000 0.0000 Constraint 429 1777 0.8000 1.0000 2.0000 0.0000 Constraint 429 1772 0.8000 1.0000 2.0000 0.0000 Constraint 429 1764 0.8000 1.0000 2.0000 0.0000 Constraint 429 1756 0.8000 1.0000 2.0000 0.0000 Constraint 429 1739 0.8000 1.0000 2.0000 0.0000 Constraint 429 1731 0.8000 1.0000 2.0000 0.0000 Constraint 429 1720 0.8000 1.0000 2.0000 0.0000 Constraint 429 1714 0.8000 1.0000 2.0000 0.0000 Constraint 429 1703 0.8000 1.0000 2.0000 0.0000 Constraint 429 1692 0.8000 1.0000 2.0000 0.0000 Constraint 429 1683 0.8000 1.0000 2.0000 0.0000 Constraint 429 1678 0.8000 1.0000 2.0000 0.0000 Constraint 429 1670 0.8000 1.0000 2.0000 0.0000 Constraint 429 1662 0.8000 1.0000 2.0000 0.0000 Constraint 429 1634 0.8000 1.0000 2.0000 0.0000 Constraint 429 1620 0.8000 1.0000 2.0000 0.0000 Constraint 429 1596 0.8000 1.0000 2.0000 0.0000 Constraint 429 1587 0.8000 1.0000 2.0000 0.0000 Constraint 429 1567 0.8000 1.0000 2.0000 0.0000 Constraint 429 1556 0.8000 1.0000 2.0000 0.0000 Constraint 429 1548 0.8000 1.0000 2.0000 0.0000 Constraint 429 1541 0.8000 1.0000 2.0000 0.0000 Constraint 429 1533 0.8000 1.0000 2.0000 0.0000 Constraint 429 1526 0.8000 1.0000 2.0000 0.0000 Constraint 429 1519 0.8000 1.0000 2.0000 0.0000 Constraint 429 1511 0.8000 1.0000 2.0000 0.0000 Constraint 429 1503 0.8000 1.0000 2.0000 0.0000 Constraint 429 1494 0.8000 1.0000 2.0000 0.0000 Constraint 429 1488 0.8000 1.0000 2.0000 0.0000 Constraint 429 1471 0.8000 1.0000 2.0000 0.0000 Constraint 429 1466 0.8000 1.0000 2.0000 0.0000 Constraint 429 1455 0.8000 1.0000 2.0000 0.0000 Constraint 429 1438 0.8000 1.0000 2.0000 0.0000 Constraint 429 1427 0.8000 1.0000 2.0000 0.0000 Constraint 429 1416 0.8000 1.0000 2.0000 0.0000 Constraint 429 1408 0.8000 1.0000 2.0000 0.0000 Constraint 429 1399 0.8000 1.0000 2.0000 0.0000 Constraint 429 1391 0.8000 1.0000 2.0000 0.0000 Constraint 429 1382 0.8000 1.0000 2.0000 0.0000 Constraint 429 1374 0.8000 1.0000 2.0000 0.0000 Constraint 429 1366 0.8000 1.0000 2.0000 0.0000 Constraint 429 1351 0.8000 1.0000 2.0000 0.0000 Constraint 429 1343 0.8000 1.0000 2.0000 0.0000 Constraint 429 1334 0.8000 1.0000 2.0000 0.0000 Constraint 429 1317 0.8000 1.0000 2.0000 0.0000 Constraint 429 1309 0.8000 1.0000 2.0000 0.0000 Constraint 429 1301 0.8000 1.0000 2.0000 0.0000 Constraint 429 1293 0.8000 1.0000 2.0000 0.0000 Constraint 429 1284 0.8000 1.0000 2.0000 0.0000 Constraint 429 1276 0.8000 1.0000 2.0000 0.0000 Constraint 429 1268 0.8000 1.0000 2.0000 0.0000 Constraint 429 1260 0.8000 1.0000 2.0000 0.0000 Constraint 429 1246 0.8000 1.0000 2.0000 0.0000 Constraint 429 1239 0.8000 1.0000 2.0000 0.0000 Constraint 429 1220 0.8000 1.0000 2.0000 0.0000 Constraint 429 1204 0.8000 1.0000 2.0000 0.0000 Constraint 429 1193 0.8000 1.0000 2.0000 0.0000 Constraint 429 1178 0.8000 1.0000 2.0000 0.0000 Constraint 429 1167 0.8000 1.0000 2.0000 0.0000 Constraint 429 1158 0.8000 1.0000 2.0000 0.0000 Constraint 429 1149 0.8000 1.0000 2.0000 0.0000 Constraint 429 1141 0.8000 1.0000 2.0000 0.0000 Constraint 429 1133 0.8000 1.0000 2.0000 0.0000 Constraint 429 1125 0.8000 1.0000 2.0000 0.0000 Constraint 429 1117 0.8000 1.0000 2.0000 0.0000 Constraint 429 1109 0.8000 1.0000 2.0000 0.0000 Constraint 429 1100 0.8000 1.0000 2.0000 0.0000 Constraint 429 1092 0.8000 1.0000 2.0000 0.0000 Constraint 429 1084 0.8000 1.0000 2.0000 0.0000 Constraint 429 1068 0.8000 1.0000 2.0000 0.0000 Constraint 429 1059 0.8000 1.0000 2.0000 0.0000 Constraint 429 1054 0.8000 1.0000 2.0000 0.0000 Constraint 429 1022 0.8000 1.0000 2.0000 0.0000 Constraint 429 988 0.8000 1.0000 2.0000 0.0000 Constraint 429 955 0.8000 1.0000 2.0000 0.0000 Constraint 429 944 0.8000 1.0000 2.0000 0.0000 Constraint 429 930 0.8000 1.0000 2.0000 0.0000 Constraint 429 876 0.8000 1.0000 2.0000 0.0000 Constraint 429 487 0.8000 1.0000 2.0000 0.0000 Constraint 429 479 0.8000 1.0000 2.0000 0.0000 Constraint 429 466 0.8000 1.0000 2.0000 0.0000 Constraint 429 457 0.8000 1.0000 2.0000 0.0000 Constraint 429 448 0.8000 1.0000 2.0000 0.0000 Constraint 429 443 0.8000 1.0000 2.0000 0.0000 Constraint 429 435 0.8000 1.0000 2.0000 0.0000 Constraint 421 1788 0.8000 1.0000 2.0000 0.0000 Constraint 421 1772 0.8000 1.0000 2.0000 0.0000 Constraint 421 1764 0.8000 1.0000 2.0000 0.0000 Constraint 421 1756 0.8000 1.0000 2.0000 0.0000 Constraint 421 1748 0.8000 1.0000 2.0000 0.0000 Constraint 421 1739 0.8000 1.0000 2.0000 0.0000 Constraint 421 1714 0.8000 1.0000 2.0000 0.0000 Constraint 421 1692 0.8000 1.0000 2.0000 0.0000 Constraint 421 1683 0.8000 1.0000 2.0000 0.0000 Constraint 421 1678 0.8000 1.0000 2.0000 0.0000 Constraint 421 1670 0.8000 1.0000 2.0000 0.0000 Constraint 421 1662 0.8000 1.0000 2.0000 0.0000 Constraint 421 1649 0.8000 1.0000 2.0000 0.0000 Constraint 421 1634 0.8000 1.0000 2.0000 0.0000 Constraint 421 1567 0.8000 1.0000 2.0000 0.0000 Constraint 421 1541 0.8000 1.0000 2.0000 0.0000 Constraint 421 1526 0.8000 1.0000 2.0000 0.0000 Constraint 421 1519 0.8000 1.0000 2.0000 0.0000 Constraint 421 1488 0.8000 1.0000 2.0000 0.0000 Constraint 421 1471 0.8000 1.0000 2.0000 0.0000 Constraint 421 1466 0.8000 1.0000 2.0000 0.0000 Constraint 421 1455 0.8000 1.0000 2.0000 0.0000 Constraint 421 1438 0.8000 1.0000 2.0000 0.0000 Constraint 421 1427 0.8000 1.0000 2.0000 0.0000 Constraint 421 1416 0.8000 1.0000 2.0000 0.0000 Constraint 421 1399 0.8000 1.0000 2.0000 0.0000 Constraint 421 1391 0.8000 1.0000 2.0000 0.0000 Constraint 421 1374 0.8000 1.0000 2.0000 0.0000 Constraint 421 1343 0.8000 1.0000 2.0000 0.0000 Constraint 421 1334 0.8000 1.0000 2.0000 0.0000 Constraint 421 1317 0.8000 1.0000 2.0000 0.0000 Constraint 421 1309 0.8000 1.0000 2.0000 0.0000 Constraint 421 1301 0.8000 1.0000 2.0000 0.0000 Constraint 421 1293 0.8000 1.0000 2.0000 0.0000 Constraint 421 1284 0.8000 1.0000 2.0000 0.0000 Constraint 421 1276 0.8000 1.0000 2.0000 0.0000 Constraint 421 1260 0.8000 1.0000 2.0000 0.0000 Constraint 421 1251 0.8000 1.0000 2.0000 0.0000 Constraint 421 1246 0.8000 1.0000 2.0000 0.0000 Constraint 421 1239 0.8000 1.0000 2.0000 0.0000 Constraint 421 1220 0.8000 1.0000 2.0000 0.0000 Constraint 421 1213 0.8000 1.0000 2.0000 0.0000 Constraint 421 1204 0.8000 1.0000 2.0000 0.0000 Constraint 421 1193 0.8000 1.0000 2.0000 0.0000 Constraint 421 1178 0.8000 1.0000 2.0000 0.0000 Constraint 421 1167 0.8000 1.0000 2.0000 0.0000 Constraint 421 1149 0.8000 1.0000 2.0000 0.0000 Constraint 421 1117 0.8000 1.0000 2.0000 0.0000 Constraint 421 1077 0.8000 1.0000 2.0000 0.0000 Constraint 421 1068 0.8000 1.0000 2.0000 0.0000 Constraint 421 1046 0.8000 1.0000 2.0000 0.0000 Constraint 421 1022 0.8000 1.0000 2.0000 0.0000 Constraint 421 1014 0.8000 1.0000 2.0000 0.0000 Constraint 421 955 0.8000 1.0000 2.0000 0.0000 Constraint 421 930 0.8000 1.0000 2.0000 0.0000 Constraint 421 908 0.8000 1.0000 2.0000 0.0000 Constraint 421 792 0.8000 1.0000 2.0000 0.0000 Constraint 421 761 0.8000 1.0000 2.0000 0.0000 Constraint 421 706 0.8000 1.0000 2.0000 0.0000 Constraint 421 673 0.8000 1.0000 2.0000 0.0000 Constraint 421 616 0.8000 1.0000 2.0000 0.0000 Constraint 421 479 0.8000 1.0000 2.0000 0.0000 Constraint 421 466 0.8000 1.0000 2.0000 0.0000 Constraint 421 457 0.8000 1.0000 2.0000 0.0000 Constraint 421 448 0.8000 1.0000 2.0000 0.0000 Constraint 421 443 0.8000 1.0000 2.0000 0.0000 Constraint 421 435 0.8000 1.0000 2.0000 0.0000 Constraint 421 429 0.8000 1.0000 2.0000 0.0000 Constraint 412 1764 0.8000 1.0000 2.0000 0.0000 Constraint 412 1756 0.8000 1.0000 2.0000 0.0000 Constraint 412 1739 0.8000 1.0000 2.0000 0.0000 Constraint 412 1731 0.8000 1.0000 2.0000 0.0000 Constraint 412 1714 0.8000 1.0000 2.0000 0.0000 Constraint 412 1703 0.8000 1.0000 2.0000 0.0000 Constraint 412 1692 0.8000 1.0000 2.0000 0.0000 Constraint 412 1683 0.8000 1.0000 2.0000 0.0000 Constraint 412 1662 0.8000 1.0000 2.0000 0.0000 Constraint 412 1657 0.8000 1.0000 2.0000 0.0000 Constraint 412 1634 0.8000 1.0000 2.0000 0.0000 Constraint 412 1620 0.8000 1.0000 2.0000 0.0000 Constraint 412 1611 0.8000 1.0000 2.0000 0.0000 Constraint 412 1603 0.8000 1.0000 2.0000 0.0000 Constraint 412 1596 0.8000 1.0000 2.0000 0.0000 Constraint 412 1587 0.8000 1.0000 2.0000 0.0000 Constraint 412 1575 0.8000 1.0000 2.0000 0.0000 Constraint 412 1567 0.8000 1.0000 2.0000 0.0000 Constraint 412 1556 0.8000 1.0000 2.0000 0.0000 Constraint 412 1548 0.8000 1.0000 2.0000 0.0000 Constraint 412 1526 0.8000 1.0000 2.0000 0.0000 Constraint 412 1519 0.8000 1.0000 2.0000 0.0000 Constraint 412 1488 0.8000 1.0000 2.0000 0.0000 Constraint 412 1427 0.8000 1.0000 2.0000 0.0000 Constraint 412 1416 0.8000 1.0000 2.0000 0.0000 Constraint 412 1391 0.8000 1.0000 2.0000 0.0000 Constraint 412 1358 0.8000 1.0000 2.0000 0.0000 Constraint 412 1351 0.8000 1.0000 2.0000 0.0000 Constraint 412 1343 0.8000 1.0000 2.0000 0.0000 Constraint 412 1325 0.8000 1.0000 2.0000 0.0000 Constraint 412 1317 0.8000 1.0000 2.0000 0.0000 Constraint 412 1309 0.8000 1.0000 2.0000 0.0000 Constraint 412 1293 0.8000 1.0000 2.0000 0.0000 Constraint 412 1284 0.8000 1.0000 2.0000 0.0000 Constraint 412 1276 0.8000 1.0000 2.0000 0.0000 Constraint 412 1251 0.8000 1.0000 2.0000 0.0000 Constraint 412 1246 0.8000 1.0000 2.0000 0.0000 Constraint 412 1213 0.8000 1.0000 2.0000 0.0000 Constraint 412 1178 0.8000 1.0000 2.0000 0.0000 Constraint 412 1149 0.8000 1.0000 2.0000 0.0000 Constraint 412 1059 0.8000 1.0000 2.0000 0.0000 Constraint 412 1054 0.8000 1.0000 2.0000 0.0000 Constraint 412 1035 0.8000 1.0000 2.0000 0.0000 Constraint 412 1022 0.8000 1.0000 2.0000 0.0000 Constraint 412 997 0.8000 1.0000 2.0000 0.0000 Constraint 412 963 0.8000 1.0000 2.0000 0.0000 Constraint 412 930 0.8000 1.0000 2.0000 0.0000 Constraint 412 913 0.8000 1.0000 2.0000 0.0000 Constraint 412 908 0.8000 1.0000 2.0000 0.0000 Constraint 412 899 0.8000 1.0000 2.0000 0.0000 Constraint 412 892 0.8000 1.0000 2.0000 0.0000 Constraint 412 884 0.8000 1.0000 2.0000 0.0000 Constraint 412 868 0.8000 1.0000 2.0000 0.0000 Constraint 412 859 0.8000 1.0000 2.0000 0.0000 Constraint 412 836 0.8000 1.0000 2.0000 0.0000 Constraint 412 706 0.8000 1.0000 2.0000 0.0000 Constraint 412 698 0.8000 1.0000 2.0000 0.0000 Constraint 412 650 0.8000 1.0000 2.0000 0.0000 Constraint 412 630 0.8000 1.0000 2.0000 0.0000 Constraint 412 597 0.8000 1.0000 2.0000 0.0000 Constraint 412 466 0.8000 1.0000 2.0000 0.0000 Constraint 412 457 0.8000 1.0000 2.0000 0.0000 Constraint 412 448 0.8000 1.0000 2.0000 0.0000 Constraint 412 443 0.8000 1.0000 2.0000 0.0000 Constraint 412 435 0.8000 1.0000 2.0000 0.0000 Constraint 412 429 0.8000 1.0000 2.0000 0.0000 Constraint 412 421 0.8000 1.0000 2.0000 0.0000 Constraint 403 1788 0.8000 1.0000 2.0000 0.0000 Constraint 403 1777 0.8000 1.0000 2.0000 0.0000 Constraint 403 1772 0.8000 1.0000 2.0000 0.0000 Constraint 403 1764 0.8000 1.0000 2.0000 0.0000 Constraint 403 1756 0.8000 1.0000 2.0000 0.0000 Constraint 403 1748 0.8000 1.0000 2.0000 0.0000 Constraint 403 1739 0.8000 1.0000 2.0000 0.0000 Constraint 403 1731 0.8000 1.0000 2.0000 0.0000 Constraint 403 1720 0.8000 1.0000 2.0000 0.0000 Constraint 403 1714 0.8000 1.0000 2.0000 0.0000 Constraint 403 1703 0.8000 1.0000 2.0000 0.0000 Constraint 403 1692 0.8000 1.0000 2.0000 0.0000 Constraint 403 1683 0.8000 1.0000 2.0000 0.0000 Constraint 403 1670 0.8000 1.0000 2.0000 0.0000 Constraint 403 1662 0.8000 1.0000 2.0000 0.0000 Constraint 403 1620 0.8000 1.0000 2.0000 0.0000 Constraint 403 1611 0.8000 1.0000 2.0000 0.0000 Constraint 403 1603 0.8000 1.0000 2.0000 0.0000 Constraint 403 1596 0.8000 1.0000 2.0000 0.0000 Constraint 403 1575 0.8000 1.0000 2.0000 0.0000 Constraint 403 1567 0.8000 1.0000 2.0000 0.0000 Constraint 403 1556 0.8000 1.0000 2.0000 0.0000 Constraint 403 1548 0.8000 1.0000 2.0000 0.0000 Constraint 403 1526 0.8000 1.0000 2.0000 0.0000 Constraint 403 1519 0.8000 1.0000 2.0000 0.0000 Constraint 403 1503 0.8000 1.0000 2.0000 0.0000 Constraint 403 1494 0.8000 1.0000 2.0000 0.0000 Constraint 403 1488 0.8000 1.0000 2.0000 0.0000 Constraint 403 1455 0.8000 1.0000 2.0000 0.0000 Constraint 403 1447 0.8000 1.0000 2.0000 0.0000 Constraint 403 1438 0.8000 1.0000 2.0000 0.0000 Constraint 403 1427 0.8000 1.0000 2.0000 0.0000 Constraint 403 1416 0.8000 1.0000 2.0000 0.0000 Constraint 403 1408 0.8000 1.0000 2.0000 0.0000 Constraint 403 1399 0.8000 1.0000 2.0000 0.0000 Constraint 403 1382 0.8000 1.0000 2.0000 0.0000 Constraint 403 1351 0.8000 1.0000 2.0000 0.0000 Constraint 403 1334 0.8000 1.0000 2.0000 0.0000 Constraint 403 1325 0.8000 1.0000 2.0000 0.0000 Constraint 403 1317 0.8000 1.0000 2.0000 0.0000 Constraint 403 1293 0.8000 1.0000 2.0000 0.0000 Constraint 403 1276 0.8000 1.0000 2.0000 0.0000 Constraint 403 1268 0.8000 1.0000 2.0000 0.0000 Constraint 403 1260 0.8000 1.0000 2.0000 0.0000 Constraint 403 1251 0.8000 1.0000 2.0000 0.0000 Constraint 403 1246 0.8000 1.0000 2.0000 0.0000 Constraint 403 1239 0.8000 1.0000 2.0000 0.0000 Constraint 403 1220 0.8000 1.0000 2.0000 0.0000 Constraint 403 1213 0.8000 1.0000 2.0000 0.0000 Constraint 403 1204 0.8000 1.0000 2.0000 0.0000 Constraint 403 1158 0.8000 1.0000 2.0000 0.0000 Constraint 403 1133 0.8000 1.0000 2.0000 0.0000 Constraint 403 1109 0.8000 1.0000 2.0000 0.0000 Constraint 403 1100 0.8000 1.0000 2.0000 0.0000 Constraint 403 1092 0.8000 1.0000 2.0000 0.0000 Constraint 403 1022 0.8000 1.0000 2.0000 0.0000 Constraint 403 944 0.8000 1.0000 2.0000 0.0000 Constraint 403 876 0.8000 1.0000 2.0000 0.0000 Constraint 403 859 0.8000 1.0000 2.0000 0.0000 Constraint 403 848 0.8000 1.0000 2.0000 0.0000 Constraint 403 706 0.8000 1.0000 2.0000 0.0000 Constraint 403 623 0.8000 1.0000 2.0000 0.0000 Constraint 403 616 0.8000 1.0000 2.0000 0.0000 Constraint 403 579 0.8000 1.0000 2.0000 0.0000 Constraint 403 487 0.8000 1.0000 2.0000 0.0000 Constraint 403 466 0.8000 1.0000 2.0000 0.0000 Constraint 403 457 0.8000 1.0000 2.0000 0.0000 Constraint 403 448 0.8000 1.0000 2.0000 0.0000 Constraint 403 443 0.8000 1.0000 2.0000 0.0000 Constraint 403 435 0.8000 1.0000 2.0000 0.0000 Constraint 403 429 0.8000 1.0000 2.0000 0.0000 Constraint 403 421 0.8000 1.0000 2.0000 0.0000 Constraint 403 412 0.8000 1.0000 2.0000 0.0000 Constraint 392 1788 0.8000 1.0000 2.0000 0.0000 Constraint 392 1777 0.8000 1.0000 2.0000 0.0000 Constraint 392 1772 0.8000 1.0000 2.0000 0.0000 Constraint 392 1764 0.8000 1.0000 2.0000 0.0000 Constraint 392 1756 0.8000 1.0000 2.0000 0.0000 Constraint 392 1748 0.8000 1.0000 2.0000 0.0000 Constraint 392 1731 0.8000 1.0000 2.0000 0.0000 Constraint 392 1720 0.8000 1.0000 2.0000 0.0000 Constraint 392 1703 0.8000 1.0000 2.0000 0.0000 Constraint 392 1678 0.8000 1.0000 2.0000 0.0000 Constraint 392 1670 0.8000 1.0000 2.0000 0.0000 Constraint 392 1662 0.8000 1.0000 2.0000 0.0000 Constraint 392 1567 0.8000 1.0000 2.0000 0.0000 Constraint 392 1556 0.8000 1.0000 2.0000 0.0000 Constraint 392 1533 0.8000 1.0000 2.0000 0.0000 Constraint 392 1503 0.8000 1.0000 2.0000 0.0000 Constraint 392 1488 0.8000 1.0000 2.0000 0.0000 Constraint 392 1479 0.8000 1.0000 2.0000 0.0000 Constraint 392 1455 0.8000 1.0000 2.0000 0.0000 Constraint 392 1447 0.8000 1.0000 2.0000 0.0000 Constraint 392 1408 0.8000 1.0000 2.0000 0.0000 Constraint 392 1366 0.8000 1.0000 2.0000 0.0000 Constraint 392 1351 0.8000 1.0000 2.0000 0.0000 Constraint 392 1334 0.8000 1.0000 2.0000 0.0000 Constraint 392 1325 0.8000 1.0000 2.0000 0.0000 Constraint 392 1317 0.8000 1.0000 2.0000 0.0000 Constraint 392 1293 0.8000 1.0000 2.0000 0.0000 Constraint 392 1284 0.8000 1.0000 2.0000 0.0000 Constraint 392 1276 0.8000 1.0000 2.0000 0.0000 Constraint 392 1268 0.8000 1.0000 2.0000 0.0000 Constraint 392 1260 0.8000 1.0000 2.0000 0.0000 Constraint 392 1251 0.8000 1.0000 2.0000 0.0000 Constraint 392 1246 0.8000 1.0000 2.0000 0.0000 Constraint 392 1239 0.8000 1.0000 2.0000 0.0000 Constraint 392 1228 0.8000 1.0000 2.0000 0.0000 Constraint 392 1213 0.8000 1.0000 2.0000 0.0000 Constraint 392 1178 0.8000 1.0000 2.0000 0.0000 Constraint 392 1149 0.8000 1.0000 2.0000 0.0000 Constraint 392 1125 0.8000 1.0000 2.0000 0.0000 Constraint 392 1100 0.8000 1.0000 2.0000 0.0000 Constraint 392 1077 0.8000 1.0000 2.0000 0.0000 Constraint 392 1068 0.8000 1.0000 2.0000 0.0000 Constraint 392 1059 0.8000 1.0000 2.0000 0.0000 Constraint 392 1054 0.8000 1.0000 2.0000 0.0000 Constraint 392 1022 0.8000 1.0000 2.0000 0.0000 Constraint 392 988 0.8000 1.0000 2.0000 0.0000 Constraint 392 980 0.8000 1.0000 2.0000 0.0000 Constraint 392 955 0.8000 1.0000 2.0000 0.0000 Constraint 392 921 0.8000 1.0000 2.0000 0.0000 Constraint 392 899 0.8000 1.0000 2.0000 0.0000 Constraint 392 892 0.8000 1.0000 2.0000 0.0000 Constraint 392 457 0.8000 1.0000 2.0000 0.0000 Constraint 392 448 0.8000 1.0000 2.0000 0.0000 Constraint 392 443 0.8000 1.0000 2.0000 0.0000 Constraint 392 435 0.8000 1.0000 2.0000 0.0000 Constraint 392 429 0.8000 1.0000 2.0000 0.0000 Constraint 392 421 0.8000 1.0000 2.0000 0.0000 Constraint 392 412 0.8000 1.0000 2.0000 0.0000 Constraint 392 403 0.8000 1.0000 2.0000 0.0000 Constraint 384 1756 0.8000 1.0000 2.0000 0.0000 Constraint 384 1748 0.8000 1.0000 2.0000 0.0000 Constraint 384 1731 0.8000 1.0000 2.0000 0.0000 Constraint 384 1720 0.8000 1.0000 2.0000 0.0000 Constraint 384 1703 0.8000 1.0000 2.0000 0.0000 Constraint 384 1683 0.8000 1.0000 2.0000 0.0000 Constraint 384 1678 0.8000 1.0000 2.0000 0.0000 Constraint 384 1670 0.8000 1.0000 2.0000 0.0000 Constraint 384 1662 0.8000 1.0000 2.0000 0.0000 Constraint 384 1657 0.8000 1.0000 2.0000 0.0000 Constraint 384 1649 0.8000 1.0000 2.0000 0.0000 Constraint 384 1620 0.8000 1.0000 2.0000 0.0000 Constraint 384 1611 0.8000 1.0000 2.0000 0.0000 Constraint 384 1603 0.8000 1.0000 2.0000 0.0000 Constraint 384 1556 0.8000 1.0000 2.0000 0.0000 Constraint 384 1548 0.8000 1.0000 2.0000 0.0000 Constraint 384 1533 0.8000 1.0000 2.0000 0.0000 Constraint 384 1526 0.8000 1.0000 2.0000 0.0000 Constraint 384 1494 0.8000 1.0000 2.0000 0.0000 Constraint 384 1488 0.8000 1.0000 2.0000 0.0000 Constraint 384 1471 0.8000 1.0000 2.0000 0.0000 Constraint 384 1427 0.8000 1.0000 2.0000 0.0000 Constraint 384 1408 0.8000 1.0000 2.0000 0.0000 Constraint 384 1391 0.8000 1.0000 2.0000 0.0000 Constraint 384 1382 0.8000 1.0000 2.0000 0.0000 Constraint 384 1358 0.8000 1.0000 2.0000 0.0000 Constraint 384 1351 0.8000 1.0000 2.0000 0.0000 Constraint 384 1334 0.8000 1.0000 2.0000 0.0000 Constraint 384 1325 0.8000 1.0000 2.0000 0.0000 Constraint 384 1317 0.8000 1.0000 2.0000 0.0000 Constraint 384 1301 0.8000 1.0000 2.0000 0.0000 Constraint 384 1284 0.8000 1.0000 2.0000 0.0000 Constraint 384 1276 0.8000 1.0000 2.0000 0.0000 Constraint 384 1268 0.8000 1.0000 2.0000 0.0000 Constraint 384 1260 0.8000 1.0000 2.0000 0.0000 Constraint 384 1239 0.8000 1.0000 2.0000 0.0000 Constraint 384 1213 0.8000 1.0000 2.0000 0.0000 Constraint 384 1204 0.8000 1.0000 2.0000 0.0000 Constraint 384 1193 0.8000 1.0000 2.0000 0.0000 Constraint 384 1178 0.8000 1.0000 2.0000 0.0000 Constraint 384 1149 0.8000 1.0000 2.0000 0.0000 Constraint 384 1092 0.8000 1.0000 2.0000 0.0000 Constraint 384 1084 0.8000 1.0000 2.0000 0.0000 Constraint 384 1068 0.8000 1.0000 2.0000 0.0000 Constraint 384 1059 0.8000 1.0000 2.0000 0.0000 Constraint 384 1046 0.8000 1.0000 2.0000 0.0000 Constraint 384 1022 0.8000 1.0000 2.0000 0.0000 Constraint 384 997 0.8000 1.0000 2.0000 0.0000 Constraint 384 988 0.8000 1.0000 2.0000 0.0000 Constraint 384 963 0.8000 1.0000 2.0000 0.0000 Constraint 384 930 0.8000 1.0000 2.0000 0.0000 Constraint 384 921 0.8000 1.0000 2.0000 0.0000 Constraint 384 859 0.8000 1.0000 2.0000 0.0000 Constraint 384 448 0.8000 1.0000 2.0000 0.0000 Constraint 384 443 0.8000 1.0000 2.0000 0.0000 Constraint 384 435 0.8000 1.0000 2.0000 0.0000 Constraint 384 429 0.8000 1.0000 2.0000 0.0000 Constraint 384 421 0.8000 1.0000 2.0000 0.0000 Constraint 384 412 0.8000 1.0000 2.0000 0.0000 Constraint 384 403 0.8000 1.0000 2.0000 0.0000 Constraint 384 392 0.8000 1.0000 2.0000 0.0000 Constraint 375 1777 0.8000 1.0000 2.0000 0.0000 Constraint 375 1764 0.8000 1.0000 2.0000 0.0000 Constraint 375 1756 0.8000 1.0000 2.0000 0.0000 Constraint 375 1748 0.8000 1.0000 2.0000 0.0000 Constraint 375 1739 0.8000 1.0000 2.0000 0.0000 Constraint 375 1731 0.8000 1.0000 2.0000 0.0000 Constraint 375 1720 0.8000 1.0000 2.0000 0.0000 Constraint 375 1714 0.8000 1.0000 2.0000 0.0000 Constraint 375 1703 0.8000 1.0000 2.0000 0.0000 Constraint 375 1692 0.8000 1.0000 2.0000 0.0000 Constraint 375 1683 0.8000 1.0000 2.0000 0.0000 Constraint 375 1678 0.8000 1.0000 2.0000 0.0000 Constraint 375 1670 0.8000 1.0000 2.0000 0.0000 Constraint 375 1662 0.8000 1.0000 2.0000 0.0000 Constraint 375 1657 0.8000 1.0000 2.0000 0.0000 Constraint 375 1649 0.8000 1.0000 2.0000 0.0000 Constraint 375 1620 0.8000 1.0000 2.0000 0.0000 Constraint 375 1611 0.8000 1.0000 2.0000 0.0000 Constraint 375 1603 0.8000 1.0000 2.0000 0.0000 Constraint 375 1596 0.8000 1.0000 2.0000 0.0000 Constraint 375 1587 0.8000 1.0000 2.0000 0.0000 Constraint 375 1575 0.8000 1.0000 2.0000 0.0000 Constraint 375 1556 0.8000 1.0000 2.0000 0.0000 Constraint 375 1541 0.8000 1.0000 2.0000 0.0000 Constraint 375 1533 0.8000 1.0000 2.0000 0.0000 Constraint 375 1526 0.8000 1.0000 2.0000 0.0000 Constraint 375 1471 0.8000 1.0000 2.0000 0.0000 Constraint 375 1466 0.8000 1.0000 2.0000 0.0000 Constraint 375 1455 0.8000 1.0000 2.0000 0.0000 Constraint 375 1427 0.8000 1.0000 2.0000 0.0000 Constraint 375 1416 0.8000 1.0000 2.0000 0.0000 Constraint 375 1391 0.8000 1.0000 2.0000 0.0000 Constraint 375 1382 0.8000 1.0000 2.0000 0.0000 Constraint 375 1366 0.8000 1.0000 2.0000 0.0000 Constraint 375 1358 0.8000 1.0000 2.0000 0.0000 Constraint 375 1351 0.8000 1.0000 2.0000 0.0000 Constraint 375 1325 0.8000 1.0000 2.0000 0.0000 Constraint 375 1317 0.8000 1.0000 2.0000 0.0000 Constraint 375 1301 0.8000 1.0000 2.0000 0.0000 Constraint 375 1293 0.8000 1.0000 2.0000 0.0000 Constraint 375 1284 0.8000 1.0000 2.0000 0.0000 Constraint 375 1276 0.8000 1.0000 2.0000 0.0000 Constraint 375 1268 0.8000 1.0000 2.0000 0.0000 Constraint 375 1260 0.8000 1.0000 2.0000 0.0000 Constraint 375 1246 0.8000 1.0000 2.0000 0.0000 Constraint 375 1239 0.8000 1.0000 2.0000 0.0000 Constraint 375 1220 0.8000 1.0000 2.0000 0.0000 Constraint 375 1213 0.8000 1.0000 2.0000 0.0000 Constraint 375 1204 0.8000 1.0000 2.0000 0.0000 Constraint 375 1193 0.8000 1.0000 2.0000 0.0000 Constraint 375 1178 0.8000 1.0000 2.0000 0.0000 Constraint 375 1167 0.8000 1.0000 2.0000 0.0000 Constraint 375 1158 0.8000 1.0000 2.0000 0.0000 Constraint 375 1100 0.8000 1.0000 2.0000 0.0000 Constraint 375 1092 0.8000 1.0000 2.0000 0.0000 Constraint 375 1084 0.8000 1.0000 2.0000 0.0000 Constraint 375 1077 0.8000 1.0000 2.0000 0.0000 Constraint 375 1059 0.8000 1.0000 2.0000 0.0000 Constraint 375 1022 0.8000 1.0000 2.0000 0.0000 Constraint 375 1014 0.8000 1.0000 2.0000 0.0000 Constraint 375 997 0.8000 1.0000 2.0000 0.0000 Constraint 375 892 0.8000 1.0000 2.0000 0.0000 Constraint 375 884 0.8000 1.0000 2.0000 0.0000 Constraint 375 848 0.8000 1.0000 2.0000 0.0000 Constraint 375 829 0.8000 1.0000 2.0000 0.0000 Constraint 375 650 0.8000 1.0000 2.0000 0.0000 Constraint 375 538 0.8000 1.0000 2.0000 0.0000 Constraint 375 501 0.8000 1.0000 2.0000 0.0000 Constraint 375 487 0.8000 1.0000 2.0000 0.0000 Constraint 375 479 0.8000 1.0000 2.0000 0.0000 Constraint 375 457 0.8000 1.0000 2.0000 0.0000 Constraint 375 448 0.8000 1.0000 2.0000 0.0000 Constraint 375 443 0.8000 1.0000 2.0000 0.0000 Constraint 375 435 0.8000 1.0000 2.0000 0.0000 Constraint 375 429 0.8000 1.0000 2.0000 0.0000 Constraint 375 421 0.8000 1.0000 2.0000 0.0000 Constraint 375 412 0.8000 1.0000 2.0000 0.0000 Constraint 375 403 0.8000 1.0000 2.0000 0.0000 Constraint 375 392 0.8000 1.0000 2.0000 0.0000 Constraint 375 384 0.8000 1.0000 2.0000 0.0000 Constraint 368 1788 0.8000 1.0000 2.0000 0.0000 Constraint 368 1772 0.8000 1.0000 2.0000 0.0000 Constraint 368 1764 0.8000 1.0000 2.0000 0.0000 Constraint 368 1756 0.8000 1.0000 2.0000 0.0000 Constraint 368 1748 0.8000 1.0000 2.0000 0.0000 Constraint 368 1670 0.8000 1.0000 2.0000 0.0000 Constraint 368 1657 0.8000 1.0000 2.0000 0.0000 Constraint 368 1634 0.8000 1.0000 2.0000 0.0000 Constraint 368 1620 0.8000 1.0000 2.0000 0.0000 Constraint 368 1611 0.8000 1.0000 2.0000 0.0000 Constraint 368 1575 0.8000 1.0000 2.0000 0.0000 Constraint 368 1567 0.8000 1.0000 2.0000 0.0000 Constraint 368 1556 0.8000 1.0000 2.0000 0.0000 Constraint 368 1533 0.8000 1.0000 2.0000 0.0000 Constraint 368 1526 0.8000 1.0000 2.0000 0.0000 Constraint 368 1511 0.8000 1.0000 2.0000 0.0000 Constraint 368 1471 0.8000 1.0000 2.0000 0.0000 Constraint 368 1466 0.8000 1.0000 2.0000 0.0000 Constraint 368 1455 0.8000 1.0000 2.0000 0.0000 Constraint 368 1447 0.8000 1.0000 2.0000 0.0000 Constraint 368 1427 0.8000 1.0000 2.0000 0.0000 Constraint 368 1408 0.8000 1.0000 2.0000 0.0000 Constraint 368 1391 0.8000 1.0000 2.0000 0.0000 Constraint 368 1382 0.8000 1.0000 2.0000 0.0000 Constraint 368 1374 0.8000 1.0000 2.0000 0.0000 Constraint 368 1366 0.8000 1.0000 2.0000 0.0000 Constraint 368 1358 0.8000 1.0000 2.0000 0.0000 Constraint 368 1351 0.8000 1.0000 2.0000 0.0000 Constraint 368 1334 0.8000 1.0000 2.0000 0.0000 Constraint 368 1325 0.8000 1.0000 2.0000 0.0000 Constraint 368 1317 0.8000 1.0000 2.0000 0.0000 Constraint 368 1309 0.8000 1.0000 2.0000 0.0000 Constraint 368 1301 0.8000 1.0000 2.0000 0.0000 Constraint 368 1293 0.8000 1.0000 2.0000 0.0000 Constraint 368 1284 0.8000 1.0000 2.0000 0.0000 Constraint 368 1276 0.8000 1.0000 2.0000 0.0000 Constraint 368 1268 0.8000 1.0000 2.0000 0.0000 Constraint 368 1260 0.8000 1.0000 2.0000 0.0000 Constraint 368 1251 0.8000 1.0000 2.0000 0.0000 Constraint 368 1246 0.8000 1.0000 2.0000 0.0000 Constraint 368 1228 0.8000 1.0000 2.0000 0.0000 Constraint 368 1213 0.8000 1.0000 2.0000 0.0000 Constraint 368 1193 0.8000 1.0000 2.0000 0.0000 Constraint 368 1158 0.8000 1.0000 2.0000 0.0000 Constraint 368 1133 0.8000 1.0000 2.0000 0.0000 Constraint 368 1125 0.8000 1.0000 2.0000 0.0000 Constraint 368 1109 0.8000 1.0000 2.0000 0.0000 Constraint 368 1100 0.8000 1.0000 2.0000 0.0000 Constraint 368 1092 0.8000 1.0000 2.0000 0.0000 Constraint 368 1084 0.8000 1.0000 2.0000 0.0000 Constraint 368 1077 0.8000 1.0000 2.0000 0.0000 Constraint 368 1059 0.8000 1.0000 2.0000 0.0000 Constraint 368 1046 0.8000 1.0000 2.0000 0.0000 Constraint 368 1022 0.8000 1.0000 2.0000 0.0000 Constraint 368 997 0.8000 1.0000 2.0000 0.0000 Constraint 368 988 0.8000 1.0000 2.0000 0.0000 Constraint 368 963 0.8000 1.0000 2.0000 0.0000 Constraint 368 955 0.8000 1.0000 2.0000 0.0000 Constraint 368 899 0.8000 1.0000 2.0000 0.0000 Constraint 368 848 0.8000 1.0000 2.0000 0.0000 Constraint 368 761 0.8000 1.0000 2.0000 0.0000 Constraint 368 731 0.8000 1.0000 2.0000 0.0000 Constraint 368 681 0.8000 1.0000 2.0000 0.0000 Constraint 368 650 0.8000 1.0000 2.0000 0.0000 Constraint 368 639 0.8000 1.0000 2.0000 0.0000 Constraint 368 457 0.8000 1.0000 2.0000 0.0000 Constraint 368 435 0.8000 1.0000 2.0000 0.0000 Constraint 368 429 0.8000 1.0000 2.0000 0.0000 Constraint 368 421 0.8000 1.0000 2.0000 0.0000 Constraint 368 412 0.8000 1.0000 2.0000 0.0000 Constraint 368 403 0.8000 1.0000 2.0000 0.0000 Constraint 368 392 0.8000 1.0000 2.0000 0.0000 Constraint 368 384 0.8000 1.0000 2.0000 0.0000 Constraint 368 375 0.8000 1.0000 2.0000 0.0000 Constraint 363 1748 0.8000 1.0000 2.0000 0.0000 Constraint 363 1683 0.8000 1.0000 2.0000 0.0000 Constraint 363 1678 0.8000 1.0000 2.0000 0.0000 Constraint 363 1670 0.8000 1.0000 2.0000 0.0000 Constraint 363 1662 0.8000 1.0000 2.0000 0.0000 Constraint 363 1657 0.8000 1.0000 2.0000 0.0000 Constraint 363 1611 0.8000 1.0000 2.0000 0.0000 Constraint 363 1603 0.8000 1.0000 2.0000 0.0000 Constraint 363 1596 0.8000 1.0000 2.0000 0.0000 Constraint 363 1587 0.8000 1.0000 2.0000 0.0000 Constraint 363 1556 0.8000 1.0000 2.0000 0.0000 Constraint 363 1526 0.8000 1.0000 2.0000 0.0000 Constraint 363 1519 0.8000 1.0000 2.0000 0.0000 Constraint 363 1511 0.8000 1.0000 2.0000 0.0000 Constraint 363 1455 0.8000 1.0000 2.0000 0.0000 Constraint 363 1427 0.8000 1.0000 2.0000 0.0000 Constraint 363 1416 0.8000 1.0000 2.0000 0.0000 Constraint 363 1391 0.8000 1.0000 2.0000 0.0000 Constraint 363 1382 0.8000 1.0000 2.0000 0.0000 Constraint 363 1366 0.8000 1.0000 2.0000 0.0000 Constraint 363 1358 0.8000 1.0000 2.0000 0.0000 Constraint 363 1351 0.8000 1.0000 2.0000 0.0000 Constraint 363 1343 0.8000 1.0000 2.0000 0.0000 Constraint 363 1334 0.8000 1.0000 2.0000 0.0000 Constraint 363 1325 0.8000 1.0000 2.0000 0.0000 Constraint 363 1317 0.8000 1.0000 2.0000 0.0000 Constraint 363 1309 0.8000 1.0000 2.0000 0.0000 Constraint 363 1301 0.8000 1.0000 2.0000 0.0000 Constraint 363 1293 0.8000 1.0000 2.0000 0.0000 Constraint 363 1284 0.8000 1.0000 2.0000 0.0000 Constraint 363 1276 0.8000 1.0000 2.0000 0.0000 Constraint 363 1268 0.8000 1.0000 2.0000 0.0000 Constraint 363 1260 0.8000 1.0000 2.0000 0.0000 Constraint 363 1251 0.8000 1.0000 2.0000 0.0000 Constraint 363 1246 0.8000 1.0000 2.0000 0.0000 Constraint 363 1239 0.8000 1.0000 2.0000 0.0000 Constraint 363 1228 0.8000 1.0000 2.0000 0.0000 Constraint 363 1220 0.8000 1.0000 2.0000 0.0000 Constraint 363 1213 0.8000 1.0000 2.0000 0.0000 Constraint 363 1204 0.8000 1.0000 2.0000 0.0000 Constraint 363 1193 0.8000 1.0000 2.0000 0.0000 Constraint 363 1149 0.8000 1.0000 2.0000 0.0000 Constraint 363 1125 0.8000 1.0000 2.0000 0.0000 Constraint 363 1092 0.8000 1.0000 2.0000 0.0000 Constraint 363 1068 0.8000 1.0000 2.0000 0.0000 Constraint 363 1059 0.8000 1.0000 2.0000 0.0000 Constraint 363 1054 0.8000 1.0000 2.0000 0.0000 Constraint 363 1022 0.8000 1.0000 2.0000 0.0000 Constraint 363 988 0.8000 1.0000 2.0000 0.0000 Constraint 363 955 0.8000 1.0000 2.0000 0.0000 Constraint 363 930 0.8000 1.0000 2.0000 0.0000 Constraint 363 761 0.8000 1.0000 2.0000 0.0000 Constraint 363 731 0.8000 1.0000 2.0000 0.0000 Constraint 363 650 0.8000 1.0000 2.0000 0.0000 Constraint 363 429 0.8000 1.0000 2.0000 0.0000 Constraint 363 421 0.8000 1.0000 2.0000 0.0000 Constraint 363 412 0.8000 1.0000 2.0000 0.0000 Constraint 363 403 0.8000 1.0000 2.0000 0.0000 Constraint 363 392 0.8000 1.0000 2.0000 0.0000 Constraint 363 384 0.8000 1.0000 2.0000 0.0000 Constraint 363 375 0.8000 1.0000 2.0000 0.0000 Constraint 363 368 0.8000 1.0000 2.0000 0.0000 Constraint 355 1777 0.8000 1.0000 2.0000 0.0000 Constraint 355 1731 0.8000 1.0000 2.0000 0.0000 Constraint 355 1720 0.8000 1.0000 2.0000 0.0000 Constraint 355 1703 0.8000 1.0000 2.0000 0.0000 Constraint 355 1692 0.8000 1.0000 2.0000 0.0000 Constraint 355 1683 0.8000 1.0000 2.0000 0.0000 Constraint 355 1678 0.8000 1.0000 2.0000 0.0000 Constraint 355 1670 0.8000 1.0000 2.0000 0.0000 Constraint 355 1662 0.8000 1.0000 2.0000 0.0000 Constraint 355 1657 0.8000 1.0000 2.0000 0.0000 Constraint 355 1649 0.8000 1.0000 2.0000 0.0000 Constraint 355 1611 0.8000 1.0000 2.0000 0.0000 Constraint 355 1603 0.8000 1.0000 2.0000 0.0000 Constraint 355 1596 0.8000 1.0000 2.0000 0.0000 Constraint 355 1556 0.8000 1.0000 2.0000 0.0000 Constraint 355 1548 0.8000 1.0000 2.0000 0.0000 Constraint 355 1541 0.8000 1.0000 2.0000 0.0000 Constraint 355 1533 0.8000 1.0000 2.0000 0.0000 Constraint 355 1526 0.8000 1.0000 2.0000 0.0000 Constraint 355 1519 0.8000 1.0000 2.0000 0.0000 Constraint 355 1511 0.8000 1.0000 2.0000 0.0000 Constraint 355 1503 0.8000 1.0000 2.0000 0.0000 Constraint 355 1494 0.8000 1.0000 2.0000 0.0000 Constraint 355 1455 0.8000 1.0000 2.0000 0.0000 Constraint 355 1427 0.8000 1.0000 2.0000 0.0000 Constraint 355 1391 0.8000 1.0000 2.0000 0.0000 Constraint 355 1374 0.8000 1.0000 2.0000 0.0000 Constraint 355 1366 0.8000 1.0000 2.0000 0.0000 Constraint 355 1358 0.8000 1.0000 2.0000 0.0000 Constraint 355 1351 0.8000 1.0000 2.0000 0.0000 Constraint 355 1334 0.8000 1.0000 2.0000 0.0000 Constraint 355 1325 0.8000 1.0000 2.0000 0.0000 Constraint 355 1317 0.8000 1.0000 2.0000 0.0000 Constraint 355 1309 0.8000 1.0000 2.0000 0.0000 Constraint 355 1301 0.8000 1.0000 2.0000 0.0000 Constraint 355 1293 0.8000 1.0000 2.0000 0.0000 Constraint 355 1276 0.8000 1.0000 2.0000 0.0000 Constraint 355 1268 0.8000 1.0000 2.0000 0.0000 Constraint 355 1260 0.8000 1.0000 2.0000 0.0000 Constraint 355 1251 0.8000 1.0000 2.0000 0.0000 Constraint 355 1246 0.8000 1.0000 2.0000 0.0000 Constraint 355 1239 0.8000 1.0000 2.0000 0.0000 Constraint 355 1228 0.8000 1.0000 2.0000 0.0000 Constraint 355 1220 0.8000 1.0000 2.0000 0.0000 Constraint 355 1213 0.8000 1.0000 2.0000 0.0000 Constraint 355 1204 0.8000 1.0000 2.0000 0.0000 Constraint 355 1193 0.8000 1.0000 2.0000 0.0000 Constraint 355 1178 0.8000 1.0000 2.0000 0.0000 Constraint 355 1125 0.8000 1.0000 2.0000 0.0000 Constraint 355 1092 0.8000 1.0000 2.0000 0.0000 Constraint 355 1068 0.8000 1.0000 2.0000 0.0000 Constraint 355 1059 0.8000 1.0000 2.0000 0.0000 Constraint 355 1054 0.8000 1.0000 2.0000 0.0000 Constraint 355 1046 0.8000 1.0000 2.0000 0.0000 Constraint 355 1022 0.8000 1.0000 2.0000 0.0000 Constraint 355 1014 0.8000 1.0000 2.0000 0.0000 Constraint 355 1008 0.8000 1.0000 2.0000 0.0000 Constraint 355 997 0.8000 1.0000 2.0000 0.0000 Constraint 355 988 0.8000 1.0000 2.0000 0.0000 Constraint 355 968 0.8000 1.0000 2.0000 0.0000 Constraint 355 963 0.8000 1.0000 2.0000 0.0000 Constraint 355 761 0.8000 1.0000 2.0000 0.0000 Constraint 355 748 0.8000 1.0000 2.0000 0.0000 Constraint 355 706 0.8000 1.0000 2.0000 0.0000 Constraint 355 572 0.8000 1.0000 2.0000 0.0000 Constraint 355 501 0.8000 1.0000 2.0000 0.0000 Constraint 355 493 0.8000 1.0000 2.0000 0.0000 Constraint 355 421 0.8000 1.0000 2.0000 0.0000 Constraint 355 412 0.8000 1.0000 2.0000 0.0000 Constraint 355 403 0.8000 1.0000 2.0000 0.0000 Constraint 355 392 0.8000 1.0000 2.0000 0.0000 Constraint 355 384 0.8000 1.0000 2.0000 0.0000 Constraint 355 375 0.8000 1.0000 2.0000 0.0000 Constraint 355 368 0.8000 1.0000 2.0000 0.0000 Constraint 355 363 0.8000 1.0000 2.0000 0.0000 Constraint 347 1788 0.8000 1.0000 2.0000 0.0000 Constraint 347 1772 0.8000 1.0000 2.0000 0.0000 Constraint 347 1764 0.8000 1.0000 2.0000 0.0000 Constraint 347 1739 0.8000 1.0000 2.0000 0.0000 Constraint 347 1714 0.8000 1.0000 2.0000 0.0000 Constraint 347 1703 0.8000 1.0000 2.0000 0.0000 Constraint 347 1692 0.8000 1.0000 2.0000 0.0000 Constraint 347 1683 0.8000 1.0000 2.0000 0.0000 Constraint 347 1678 0.8000 1.0000 2.0000 0.0000 Constraint 347 1670 0.8000 1.0000 2.0000 0.0000 Constraint 347 1662 0.8000 1.0000 2.0000 0.0000 Constraint 347 1657 0.8000 1.0000 2.0000 0.0000 Constraint 347 1649 0.8000 1.0000 2.0000 0.0000 Constraint 347 1634 0.8000 1.0000 2.0000 0.0000 Constraint 347 1620 0.8000 1.0000 2.0000 0.0000 Constraint 347 1611 0.8000 1.0000 2.0000 0.0000 Constraint 347 1603 0.8000 1.0000 2.0000 0.0000 Constraint 347 1556 0.8000 1.0000 2.0000 0.0000 Constraint 347 1548 0.8000 1.0000 2.0000 0.0000 Constraint 347 1533 0.8000 1.0000 2.0000 0.0000 Constraint 347 1519 0.8000 1.0000 2.0000 0.0000 Constraint 347 1511 0.8000 1.0000 2.0000 0.0000 Constraint 347 1503 0.8000 1.0000 2.0000 0.0000 Constraint 347 1494 0.8000 1.0000 2.0000 0.0000 Constraint 347 1447 0.8000 1.0000 2.0000 0.0000 Constraint 347 1438 0.8000 1.0000 2.0000 0.0000 Constraint 347 1427 0.8000 1.0000 2.0000 0.0000 Constraint 347 1416 0.8000 1.0000 2.0000 0.0000 Constraint 347 1391 0.8000 1.0000 2.0000 0.0000 Constraint 347 1382 0.8000 1.0000 2.0000 0.0000 Constraint 347 1374 0.8000 1.0000 2.0000 0.0000 Constraint 347 1366 0.8000 1.0000 2.0000 0.0000 Constraint 347 1358 0.8000 1.0000 2.0000 0.0000 Constraint 347 1351 0.8000 1.0000 2.0000 0.0000 Constraint 347 1343 0.8000 1.0000 2.0000 0.0000 Constraint 347 1334 0.8000 1.0000 2.0000 0.0000 Constraint 347 1325 0.8000 1.0000 2.0000 0.0000 Constraint 347 1317 0.8000 1.0000 2.0000 0.0000 Constraint 347 1309 0.8000 1.0000 2.0000 0.0000 Constraint 347 1293 0.8000 1.0000 2.0000 0.0000 Constraint 347 1284 0.8000 1.0000 2.0000 0.0000 Constraint 347 1276 0.8000 1.0000 2.0000 0.0000 Constraint 347 1268 0.8000 1.0000 2.0000 0.0000 Constraint 347 1260 0.8000 1.0000 2.0000 0.0000 Constraint 347 1251 0.8000 1.0000 2.0000 0.0000 Constraint 347 1246 0.8000 1.0000 2.0000 0.0000 Constraint 347 1239 0.8000 1.0000 2.0000 0.0000 Constraint 347 1220 0.8000 1.0000 2.0000 0.0000 Constraint 347 1213 0.8000 1.0000 2.0000 0.0000 Constraint 347 1178 0.8000 1.0000 2.0000 0.0000 Constraint 347 1141 0.8000 1.0000 2.0000 0.0000 Constraint 347 1125 0.8000 1.0000 2.0000 0.0000 Constraint 347 1109 0.8000 1.0000 2.0000 0.0000 Constraint 347 1100 0.8000 1.0000 2.0000 0.0000 Constraint 347 1068 0.8000 1.0000 2.0000 0.0000 Constraint 347 988 0.8000 1.0000 2.0000 0.0000 Constraint 347 968 0.8000 1.0000 2.0000 0.0000 Constraint 347 963 0.8000 1.0000 2.0000 0.0000 Constraint 347 937 0.8000 1.0000 2.0000 0.0000 Constraint 347 908 0.8000 1.0000 2.0000 0.0000 Constraint 347 899 0.8000 1.0000 2.0000 0.0000 Constraint 347 892 0.8000 1.0000 2.0000 0.0000 Constraint 347 792 0.8000 1.0000 2.0000 0.0000 Constraint 347 778 0.8000 1.0000 2.0000 0.0000 Constraint 347 761 0.8000 1.0000 2.0000 0.0000 Constraint 347 756 0.8000 1.0000 2.0000 0.0000 Constraint 347 748 0.8000 1.0000 2.0000 0.0000 Constraint 347 722 0.8000 1.0000 2.0000 0.0000 Constraint 347 713 0.8000 1.0000 2.0000 0.0000 Constraint 347 706 0.8000 1.0000 2.0000 0.0000 Constraint 347 650 0.8000 1.0000 2.0000 0.0000 Constraint 347 639 0.8000 1.0000 2.0000 0.0000 Constraint 347 572 0.8000 1.0000 2.0000 0.0000 Constraint 347 564 0.8000 1.0000 2.0000 0.0000 Constraint 347 557 0.8000 1.0000 2.0000 0.0000 Constraint 347 501 0.8000 1.0000 2.0000 0.0000 Constraint 347 412 0.8000 1.0000 2.0000 0.0000 Constraint 347 403 0.8000 1.0000 2.0000 0.0000 Constraint 347 392 0.8000 1.0000 2.0000 0.0000 Constraint 347 384 0.8000 1.0000 2.0000 0.0000 Constraint 347 375 0.8000 1.0000 2.0000 0.0000 Constraint 347 368 0.8000 1.0000 2.0000 0.0000 Constraint 347 363 0.8000 1.0000 2.0000 0.0000 Constraint 347 355 0.8000 1.0000 2.0000 0.0000 Constraint 333 1788 0.8000 1.0000 2.0000 0.0000 Constraint 333 1777 0.8000 1.0000 2.0000 0.0000 Constraint 333 1772 0.8000 1.0000 2.0000 0.0000 Constraint 333 1764 0.8000 1.0000 2.0000 0.0000 Constraint 333 1756 0.8000 1.0000 2.0000 0.0000 Constraint 333 1748 0.8000 1.0000 2.0000 0.0000 Constraint 333 1739 0.8000 1.0000 2.0000 0.0000 Constraint 333 1683 0.8000 1.0000 2.0000 0.0000 Constraint 333 1678 0.8000 1.0000 2.0000 0.0000 Constraint 333 1670 0.8000 1.0000 2.0000 0.0000 Constraint 333 1662 0.8000 1.0000 2.0000 0.0000 Constraint 333 1657 0.8000 1.0000 2.0000 0.0000 Constraint 333 1649 0.8000 1.0000 2.0000 0.0000 Constraint 333 1611 0.8000 1.0000 2.0000 0.0000 Constraint 333 1556 0.8000 1.0000 2.0000 0.0000 Constraint 333 1533 0.8000 1.0000 2.0000 0.0000 Constraint 333 1526 0.8000 1.0000 2.0000 0.0000 Constraint 333 1519 0.8000 1.0000 2.0000 0.0000 Constraint 333 1511 0.8000 1.0000 2.0000 0.0000 Constraint 333 1503 0.8000 1.0000 2.0000 0.0000 Constraint 333 1494 0.8000 1.0000 2.0000 0.0000 Constraint 333 1488 0.8000 1.0000 2.0000 0.0000 Constraint 333 1479 0.8000 1.0000 2.0000 0.0000 Constraint 333 1466 0.8000 1.0000 2.0000 0.0000 Constraint 333 1447 0.8000 1.0000 2.0000 0.0000 Constraint 333 1427 0.8000 1.0000 2.0000 0.0000 Constraint 333 1416 0.8000 1.0000 2.0000 0.0000 Constraint 333 1408 0.8000 1.0000 2.0000 0.0000 Constraint 333 1399 0.8000 1.0000 2.0000 0.0000 Constraint 333 1391 0.8000 1.0000 2.0000 0.0000 Constraint 333 1382 0.8000 1.0000 2.0000 0.0000 Constraint 333 1374 0.8000 1.0000 2.0000 0.0000 Constraint 333 1366 0.8000 1.0000 2.0000 0.0000 Constraint 333 1358 0.8000 1.0000 2.0000 0.0000 Constraint 333 1351 0.8000 1.0000 2.0000 0.0000 Constraint 333 1343 0.8000 1.0000 2.0000 0.0000 Constraint 333 1334 0.8000 1.0000 2.0000 0.0000 Constraint 333 1325 0.8000 1.0000 2.0000 0.0000 Constraint 333 1317 0.8000 1.0000 2.0000 0.0000 Constraint 333 1309 0.8000 1.0000 2.0000 0.0000 Constraint 333 1293 0.8000 1.0000 2.0000 0.0000 Constraint 333 1276 0.8000 1.0000 2.0000 0.0000 Constraint 333 1268 0.8000 1.0000 2.0000 0.0000 Constraint 333 1246 0.8000 1.0000 2.0000 0.0000 Constraint 333 1213 0.8000 1.0000 2.0000 0.0000 Constraint 333 1178 0.8000 1.0000 2.0000 0.0000 Constraint 333 1133 0.8000 1.0000 2.0000 0.0000 Constraint 333 1125 0.8000 1.0000 2.0000 0.0000 Constraint 333 1100 0.8000 1.0000 2.0000 0.0000 Constraint 333 1077 0.8000 1.0000 2.0000 0.0000 Constraint 333 1068 0.8000 1.0000 2.0000 0.0000 Constraint 333 1035 0.8000 1.0000 2.0000 0.0000 Constraint 333 1022 0.8000 1.0000 2.0000 0.0000 Constraint 333 1014 0.8000 1.0000 2.0000 0.0000 Constraint 333 988 0.8000 1.0000 2.0000 0.0000 Constraint 333 963 0.8000 1.0000 2.0000 0.0000 Constraint 333 899 0.8000 1.0000 2.0000 0.0000 Constraint 333 818 0.8000 1.0000 2.0000 0.0000 Constraint 333 722 0.8000 1.0000 2.0000 0.0000 Constraint 333 650 0.8000 1.0000 2.0000 0.0000 Constraint 333 639 0.8000 1.0000 2.0000 0.0000 Constraint 333 549 0.8000 1.0000 2.0000 0.0000 Constraint 333 403 0.8000 1.0000 2.0000 0.0000 Constraint 333 392 0.8000 1.0000 2.0000 0.0000 Constraint 333 384 0.8000 1.0000 2.0000 0.0000 Constraint 333 375 0.8000 1.0000 2.0000 0.0000 Constraint 333 368 0.8000 1.0000 2.0000 0.0000 Constraint 333 363 0.8000 1.0000 2.0000 0.0000 Constraint 333 355 0.8000 1.0000 2.0000 0.0000 Constraint 333 347 0.8000 1.0000 2.0000 0.0000 Constraint 325 1788 0.8000 1.0000 2.0000 0.0000 Constraint 325 1777 0.8000 1.0000 2.0000 0.0000 Constraint 325 1756 0.8000 1.0000 2.0000 0.0000 Constraint 325 1720 0.8000 1.0000 2.0000 0.0000 Constraint 325 1703 0.8000 1.0000 2.0000 0.0000 Constraint 325 1692 0.8000 1.0000 2.0000 0.0000 Constraint 325 1683 0.8000 1.0000 2.0000 0.0000 Constraint 325 1678 0.8000 1.0000 2.0000 0.0000 Constraint 325 1670 0.8000 1.0000 2.0000 0.0000 Constraint 325 1662 0.8000 1.0000 2.0000 0.0000 Constraint 325 1657 0.8000 1.0000 2.0000 0.0000 Constraint 325 1649 0.8000 1.0000 2.0000 0.0000 Constraint 325 1634 0.8000 1.0000 2.0000 0.0000 Constraint 325 1556 0.8000 1.0000 2.0000 0.0000 Constraint 325 1548 0.8000 1.0000 2.0000 0.0000 Constraint 325 1541 0.8000 1.0000 2.0000 0.0000 Constraint 325 1533 0.8000 1.0000 2.0000 0.0000 Constraint 325 1526 0.8000 1.0000 2.0000 0.0000 Constraint 325 1519 0.8000 1.0000 2.0000 0.0000 Constraint 325 1511 0.8000 1.0000 2.0000 0.0000 Constraint 325 1503 0.8000 1.0000 2.0000 0.0000 Constraint 325 1494 0.8000 1.0000 2.0000 0.0000 Constraint 325 1488 0.8000 1.0000 2.0000 0.0000 Constraint 325 1479 0.8000 1.0000 2.0000 0.0000 Constraint 325 1438 0.8000 1.0000 2.0000 0.0000 Constraint 325 1427 0.8000 1.0000 2.0000 0.0000 Constraint 325 1416 0.8000 1.0000 2.0000 0.0000 Constraint 325 1391 0.8000 1.0000 2.0000 0.0000 Constraint 325 1374 0.8000 1.0000 2.0000 0.0000 Constraint 325 1366 0.8000 1.0000 2.0000 0.0000 Constraint 325 1358 0.8000 1.0000 2.0000 0.0000 Constraint 325 1351 0.8000 1.0000 2.0000 0.0000 Constraint 325 1343 0.8000 1.0000 2.0000 0.0000 Constraint 325 1334 0.8000 1.0000 2.0000 0.0000 Constraint 325 1325 0.8000 1.0000 2.0000 0.0000 Constraint 325 1317 0.8000 1.0000 2.0000 0.0000 Constraint 325 1293 0.8000 1.0000 2.0000 0.0000 Constraint 325 1284 0.8000 1.0000 2.0000 0.0000 Constraint 325 1276 0.8000 1.0000 2.0000 0.0000 Constraint 325 1260 0.8000 1.0000 2.0000 0.0000 Constraint 325 1251 0.8000 1.0000 2.0000 0.0000 Constraint 325 1246 0.8000 1.0000 2.0000 0.0000 Constraint 325 1193 0.8000 1.0000 2.0000 0.0000 Constraint 325 1178 0.8000 1.0000 2.0000 0.0000 Constraint 325 1149 0.8000 1.0000 2.0000 0.0000 Constraint 325 1141 0.8000 1.0000 2.0000 0.0000 Constraint 325 1125 0.8000 1.0000 2.0000 0.0000 Constraint 325 1117 0.8000 1.0000 2.0000 0.0000 Constraint 325 1109 0.8000 1.0000 2.0000 0.0000 Constraint 325 1100 0.8000 1.0000 2.0000 0.0000 Constraint 325 1084 0.8000 1.0000 2.0000 0.0000 Constraint 325 1077 0.8000 1.0000 2.0000 0.0000 Constraint 325 1059 0.8000 1.0000 2.0000 0.0000 Constraint 325 1054 0.8000 1.0000 2.0000 0.0000 Constraint 325 1046 0.8000 1.0000 2.0000 0.0000 Constraint 325 1035 0.8000 1.0000 2.0000 0.0000 Constraint 325 1030 0.8000 1.0000 2.0000 0.0000 Constraint 325 1022 0.8000 1.0000 2.0000 0.0000 Constraint 325 1014 0.8000 1.0000 2.0000 0.0000 Constraint 325 1008 0.8000 1.0000 2.0000 0.0000 Constraint 325 997 0.8000 1.0000 2.0000 0.0000 Constraint 325 963 0.8000 1.0000 2.0000 0.0000 Constraint 325 955 0.8000 1.0000 2.0000 0.0000 Constraint 325 899 0.8000 1.0000 2.0000 0.0000 Constraint 325 792 0.8000 1.0000 2.0000 0.0000 Constraint 325 783 0.8000 1.0000 2.0000 0.0000 Constraint 325 769 0.8000 1.0000 2.0000 0.0000 Constraint 325 761 0.8000 1.0000 2.0000 0.0000 Constraint 325 756 0.8000 1.0000 2.0000 0.0000 Constraint 325 739 0.8000 1.0000 2.0000 0.0000 Constraint 325 731 0.8000 1.0000 2.0000 0.0000 Constraint 325 722 0.8000 1.0000 2.0000 0.0000 Constraint 325 713 0.8000 1.0000 2.0000 0.0000 Constraint 325 673 0.8000 1.0000 2.0000 0.0000 Constraint 325 650 0.8000 1.0000 2.0000 0.0000 Constraint 325 639 0.8000 1.0000 2.0000 0.0000 Constraint 325 597 0.8000 1.0000 2.0000 0.0000 Constraint 325 579 0.8000 1.0000 2.0000 0.0000 Constraint 325 510 0.8000 1.0000 2.0000 0.0000 Constraint 325 501 0.8000 1.0000 2.0000 0.0000 Constraint 325 487 0.8000 1.0000 2.0000 0.0000 Constraint 325 392 0.8000 1.0000 2.0000 0.0000 Constraint 325 384 0.8000 1.0000 2.0000 0.0000 Constraint 325 375 0.8000 1.0000 2.0000 0.0000 Constraint 325 368 0.8000 1.0000 2.0000 0.0000 Constraint 325 363 0.8000 1.0000 2.0000 0.0000 Constraint 325 355 0.8000 1.0000 2.0000 0.0000 Constraint 325 347 0.8000 1.0000 2.0000 0.0000 Constraint 325 333 0.8000 1.0000 2.0000 0.0000 Constraint 314 1788 0.8000 1.0000 2.0000 0.0000 Constraint 314 1777 0.8000 1.0000 2.0000 0.0000 Constraint 314 1772 0.8000 1.0000 2.0000 0.0000 Constraint 314 1764 0.8000 1.0000 2.0000 0.0000 Constraint 314 1756 0.8000 1.0000 2.0000 0.0000 Constraint 314 1748 0.8000 1.0000 2.0000 0.0000 Constraint 314 1739 0.8000 1.0000 2.0000 0.0000 Constraint 314 1731 0.8000 1.0000 2.0000 0.0000 Constraint 314 1720 0.8000 1.0000 2.0000 0.0000 Constraint 314 1714 0.8000 1.0000 2.0000 0.0000 Constraint 314 1703 0.8000 1.0000 2.0000 0.0000 Constraint 314 1692 0.8000 1.0000 2.0000 0.0000 Constraint 314 1683 0.8000 1.0000 2.0000 0.0000 Constraint 314 1678 0.8000 1.0000 2.0000 0.0000 Constraint 314 1670 0.8000 1.0000 2.0000 0.0000 Constraint 314 1662 0.8000 1.0000 2.0000 0.0000 Constraint 314 1657 0.8000 1.0000 2.0000 0.0000 Constraint 314 1649 0.8000 1.0000 2.0000 0.0000 Constraint 314 1634 0.8000 1.0000 2.0000 0.0000 Constraint 314 1620 0.8000 1.0000 2.0000 0.0000 Constraint 314 1611 0.8000 1.0000 2.0000 0.0000 Constraint 314 1575 0.8000 1.0000 2.0000 0.0000 Constraint 314 1567 0.8000 1.0000 2.0000 0.0000 Constraint 314 1556 0.8000 1.0000 2.0000 0.0000 Constraint 314 1541 0.8000 1.0000 2.0000 0.0000 Constraint 314 1519 0.8000 1.0000 2.0000 0.0000 Constraint 314 1511 0.8000 1.0000 2.0000 0.0000 Constraint 314 1503 0.8000 1.0000 2.0000 0.0000 Constraint 314 1494 0.8000 1.0000 2.0000 0.0000 Constraint 314 1488 0.8000 1.0000 2.0000 0.0000 Constraint 314 1479 0.8000 1.0000 2.0000 0.0000 Constraint 314 1471 0.8000 1.0000 2.0000 0.0000 Constraint 314 1466 0.8000 1.0000 2.0000 0.0000 Constraint 314 1455 0.8000 1.0000 2.0000 0.0000 Constraint 314 1447 0.8000 1.0000 2.0000 0.0000 Constraint 314 1438 0.8000 1.0000 2.0000 0.0000 Constraint 314 1427 0.8000 1.0000 2.0000 0.0000 Constraint 314 1416 0.8000 1.0000 2.0000 0.0000 Constraint 314 1399 0.8000 1.0000 2.0000 0.0000 Constraint 314 1391 0.8000 1.0000 2.0000 0.0000 Constraint 314 1382 0.8000 1.0000 2.0000 0.0000 Constraint 314 1374 0.8000 1.0000 2.0000 0.0000 Constraint 314 1366 0.8000 1.0000 2.0000 0.0000 Constraint 314 1358 0.8000 1.0000 2.0000 0.0000 Constraint 314 1351 0.8000 1.0000 2.0000 0.0000 Constraint 314 1334 0.8000 1.0000 2.0000 0.0000 Constraint 314 1325 0.8000 1.0000 2.0000 0.0000 Constraint 314 1317 0.8000 1.0000 2.0000 0.0000 Constraint 314 1309 0.8000 1.0000 2.0000 0.0000 Constraint 314 1301 0.8000 1.0000 2.0000 0.0000 Constraint 314 1293 0.8000 1.0000 2.0000 0.0000 Constraint 314 1276 0.8000 1.0000 2.0000 0.0000 Constraint 314 1268 0.8000 1.0000 2.0000 0.0000 Constraint 314 1246 0.8000 1.0000 2.0000 0.0000 Constraint 314 1239 0.8000 1.0000 2.0000 0.0000 Constraint 314 1220 0.8000 1.0000 2.0000 0.0000 Constraint 314 1149 0.8000 1.0000 2.0000 0.0000 Constraint 314 1125 0.8000 1.0000 2.0000 0.0000 Constraint 314 1059 0.8000 1.0000 2.0000 0.0000 Constraint 314 1014 0.8000 1.0000 2.0000 0.0000 Constraint 314 848 0.8000 1.0000 2.0000 0.0000 Constraint 314 783 0.8000 1.0000 2.0000 0.0000 Constraint 314 778 0.8000 1.0000 2.0000 0.0000 Constraint 314 761 0.8000 1.0000 2.0000 0.0000 Constraint 314 756 0.8000 1.0000 2.0000 0.0000 Constraint 314 748 0.8000 1.0000 2.0000 0.0000 Constraint 314 739 0.8000 1.0000 2.0000 0.0000 Constraint 314 731 0.8000 1.0000 2.0000 0.0000 Constraint 314 673 0.8000 1.0000 2.0000 0.0000 Constraint 314 650 0.8000 1.0000 2.0000 0.0000 Constraint 314 639 0.8000 1.0000 2.0000 0.0000 Constraint 314 616 0.8000 1.0000 2.0000 0.0000 Constraint 314 608 0.8000 1.0000 2.0000 0.0000 Constraint 314 572 0.8000 1.0000 2.0000 0.0000 Constraint 314 564 0.8000 1.0000 2.0000 0.0000 Constraint 314 538 0.8000 1.0000 2.0000 0.0000 Constraint 314 479 0.8000 1.0000 2.0000 0.0000 Constraint 314 457 0.8000 1.0000 2.0000 0.0000 Constraint 314 429 0.8000 1.0000 2.0000 0.0000 Constraint 314 375 0.8000 1.0000 2.0000 0.0000 Constraint 314 368 0.8000 1.0000 2.0000 0.0000 Constraint 314 363 0.8000 1.0000 2.0000 0.0000 Constraint 314 355 0.8000 1.0000 2.0000 0.0000 Constraint 314 347 0.8000 1.0000 2.0000 0.0000 Constraint 314 333 0.8000 1.0000 2.0000 0.0000 Constraint 314 325 0.8000 1.0000 2.0000 0.0000 Constraint 306 1788 0.8000 1.0000 2.0000 0.0000 Constraint 306 1777 0.8000 1.0000 2.0000 0.0000 Constraint 306 1772 0.8000 1.0000 2.0000 0.0000 Constraint 306 1764 0.8000 1.0000 2.0000 0.0000 Constraint 306 1756 0.8000 1.0000 2.0000 0.0000 Constraint 306 1748 0.8000 1.0000 2.0000 0.0000 Constraint 306 1739 0.8000 1.0000 2.0000 0.0000 Constraint 306 1731 0.8000 1.0000 2.0000 0.0000 Constraint 306 1720 0.8000 1.0000 2.0000 0.0000 Constraint 306 1714 0.8000 1.0000 2.0000 0.0000 Constraint 306 1703 0.8000 1.0000 2.0000 0.0000 Constraint 306 1692 0.8000 1.0000 2.0000 0.0000 Constraint 306 1683 0.8000 1.0000 2.0000 0.0000 Constraint 306 1678 0.8000 1.0000 2.0000 0.0000 Constraint 306 1670 0.8000 1.0000 2.0000 0.0000 Constraint 306 1662 0.8000 1.0000 2.0000 0.0000 Constraint 306 1657 0.8000 1.0000 2.0000 0.0000 Constraint 306 1620 0.8000 1.0000 2.0000 0.0000 Constraint 306 1611 0.8000 1.0000 2.0000 0.0000 Constraint 306 1596 0.8000 1.0000 2.0000 0.0000 Constraint 306 1567 0.8000 1.0000 2.0000 0.0000 Constraint 306 1556 0.8000 1.0000 2.0000 0.0000 Constraint 306 1541 0.8000 1.0000 2.0000 0.0000 Constraint 306 1533 0.8000 1.0000 2.0000 0.0000 Constraint 306 1526 0.8000 1.0000 2.0000 0.0000 Constraint 306 1519 0.8000 1.0000 2.0000 0.0000 Constraint 306 1511 0.8000 1.0000 2.0000 0.0000 Constraint 306 1503 0.8000 1.0000 2.0000 0.0000 Constraint 306 1488 0.8000 1.0000 2.0000 0.0000 Constraint 306 1479 0.8000 1.0000 2.0000 0.0000 Constraint 306 1438 0.8000 1.0000 2.0000 0.0000 Constraint 306 1374 0.8000 1.0000 2.0000 0.0000 Constraint 306 1358 0.8000 1.0000 2.0000 0.0000 Constraint 306 1351 0.8000 1.0000 2.0000 0.0000 Constraint 306 1343 0.8000 1.0000 2.0000 0.0000 Constraint 306 1334 0.8000 1.0000 2.0000 0.0000 Constraint 306 1325 0.8000 1.0000 2.0000 0.0000 Constraint 306 1317 0.8000 1.0000 2.0000 0.0000 Constraint 306 1309 0.8000 1.0000 2.0000 0.0000 Constraint 306 1301 0.8000 1.0000 2.0000 0.0000 Constraint 306 1293 0.8000 1.0000 2.0000 0.0000 Constraint 306 1284 0.8000 1.0000 2.0000 0.0000 Constraint 306 1276 0.8000 1.0000 2.0000 0.0000 Constraint 306 1268 0.8000 1.0000 2.0000 0.0000 Constraint 306 1260 0.8000 1.0000 2.0000 0.0000 Constraint 306 1251 0.8000 1.0000 2.0000 0.0000 Constraint 306 1246 0.8000 1.0000 2.0000 0.0000 Constraint 306 1220 0.8000 1.0000 2.0000 0.0000 Constraint 306 1213 0.8000 1.0000 2.0000 0.0000 Constraint 306 1178 0.8000 1.0000 2.0000 0.0000 Constraint 306 1125 0.8000 1.0000 2.0000 0.0000 Constraint 306 1077 0.8000 1.0000 2.0000 0.0000 Constraint 306 1059 0.8000 1.0000 2.0000 0.0000 Constraint 306 930 0.8000 1.0000 2.0000 0.0000 Constraint 306 761 0.8000 1.0000 2.0000 0.0000 Constraint 306 748 0.8000 1.0000 2.0000 0.0000 Constraint 306 681 0.8000 1.0000 2.0000 0.0000 Constraint 306 673 0.8000 1.0000 2.0000 0.0000 Constraint 306 650 0.8000 1.0000 2.0000 0.0000 Constraint 306 630 0.8000 1.0000 2.0000 0.0000 Constraint 306 572 0.8000 1.0000 2.0000 0.0000 Constraint 306 564 0.8000 1.0000 2.0000 0.0000 Constraint 306 368 0.8000 1.0000 2.0000 0.0000 Constraint 306 363 0.8000 1.0000 2.0000 0.0000 Constraint 306 355 0.8000 1.0000 2.0000 0.0000 Constraint 306 347 0.8000 1.0000 2.0000 0.0000 Constraint 306 333 0.8000 1.0000 2.0000 0.0000 Constraint 306 325 0.8000 1.0000 2.0000 0.0000 Constraint 306 314 0.8000 1.0000 2.0000 0.0000 Constraint 299 1788 0.8000 1.0000 2.0000 0.0000 Constraint 299 1739 0.8000 1.0000 2.0000 0.0000 Constraint 299 1731 0.8000 1.0000 2.0000 0.0000 Constraint 299 1720 0.8000 1.0000 2.0000 0.0000 Constraint 299 1714 0.8000 1.0000 2.0000 0.0000 Constraint 299 1703 0.8000 1.0000 2.0000 0.0000 Constraint 299 1692 0.8000 1.0000 2.0000 0.0000 Constraint 299 1670 0.8000 1.0000 2.0000 0.0000 Constraint 299 1662 0.8000 1.0000 2.0000 0.0000 Constraint 299 1657 0.8000 1.0000 2.0000 0.0000 Constraint 299 1649 0.8000 1.0000 2.0000 0.0000 Constraint 299 1620 0.8000 1.0000 2.0000 0.0000 Constraint 299 1611 0.8000 1.0000 2.0000 0.0000 Constraint 299 1587 0.8000 1.0000 2.0000 0.0000 Constraint 299 1541 0.8000 1.0000 2.0000 0.0000 Constraint 299 1533 0.8000 1.0000 2.0000 0.0000 Constraint 299 1526 0.8000 1.0000 2.0000 0.0000 Constraint 299 1519 0.8000 1.0000 2.0000 0.0000 Constraint 299 1511 0.8000 1.0000 2.0000 0.0000 Constraint 299 1503 0.8000 1.0000 2.0000 0.0000 Constraint 299 1494 0.8000 1.0000 2.0000 0.0000 Constraint 299 1488 0.8000 1.0000 2.0000 0.0000 Constraint 299 1366 0.8000 1.0000 2.0000 0.0000 Constraint 299 1358 0.8000 1.0000 2.0000 0.0000 Constraint 299 1351 0.8000 1.0000 2.0000 0.0000 Constraint 299 1343 0.8000 1.0000 2.0000 0.0000 Constraint 299 1334 0.8000 1.0000 2.0000 0.0000 Constraint 299 1325 0.8000 1.0000 2.0000 0.0000 Constraint 299 1317 0.8000 1.0000 2.0000 0.0000 Constraint 299 1309 0.8000 1.0000 2.0000 0.0000 Constraint 299 1301 0.8000 1.0000 2.0000 0.0000 Constraint 299 1293 0.8000 1.0000 2.0000 0.0000 Constraint 299 1276 0.8000 1.0000 2.0000 0.0000 Constraint 299 1268 0.8000 1.0000 2.0000 0.0000 Constraint 299 1260 0.8000 1.0000 2.0000 0.0000 Constraint 299 1251 0.8000 1.0000 2.0000 0.0000 Constraint 299 1246 0.8000 1.0000 2.0000 0.0000 Constraint 299 1239 0.8000 1.0000 2.0000 0.0000 Constraint 299 1213 0.8000 1.0000 2.0000 0.0000 Constraint 299 1178 0.8000 1.0000 2.0000 0.0000 Constraint 299 1158 0.8000 1.0000 2.0000 0.0000 Constraint 299 1117 0.8000 1.0000 2.0000 0.0000 Constraint 299 1092 0.8000 1.0000 2.0000 0.0000 Constraint 299 1068 0.8000 1.0000 2.0000 0.0000 Constraint 299 1059 0.8000 1.0000 2.0000 0.0000 Constraint 299 1022 0.8000 1.0000 2.0000 0.0000 Constraint 299 1014 0.8000 1.0000 2.0000 0.0000 Constraint 299 988 0.8000 1.0000 2.0000 0.0000 Constraint 299 955 0.8000 1.0000 2.0000 0.0000 Constraint 299 739 0.8000 1.0000 2.0000 0.0000 Constraint 299 564 0.8000 1.0000 2.0000 0.0000 Constraint 299 479 0.8000 1.0000 2.0000 0.0000 Constraint 299 363 0.8000 1.0000 2.0000 0.0000 Constraint 299 355 0.8000 1.0000 2.0000 0.0000 Constraint 299 347 0.8000 1.0000 2.0000 0.0000 Constraint 299 333 0.8000 1.0000 2.0000 0.0000 Constraint 299 325 0.8000 1.0000 2.0000 0.0000 Constraint 299 314 0.8000 1.0000 2.0000 0.0000 Constraint 299 306 0.8000 1.0000 2.0000 0.0000 Constraint 294 1788 0.8000 1.0000 2.0000 0.0000 Constraint 294 1764 0.8000 1.0000 2.0000 0.0000 Constraint 294 1756 0.8000 1.0000 2.0000 0.0000 Constraint 294 1748 0.8000 1.0000 2.0000 0.0000 Constraint 294 1739 0.8000 1.0000 2.0000 0.0000 Constraint 294 1731 0.8000 1.0000 2.0000 0.0000 Constraint 294 1720 0.8000 1.0000 2.0000 0.0000 Constraint 294 1714 0.8000 1.0000 2.0000 0.0000 Constraint 294 1703 0.8000 1.0000 2.0000 0.0000 Constraint 294 1692 0.8000 1.0000 2.0000 0.0000 Constraint 294 1683 0.8000 1.0000 2.0000 0.0000 Constraint 294 1678 0.8000 1.0000 2.0000 0.0000 Constraint 294 1670 0.8000 1.0000 2.0000 0.0000 Constraint 294 1662 0.8000 1.0000 2.0000 0.0000 Constraint 294 1657 0.8000 1.0000 2.0000 0.0000 Constraint 294 1649 0.8000 1.0000 2.0000 0.0000 Constraint 294 1634 0.8000 1.0000 2.0000 0.0000 Constraint 294 1620 0.8000 1.0000 2.0000 0.0000 Constraint 294 1611 0.8000 1.0000 2.0000 0.0000 Constraint 294 1603 0.8000 1.0000 2.0000 0.0000 Constraint 294 1587 0.8000 1.0000 2.0000 0.0000 Constraint 294 1575 0.8000 1.0000 2.0000 0.0000 Constraint 294 1567 0.8000 1.0000 2.0000 0.0000 Constraint 294 1556 0.8000 1.0000 2.0000 0.0000 Constraint 294 1548 0.8000 1.0000 2.0000 0.0000 Constraint 294 1541 0.8000 1.0000 2.0000 0.0000 Constraint 294 1533 0.8000 1.0000 2.0000 0.0000 Constraint 294 1526 0.8000 1.0000 2.0000 0.0000 Constraint 294 1519 0.8000 1.0000 2.0000 0.0000 Constraint 294 1511 0.8000 1.0000 2.0000 0.0000 Constraint 294 1503 0.8000 1.0000 2.0000 0.0000 Constraint 294 1488 0.8000 1.0000 2.0000 0.0000 Constraint 294 1479 0.8000 1.0000 2.0000 0.0000 Constraint 294 1466 0.8000 1.0000 2.0000 0.0000 Constraint 294 1455 0.8000 1.0000 2.0000 0.0000 Constraint 294 1447 0.8000 1.0000 2.0000 0.0000 Constraint 294 1438 0.8000 1.0000 2.0000 0.0000 Constraint 294 1427 0.8000 1.0000 2.0000 0.0000 Constraint 294 1416 0.8000 1.0000 2.0000 0.0000 Constraint 294 1399 0.8000 1.0000 2.0000 0.0000 Constraint 294 1391 0.8000 1.0000 2.0000 0.0000 Constraint 294 1382 0.8000 1.0000 2.0000 0.0000 Constraint 294 1374 0.8000 1.0000 2.0000 0.0000 Constraint 294 1366 0.8000 1.0000 2.0000 0.0000 Constraint 294 1358 0.8000 1.0000 2.0000 0.0000 Constraint 294 1351 0.8000 1.0000 2.0000 0.0000 Constraint 294 1334 0.8000 1.0000 2.0000 0.0000 Constraint 294 1317 0.8000 1.0000 2.0000 0.0000 Constraint 294 1284 0.8000 1.0000 2.0000 0.0000 Constraint 294 1276 0.8000 1.0000 2.0000 0.0000 Constraint 294 1268 0.8000 1.0000 2.0000 0.0000 Constraint 294 1260 0.8000 1.0000 2.0000 0.0000 Constraint 294 1251 0.8000 1.0000 2.0000 0.0000 Constraint 294 1246 0.8000 1.0000 2.0000 0.0000 Constraint 294 1220 0.8000 1.0000 2.0000 0.0000 Constraint 294 1213 0.8000 1.0000 2.0000 0.0000 Constraint 294 1193 0.8000 1.0000 2.0000 0.0000 Constraint 294 1178 0.8000 1.0000 2.0000 0.0000 Constraint 294 1167 0.8000 1.0000 2.0000 0.0000 Constraint 294 1158 0.8000 1.0000 2.0000 0.0000 Constraint 294 1149 0.8000 1.0000 2.0000 0.0000 Constraint 294 1141 0.8000 1.0000 2.0000 0.0000 Constraint 294 1125 0.8000 1.0000 2.0000 0.0000 Constraint 294 1117 0.8000 1.0000 2.0000 0.0000 Constraint 294 1092 0.8000 1.0000 2.0000 0.0000 Constraint 294 1084 0.8000 1.0000 2.0000 0.0000 Constraint 294 1068 0.8000 1.0000 2.0000 0.0000 Constraint 294 988 0.8000 1.0000 2.0000 0.0000 Constraint 294 963 0.8000 1.0000 2.0000 0.0000 Constraint 294 955 0.8000 1.0000 2.0000 0.0000 Constraint 294 944 0.8000 1.0000 2.0000 0.0000 Constraint 294 930 0.8000 1.0000 2.0000 0.0000 Constraint 294 818 0.8000 1.0000 2.0000 0.0000 Constraint 294 783 0.8000 1.0000 2.0000 0.0000 Constraint 294 673 0.8000 1.0000 2.0000 0.0000 Constraint 294 657 0.8000 1.0000 2.0000 0.0000 Constraint 294 650 0.8000 1.0000 2.0000 0.0000 Constraint 294 630 0.8000 1.0000 2.0000 0.0000 Constraint 294 549 0.8000 1.0000 2.0000 0.0000 Constraint 294 355 0.8000 1.0000 2.0000 0.0000 Constraint 294 347 0.8000 1.0000 2.0000 0.0000 Constraint 294 333 0.8000 1.0000 2.0000 0.0000 Constraint 294 325 0.8000 1.0000 2.0000 0.0000 Constraint 294 314 0.8000 1.0000 2.0000 0.0000 Constraint 294 306 0.8000 1.0000 2.0000 0.0000 Constraint 294 299 0.8000 1.0000 2.0000 0.0000 Constraint 285 1788 0.8000 1.0000 2.0000 0.0000 Constraint 285 1772 0.8000 1.0000 2.0000 0.0000 Constraint 285 1764 0.8000 1.0000 2.0000 0.0000 Constraint 285 1756 0.8000 1.0000 2.0000 0.0000 Constraint 285 1748 0.8000 1.0000 2.0000 0.0000 Constraint 285 1739 0.8000 1.0000 2.0000 0.0000 Constraint 285 1731 0.8000 1.0000 2.0000 0.0000 Constraint 285 1720 0.8000 1.0000 2.0000 0.0000 Constraint 285 1714 0.8000 1.0000 2.0000 0.0000 Constraint 285 1703 0.8000 1.0000 2.0000 0.0000 Constraint 285 1692 0.8000 1.0000 2.0000 0.0000 Constraint 285 1683 0.8000 1.0000 2.0000 0.0000 Constraint 285 1678 0.8000 1.0000 2.0000 0.0000 Constraint 285 1670 0.8000 1.0000 2.0000 0.0000 Constraint 285 1662 0.8000 1.0000 2.0000 0.0000 Constraint 285 1657 0.8000 1.0000 2.0000 0.0000 Constraint 285 1649 0.8000 1.0000 2.0000 0.0000 Constraint 285 1634 0.8000 1.0000 2.0000 0.0000 Constraint 285 1620 0.8000 1.0000 2.0000 0.0000 Constraint 285 1611 0.8000 1.0000 2.0000 0.0000 Constraint 285 1587 0.8000 1.0000 2.0000 0.0000 Constraint 285 1567 0.8000 1.0000 2.0000 0.0000 Constraint 285 1556 0.8000 1.0000 2.0000 0.0000 Constraint 285 1541 0.8000 1.0000 2.0000 0.0000 Constraint 285 1526 0.8000 1.0000 2.0000 0.0000 Constraint 285 1519 0.8000 1.0000 2.0000 0.0000 Constraint 285 1511 0.8000 1.0000 2.0000 0.0000 Constraint 285 1503 0.8000 1.0000 2.0000 0.0000 Constraint 285 1494 0.8000 1.0000 2.0000 0.0000 Constraint 285 1488 0.8000 1.0000 2.0000 0.0000 Constraint 285 1479 0.8000 1.0000 2.0000 0.0000 Constraint 285 1471 0.8000 1.0000 2.0000 0.0000 Constraint 285 1466 0.8000 1.0000 2.0000 0.0000 Constraint 285 1455 0.8000 1.0000 2.0000 0.0000 Constraint 285 1447 0.8000 1.0000 2.0000 0.0000 Constraint 285 1438 0.8000 1.0000 2.0000 0.0000 Constraint 285 1427 0.8000 1.0000 2.0000 0.0000 Constraint 285 1416 0.8000 1.0000 2.0000 0.0000 Constraint 285 1408 0.8000 1.0000 2.0000 0.0000 Constraint 285 1391 0.8000 1.0000 2.0000 0.0000 Constraint 285 1382 0.8000 1.0000 2.0000 0.0000 Constraint 285 1358 0.8000 1.0000 2.0000 0.0000 Constraint 285 1351 0.8000 1.0000 2.0000 0.0000 Constraint 285 1334 0.8000 1.0000 2.0000 0.0000 Constraint 285 1325 0.8000 1.0000 2.0000 0.0000 Constraint 285 1317 0.8000 1.0000 2.0000 0.0000 Constraint 285 1309 0.8000 1.0000 2.0000 0.0000 Constraint 285 1301 0.8000 1.0000 2.0000 0.0000 Constraint 285 1293 0.8000 1.0000 2.0000 0.0000 Constraint 285 1284 0.8000 1.0000 2.0000 0.0000 Constraint 285 1276 0.8000 1.0000 2.0000 0.0000 Constraint 285 1268 0.8000 1.0000 2.0000 0.0000 Constraint 285 1141 0.8000 1.0000 2.0000 0.0000 Constraint 285 1092 0.8000 1.0000 2.0000 0.0000 Constraint 285 1084 0.8000 1.0000 2.0000 0.0000 Constraint 285 908 0.8000 1.0000 2.0000 0.0000 Constraint 285 761 0.8000 1.0000 2.0000 0.0000 Constraint 285 748 0.8000 1.0000 2.0000 0.0000 Constraint 285 673 0.8000 1.0000 2.0000 0.0000 Constraint 285 347 0.8000 1.0000 2.0000 0.0000 Constraint 285 333 0.8000 1.0000 2.0000 0.0000 Constraint 285 325 0.8000 1.0000 2.0000 0.0000 Constraint 285 314 0.8000 1.0000 2.0000 0.0000 Constraint 285 306 0.8000 1.0000 2.0000 0.0000 Constraint 285 299 0.8000 1.0000 2.0000 0.0000 Constraint 285 294 0.8000 1.0000 2.0000 0.0000 Constraint 274 1788 0.8000 1.0000 2.0000 0.0000 Constraint 274 1764 0.8000 1.0000 2.0000 0.0000 Constraint 274 1756 0.8000 1.0000 2.0000 0.0000 Constraint 274 1748 0.8000 1.0000 2.0000 0.0000 Constraint 274 1720 0.8000 1.0000 2.0000 0.0000 Constraint 274 1662 0.8000 1.0000 2.0000 0.0000 Constraint 274 1620 0.8000 1.0000 2.0000 0.0000 Constraint 274 1611 0.8000 1.0000 2.0000 0.0000 Constraint 274 1575 0.8000 1.0000 2.0000 0.0000 Constraint 274 1556 0.8000 1.0000 2.0000 0.0000 Constraint 274 1548 0.8000 1.0000 2.0000 0.0000 Constraint 274 1541 0.8000 1.0000 2.0000 0.0000 Constraint 274 1533 0.8000 1.0000 2.0000 0.0000 Constraint 274 1519 0.8000 1.0000 2.0000 0.0000 Constraint 274 1494 0.8000 1.0000 2.0000 0.0000 Constraint 274 1447 0.8000 1.0000 2.0000 0.0000 Constraint 274 1408 0.8000 1.0000 2.0000 0.0000 Constraint 274 1399 0.8000 1.0000 2.0000 0.0000 Constraint 274 1391 0.8000 1.0000 2.0000 0.0000 Constraint 274 1382 0.8000 1.0000 2.0000 0.0000 Constraint 274 1374 0.8000 1.0000 2.0000 0.0000 Constraint 274 1358 0.8000 1.0000 2.0000 0.0000 Constraint 274 1351 0.8000 1.0000 2.0000 0.0000 Constraint 274 1334 0.8000 1.0000 2.0000 0.0000 Constraint 274 1309 0.8000 1.0000 2.0000 0.0000 Constraint 274 1301 0.8000 1.0000 2.0000 0.0000 Constraint 274 1246 0.8000 1.0000 2.0000 0.0000 Constraint 274 1178 0.8000 1.0000 2.0000 0.0000 Constraint 274 1084 0.8000 1.0000 2.0000 0.0000 Constraint 274 1059 0.8000 1.0000 2.0000 0.0000 Constraint 274 608 0.8000 1.0000 2.0000 0.0000 Constraint 274 479 0.8000 1.0000 2.0000 0.0000 Constraint 274 333 0.8000 1.0000 2.0000 0.0000 Constraint 274 325 0.8000 1.0000 2.0000 0.0000 Constraint 274 314 0.8000 1.0000 2.0000 0.0000 Constraint 274 306 0.8000 1.0000 2.0000 0.0000 Constraint 274 299 0.8000 1.0000 2.0000 0.0000 Constraint 274 294 0.8000 1.0000 2.0000 0.0000 Constraint 274 285 0.8000 1.0000 2.0000 0.0000 Constraint 263 1788 0.8000 1.0000 2.0000 0.0000 Constraint 263 1764 0.8000 1.0000 2.0000 0.0000 Constraint 263 1756 0.8000 1.0000 2.0000 0.0000 Constraint 263 1748 0.8000 1.0000 2.0000 0.0000 Constraint 263 1720 0.8000 1.0000 2.0000 0.0000 Constraint 263 1703 0.8000 1.0000 2.0000 0.0000 Constraint 263 1692 0.8000 1.0000 2.0000 0.0000 Constraint 263 1670 0.8000 1.0000 2.0000 0.0000 Constraint 263 1662 0.8000 1.0000 2.0000 0.0000 Constraint 263 1649 0.8000 1.0000 2.0000 0.0000 Constraint 263 1620 0.8000 1.0000 2.0000 0.0000 Constraint 263 1587 0.8000 1.0000 2.0000 0.0000 Constraint 263 1541 0.8000 1.0000 2.0000 0.0000 Constraint 263 1519 0.8000 1.0000 2.0000 0.0000 Constraint 263 1511 0.8000 1.0000 2.0000 0.0000 Constraint 263 1488 0.8000 1.0000 2.0000 0.0000 Constraint 263 1427 0.8000 1.0000 2.0000 0.0000 Constraint 263 1416 0.8000 1.0000 2.0000 0.0000 Constraint 263 1399 0.8000 1.0000 2.0000 0.0000 Constraint 263 1391 0.8000 1.0000 2.0000 0.0000 Constraint 263 1382 0.8000 1.0000 2.0000 0.0000 Constraint 263 1374 0.8000 1.0000 2.0000 0.0000 Constraint 263 1366 0.8000 1.0000 2.0000 0.0000 Constraint 263 1358 0.8000 1.0000 2.0000 0.0000 Constraint 263 1351 0.8000 1.0000 2.0000 0.0000 Constraint 263 1343 0.8000 1.0000 2.0000 0.0000 Constraint 263 1334 0.8000 1.0000 2.0000 0.0000 Constraint 263 1317 0.8000 1.0000 2.0000 0.0000 Constraint 263 1309 0.8000 1.0000 2.0000 0.0000 Constraint 263 1284 0.8000 1.0000 2.0000 0.0000 Constraint 263 1276 0.8000 1.0000 2.0000 0.0000 Constraint 263 1246 0.8000 1.0000 2.0000 0.0000 Constraint 263 1213 0.8000 1.0000 2.0000 0.0000 Constraint 263 1167 0.8000 1.0000 2.0000 0.0000 Constraint 263 1117 0.8000 1.0000 2.0000 0.0000 Constraint 263 1100 0.8000 1.0000 2.0000 0.0000 Constraint 263 1092 0.8000 1.0000 2.0000 0.0000 Constraint 263 1084 0.8000 1.0000 2.0000 0.0000 Constraint 263 1068 0.8000 1.0000 2.0000 0.0000 Constraint 263 1059 0.8000 1.0000 2.0000 0.0000 Constraint 263 1014 0.8000 1.0000 2.0000 0.0000 Constraint 263 921 0.8000 1.0000 2.0000 0.0000 Constraint 263 899 0.8000 1.0000 2.0000 0.0000 Constraint 263 650 0.8000 1.0000 2.0000 0.0000 Constraint 263 616 0.8000 1.0000 2.0000 0.0000 Constraint 263 429 0.8000 1.0000 2.0000 0.0000 Constraint 263 325 0.8000 1.0000 2.0000 0.0000 Constraint 263 314 0.8000 1.0000 2.0000 0.0000 Constraint 263 306 0.8000 1.0000 2.0000 0.0000 Constraint 263 299 0.8000 1.0000 2.0000 0.0000 Constraint 263 294 0.8000 1.0000 2.0000 0.0000 Constraint 263 285 0.8000 1.0000 2.0000 0.0000 Constraint 263 274 0.8000 1.0000 2.0000 0.0000 Constraint 256 1788 0.8000 1.0000 2.0000 0.0000 Constraint 256 1764 0.8000 1.0000 2.0000 0.0000 Constraint 256 1756 0.8000 1.0000 2.0000 0.0000 Constraint 256 1748 0.8000 1.0000 2.0000 0.0000 Constraint 256 1739 0.8000 1.0000 2.0000 0.0000 Constraint 256 1720 0.8000 1.0000 2.0000 0.0000 Constraint 256 1714 0.8000 1.0000 2.0000 0.0000 Constraint 256 1683 0.8000 1.0000 2.0000 0.0000 Constraint 256 1678 0.8000 1.0000 2.0000 0.0000 Constraint 256 1670 0.8000 1.0000 2.0000 0.0000 Constraint 256 1662 0.8000 1.0000 2.0000 0.0000 Constraint 256 1657 0.8000 1.0000 2.0000 0.0000 Constraint 256 1649 0.8000 1.0000 2.0000 0.0000 Constraint 256 1634 0.8000 1.0000 2.0000 0.0000 Constraint 256 1620 0.8000 1.0000 2.0000 0.0000 Constraint 256 1611 0.8000 1.0000 2.0000 0.0000 Constraint 256 1603 0.8000 1.0000 2.0000 0.0000 Constraint 256 1587 0.8000 1.0000 2.0000 0.0000 Constraint 256 1575 0.8000 1.0000 2.0000 0.0000 Constraint 256 1567 0.8000 1.0000 2.0000 0.0000 Constraint 256 1548 0.8000 1.0000 2.0000 0.0000 Constraint 256 1541 0.8000 1.0000 2.0000 0.0000 Constraint 256 1519 0.8000 1.0000 2.0000 0.0000 Constraint 256 1511 0.8000 1.0000 2.0000 0.0000 Constraint 256 1503 0.8000 1.0000 2.0000 0.0000 Constraint 256 1494 0.8000 1.0000 2.0000 0.0000 Constraint 256 1488 0.8000 1.0000 2.0000 0.0000 Constraint 256 1479 0.8000 1.0000 2.0000 0.0000 Constraint 256 1471 0.8000 1.0000 2.0000 0.0000 Constraint 256 1466 0.8000 1.0000 2.0000 0.0000 Constraint 256 1455 0.8000 1.0000 2.0000 0.0000 Constraint 256 1438 0.8000 1.0000 2.0000 0.0000 Constraint 256 1427 0.8000 1.0000 2.0000 0.0000 Constraint 256 1416 0.8000 1.0000 2.0000 0.0000 Constraint 256 1408 0.8000 1.0000 2.0000 0.0000 Constraint 256 1391 0.8000 1.0000 2.0000 0.0000 Constraint 256 1358 0.8000 1.0000 2.0000 0.0000 Constraint 256 1351 0.8000 1.0000 2.0000 0.0000 Constraint 256 1334 0.8000 1.0000 2.0000 0.0000 Constraint 256 1293 0.8000 1.0000 2.0000 0.0000 Constraint 256 1276 0.8000 1.0000 2.0000 0.0000 Constraint 256 1220 0.8000 1.0000 2.0000 0.0000 Constraint 256 1193 0.8000 1.0000 2.0000 0.0000 Constraint 256 1178 0.8000 1.0000 2.0000 0.0000 Constraint 256 1117 0.8000 1.0000 2.0000 0.0000 Constraint 256 1084 0.8000 1.0000 2.0000 0.0000 Constraint 256 1068 0.8000 1.0000 2.0000 0.0000 Constraint 256 1022 0.8000 1.0000 2.0000 0.0000 Constraint 256 988 0.8000 1.0000 2.0000 0.0000 Constraint 256 930 0.8000 1.0000 2.0000 0.0000 Constraint 256 908 0.8000 1.0000 2.0000 0.0000 Constraint 256 899 0.8000 1.0000 2.0000 0.0000 Constraint 256 836 0.8000 1.0000 2.0000 0.0000 Constraint 256 829 0.8000 1.0000 2.0000 0.0000 Constraint 256 818 0.8000 1.0000 2.0000 0.0000 Constraint 256 792 0.8000 1.0000 2.0000 0.0000 Constraint 256 783 0.8000 1.0000 2.0000 0.0000 Constraint 256 769 0.8000 1.0000 2.0000 0.0000 Constraint 256 761 0.8000 1.0000 2.0000 0.0000 Constraint 256 748 0.8000 1.0000 2.0000 0.0000 Constraint 256 681 0.8000 1.0000 2.0000 0.0000 Constraint 256 657 0.8000 1.0000 2.0000 0.0000 Constraint 256 630 0.8000 1.0000 2.0000 0.0000 Constraint 256 314 0.8000 1.0000 2.0000 0.0000 Constraint 256 306 0.8000 1.0000 2.0000 0.0000 Constraint 256 299 0.8000 1.0000 2.0000 0.0000 Constraint 256 294 0.8000 1.0000 2.0000 0.0000 Constraint 256 285 0.8000 1.0000 2.0000 0.0000 Constraint 256 274 0.8000 1.0000 2.0000 0.0000 Constraint 256 263 0.8000 1.0000 2.0000 0.0000 Constraint 249 1788 0.8000 1.0000 2.0000 0.0000 Constraint 249 1764 0.8000 1.0000 2.0000 0.0000 Constraint 249 1756 0.8000 1.0000 2.0000 0.0000 Constraint 249 1703 0.8000 1.0000 2.0000 0.0000 Constraint 249 1678 0.8000 1.0000 2.0000 0.0000 Constraint 249 1670 0.8000 1.0000 2.0000 0.0000 Constraint 249 1662 0.8000 1.0000 2.0000 0.0000 Constraint 249 1649 0.8000 1.0000 2.0000 0.0000 Constraint 249 1620 0.8000 1.0000 2.0000 0.0000 Constraint 249 1611 0.8000 1.0000 2.0000 0.0000 Constraint 249 1603 0.8000 1.0000 2.0000 0.0000 Constraint 249 1587 0.8000 1.0000 2.0000 0.0000 Constraint 249 1567 0.8000 1.0000 2.0000 0.0000 Constraint 249 1556 0.8000 1.0000 2.0000 0.0000 Constraint 249 1494 0.8000 1.0000 2.0000 0.0000 Constraint 249 1488 0.8000 1.0000 2.0000 0.0000 Constraint 249 1471 0.8000 1.0000 2.0000 0.0000 Constraint 249 1466 0.8000 1.0000 2.0000 0.0000 Constraint 249 1455 0.8000 1.0000 2.0000 0.0000 Constraint 249 1447 0.8000 1.0000 2.0000 0.0000 Constraint 249 1416 0.8000 1.0000 2.0000 0.0000 Constraint 249 1408 0.8000 1.0000 2.0000 0.0000 Constraint 249 1382 0.8000 1.0000 2.0000 0.0000 Constraint 249 1358 0.8000 1.0000 2.0000 0.0000 Constraint 249 1351 0.8000 1.0000 2.0000 0.0000 Constraint 249 1334 0.8000 1.0000 2.0000 0.0000 Constraint 249 1317 0.8000 1.0000 2.0000 0.0000 Constraint 249 1309 0.8000 1.0000 2.0000 0.0000 Constraint 249 1268 0.8000 1.0000 2.0000 0.0000 Constraint 249 1193 0.8000 1.0000 2.0000 0.0000 Constraint 249 1167 0.8000 1.0000 2.0000 0.0000 Constraint 249 1030 0.8000 1.0000 2.0000 0.0000 Constraint 249 1022 0.8000 1.0000 2.0000 0.0000 Constraint 249 930 0.8000 1.0000 2.0000 0.0000 Constraint 249 899 0.8000 1.0000 2.0000 0.0000 Constraint 249 650 0.8000 1.0000 2.0000 0.0000 Constraint 249 639 0.8000 1.0000 2.0000 0.0000 Constraint 249 630 0.8000 1.0000 2.0000 0.0000 Constraint 249 314 0.8000 1.0000 2.0000 0.0000 Constraint 249 306 0.8000 1.0000 2.0000 0.0000 Constraint 249 299 0.8000 1.0000 2.0000 0.0000 Constraint 249 294 0.8000 1.0000 2.0000 0.0000 Constraint 249 285 0.8000 1.0000 2.0000 0.0000 Constraint 249 274 0.8000 1.0000 2.0000 0.0000 Constraint 249 263 0.8000 1.0000 2.0000 0.0000 Constraint 249 256 0.8000 1.0000 2.0000 0.0000 Constraint 241 1788 0.8000 1.0000 2.0000 0.0000 Constraint 241 1772 0.8000 1.0000 2.0000 0.0000 Constraint 241 1764 0.8000 1.0000 2.0000 0.0000 Constraint 241 1756 0.8000 1.0000 2.0000 0.0000 Constraint 241 1739 0.8000 1.0000 2.0000 0.0000 Constraint 241 1703 0.8000 1.0000 2.0000 0.0000 Constraint 241 1683 0.8000 1.0000 2.0000 0.0000 Constraint 241 1678 0.8000 1.0000 2.0000 0.0000 Constraint 241 1670 0.8000 1.0000 2.0000 0.0000 Constraint 241 1662 0.8000 1.0000 2.0000 0.0000 Constraint 241 1657 0.8000 1.0000 2.0000 0.0000 Constraint 241 1620 0.8000 1.0000 2.0000 0.0000 Constraint 241 1587 0.8000 1.0000 2.0000 0.0000 Constraint 241 1503 0.8000 1.0000 2.0000 0.0000 Constraint 241 1488 0.8000 1.0000 2.0000 0.0000 Constraint 241 1455 0.8000 1.0000 2.0000 0.0000 Constraint 241 1416 0.8000 1.0000 2.0000 0.0000 Constraint 241 1391 0.8000 1.0000 2.0000 0.0000 Constraint 241 1374 0.8000 1.0000 2.0000 0.0000 Constraint 241 1366 0.8000 1.0000 2.0000 0.0000 Constraint 241 1343 0.8000 1.0000 2.0000 0.0000 Constraint 241 1334 0.8000 1.0000 2.0000 0.0000 Constraint 241 1317 0.8000 1.0000 2.0000 0.0000 Constraint 241 1246 0.8000 1.0000 2.0000 0.0000 Constraint 241 1193 0.8000 1.0000 2.0000 0.0000 Constraint 241 1149 0.8000 1.0000 2.0000 0.0000 Constraint 241 1125 0.8000 1.0000 2.0000 0.0000 Constraint 241 1117 0.8000 1.0000 2.0000 0.0000 Constraint 241 1068 0.8000 1.0000 2.0000 0.0000 Constraint 241 1059 0.8000 1.0000 2.0000 0.0000 Constraint 241 988 0.8000 1.0000 2.0000 0.0000 Constraint 241 899 0.8000 1.0000 2.0000 0.0000 Constraint 241 616 0.8000 1.0000 2.0000 0.0000 Constraint 241 429 0.8000 1.0000 2.0000 0.0000 Constraint 241 306 0.8000 1.0000 2.0000 0.0000 Constraint 241 299 0.8000 1.0000 2.0000 0.0000 Constraint 241 294 0.8000 1.0000 2.0000 0.0000 Constraint 241 285 0.8000 1.0000 2.0000 0.0000 Constraint 241 274 0.8000 1.0000 2.0000 0.0000 Constraint 241 263 0.8000 1.0000 2.0000 0.0000 Constraint 241 256 0.8000 1.0000 2.0000 0.0000 Constraint 241 249 0.8000 1.0000 2.0000 0.0000 Constraint 233 1788 0.8000 1.0000 2.0000 0.0000 Constraint 233 1772 0.8000 1.0000 2.0000 0.0000 Constraint 233 1764 0.8000 1.0000 2.0000 0.0000 Constraint 233 1756 0.8000 1.0000 2.0000 0.0000 Constraint 233 1748 0.8000 1.0000 2.0000 0.0000 Constraint 233 1739 0.8000 1.0000 2.0000 0.0000 Constraint 233 1731 0.8000 1.0000 2.0000 0.0000 Constraint 233 1714 0.8000 1.0000 2.0000 0.0000 Constraint 233 1703 0.8000 1.0000 2.0000 0.0000 Constraint 233 1683 0.8000 1.0000 2.0000 0.0000 Constraint 233 1670 0.8000 1.0000 2.0000 0.0000 Constraint 233 1662 0.8000 1.0000 2.0000 0.0000 Constraint 233 1657 0.8000 1.0000 2.0000 0.0000 Constraint 233 1649 0.8000 1.0000 2.0000 0.0000 Constraint 233 1634 0.8000 1.0000 2.0000 0.0000 Constraint 233 1611 0.8000 1.0000 2.0000 0.0000 Constraint 233 1541 0.8000 1.0000 2.0000 0.0000 Constraint 233 1519 0.8000 1.0000 2.0000 0.0000 Constraint 233 1511 0.8000 1.0000 2.0000 0.0000 Constraint 233 1503 0.8000 1.0000 2.0000 0.0000 Constraint 233 1488 0.8000 1.0000 2.0000 0.0000 Constraint 233 1427 0.8000 1.0000 2.0000 0.0000 Constraint 233 1416 0.8000 1.0000 2.0000 0.0000 Constraint 233 1358 0.8000 1.0000 2.0000 0.0000 Constraint 233 1351 0.8000 1.0000 2.0000 0.0000 Constraint 233 1334 0.8000 1.0000 2.0000 0.0000 Constraint 233 1317 0.8000 1.0000 2.0000 0.0000 Constraint 233 1228 0.8000 1.0000 2.0000 0.0000 Constraint 233 1220 0.8000 1.0000 2.0000 0.0000 Constraint 233 1213 0.8000 1.0000 2.0000 0.0000 Constraint 233 1204 0.8000 1.0000 2.0000 0.0000 Constraint 233 1141 0.8000 1.0000 2.0000 0.0000 Constraint 233 1117 0.8000 1.0000 2.0000 0.0000 Constraint 233 1092 0.8000 1.0000 2.0000 0.0000 Constraint 233 1084 0.8000 1.0000 2.0000 0.0000 Constraint 233 1059 0.8000 1.0000 2.0000 0.0000 Constraint 233 1054 0.8000 1.0000 2.0000 0.0000 Constraint 233 921 0.8000 1.0000 2.0000 0.0000 Constraint 233 899 0.8000 1.0000 2.0000 0.0000 Constraint 233 868 0.8000 1.0000 2.0000 0.0000 Constraint 233 848 0.8000 1.0000 2.0000 0.0000 Constraint 233 836 0.8000 1.0000 2.0000 0.0000 Constraint 233 818 0.8000 1.0000 2.0000 0.0000 Constraint 233 800 0.8000 1.0000 2.0000 0.0000 Constraint 233 761 0.8000 1.0000 2.0000 0.0000 Constraint 233 681 0.8000 1.0000 2.0000 0.0000 Constraint 233 630 0.8000 1.0000 2.0000 0.0000 Constraint 233 623 0.8000 1.0000 2.0000 0.0000 Constraint 233 616 0.8000 1.0000 2.0000 0.0000 Constraint 233 608 0.8000 1.0000 2.0000 0.0000 Constraint 233 429 0.8000 1.0000 2.0000 0.0000 Constraint 233 299 0.8000 1.0000 2.0000 0.0000 Constraint 233 294 0.8000 1.0000 2.0000 0.0000 Constraint 233 285 0.8000 1.0000 2.0000 0.0000 Constraint 233 274 0.8000 1.0000 2.0000 0.0000 Constraint 233 263 0.8000 1.0000 2.0000 0.0000 Constraint 233 256 0.8000 1.0000 2.0000 0.0000 Constraint 233 249 0.8000 1.0000 2.0000 0.0000 Constraint 233 241 0.8000 1.0000 2.0000 0.0000 Constraint 227 1788 0.8000 1.0000 2.0000 0.0000 Constraint 227 1777 0.8000 1.0000 2.0000 0.0000 Constraint 227 1772 0.8000 1.0000 2.0000 0.0000 Constraint 227 1764 0.8000 1.0000 2.0000 0.0000 Constraint 227 1756 0.8000 1.0000 2.0000 0.0000 Constraint 227 1748 0.8000 1.0000 2.0000 0.0000 Constraint 227 1703 0.8000 1.0000 2.0000 0.0000 Constraint 227 1683 0.8000 1.0000 2.0000 0.0000 Constraint 227 1678 0.8000 1.0000 2.0000 0.0000 Constraint 227 1670 0.8000 1.0000 2.0000 0.0000 Constraint 227 1662 0.8000 1.0000 2.0000 0.0000 Constraint 227 1649 0.8000 1.0000 2.0000 0.0000 Constraint 227 1634 0.8000 1.0000 2.0000 0.0000 Constraint 227 1620 0.8000 1.0000 2.0000 0.0000 Constraint 227 1603 0.8000 1.0000 2.0000 0.0000 Constraint 227 1596 0.8000 1.0000 2.0000 0.0000 Constraint 227 1567 0.8000 1.0000 2.0000 0.0000 Constraint 227 1556 0.8000 1.0000 2.0000 0.0000 Constraint 227 1511 0.8000 1.0000 2.0000 0.0000 Constraint 227 1488 0.8000 1.0000 2.0000 0.0000 Constraint 227 1479 0.8000 1.0000 2.0000 0.0000 Constraint 227 1455 0.8000 1.0000 2.0000 0.0000 Constraint 227 1447 0.8000 1.0000 2.0000 0.0000 Constraint 227 1416 0.8000 1.0000 2.0000 0.0000 Constraint 227 1408 0.8000 1.0000 2.0000 0.0000 Constraint 227 1391 0.8000 1.0000 2.0000 0.0000 Constraint 227 1351 0.8000 1.0000 2.0000 0.0000 Constraint 227 1334 0.8000 1.0000 2.0000 0.0000 Constraint 227 1317 0.8000 1.0000 2.0000 0.0000 Constraint 227 1220 0.8000 1.0000 2.0000 0.0000 Constraint 227 1204 0.8000 1.0000 2.0000 0.0000 Constraint 227 1193 0.8000 1.0000 2.0000 0.0000 Constraint 227 1167 0.8000 1.0000 2.0000 0.0000 Constraint 227 1125 0.8000 1.0000 2.0000 0.0000 Constraint 227 1092 0.8000 1.0000 2.0000 0.0000 Constraint 227 1068 0.8000 1.0000 2.0000 0.0000 Constraint 227 1022 0.8000 1.0000 2.0000 0.0000 Constraint 227 963 0.8000 1.0000 2.0000 0.0000 Constraint 227 930 0.8000 1.0000 2.0000 0.0000 Constraint 227 913 0.8000 1.0000 2.0000 0.0000 Constraint 227 908 0.8000 1.0000 2.0000 0.0000 Constraint 227 899 0.8000 1.0000 2.0000 0.0000 Constraint 227 848 0.8000 1.0000 2.0000 0.0000 Constraint 227 808 0.8000 1.0000 2.0000 0.0000 Constraint 227 783 0.8000 1.0000 2.0000 0.0000 Constraint 227 761 0.8000 1.0000 2.0000 0.0000 Constraint 227 756 0.8000 1.0000 2.0000 0.0000 Constraint 227 739 0.8000 1.0000 2.0000 0.0000 Constraint 227 706 0.8000 1.0000 2.0000 0.0000 Constraint 227 690 0.8000 1.0000 2.0000 0.0000 Constraint 227 681 0.8000 1.0000 2.0000 0.0000 Constraint 227 597 0.8000 1.0000 2.0000 0.0000 Constraint 227 589 0.8000 1.0000 2.0000 0.0000 Constraint 227 579 0.8000 1.0000 2.0000 0.0000 Constraint 227 375 0.8000 1.0000 2.0000 0.0000 Constraint 227 347 0.8000 1.0000 2.0000 0.0000 Constraint 227 294 0.8000 1.0000 2.0000 0.0000 Constraint 227 285 0.8000 1.0000 2.0000 0.0000 Constraint 227 274 0.8000 1.0000 2.0000 0.0000 Constraint 227 263 0.8000 1.0000 2.0000 0.0000 Constraint 227 256 0.8000 1.0000 2.0000 0.0000 Constraint 227 249 0.8000 1.0000 2.0000 0.0000 Constraint 227 241 0.8000 1.0000 2.0000 0.0000 Constraint 227 233 0.8000 1.0000 2.0000 0.0000 Constraint 222 1788 0.8000 1.0000 2.0000 0.0000 Constraint 222 1777 0.8000 1.0000 2.0000 0.0000 Constraint 222 1772 0.8000 1.0000 2.0000 0.0000 Constraint 222 1764 0.8000 1.0000 2.0000 0.0000 Constraint 222 1748 0.8000 1.0000 2.0000 0.0000 Constraint 222 1683 0.8000 1.0000 2.0000 0.0000 Constraint 222 1678 0.8000 1.0000 2.0000 0.0000 Constraint 222 1662 0.8000 1.0000 2.0000 0.0000 Constraint 222 1657 0.8000 1.0000 2.0000 0.0000 Constraint 222 1634 0.8000 1.0000 2.0000 0.0000 Constraint 222 1620 0.8000 1.0000 2.0000 0.0000 Constraint 222 1611 0.8000 1.0000 2.0000 0.0000 Constraint 222 1603 0.8000 1.0000 2.0000 0.0000 Constraint 222 1596 0.8000 1.0000 2.0000 0.0000 Constraint 222 1587 0.8000 1.0000 2.0000 0.0000 Constraint 222 1575 0.8000 1.0000 2.0000 0.0000 Constraint 222 1548 0.8000 1.0000 2.0000 0.0000 Constraint 222 1488 0.8000 1.0000 2.0000 0.0000 Constraint 222 1479 0.8000 1.0000 2.0000 0.0000 Constraint 222 1455 0.8000 1.0000 2.0000 0.0000 Constraint 222 1391 0.8000 1.0000 2.0000 0.0000 Constraint 222 1366 0.8000 1.0000 2.0000 0.0000 Constraint 222 1351 0.8000 1.0000 2.0000 0.0000 Constraint 222 1334 0.8000 1.0000 2.0000 0.0000 Constraint 222 1301 0.8000 1.0000 2.0000 0.0000 Constraint 222 1220 0.8000 1.0000 2.0000 0.0000 Constraint 222 1213 0.8000 1.0000 2.0000 0.0000 Constraint 222 1204 0.8000 1.0000 2.0000 0.0000 Constraint 222 1125 0.8000 1.0000 2.0000 0.0000 Constraint 222 1068 0.8000 1.0000 2.0000 0.0000 Constraint 222 1022 0.8000 1.0000 2.0000 0.0000 Constraint 222 988 0.8000 1.0000 2.0000 0.0000 Constraint 222 884 0.8000 1.0000 2.0000 0.0000 Constraint 222 859 0.8000 1.0000 2.0000 0.0000 Constraint 222 706 0.8000 1.0000 2.0000 0.0000 Constraint 222 639 0.8000 1.0000 2.0000 0.0000 Constraint 222 630 0.8000 1.0000 2.0000 0.0000 Constraint 222 579 0.8000 1.0000 2.0000 0.0000 Constraint 222 487 0.8000 1.0000 2.0000 0.0000 Constraint 222 285 0.8000 1.0000 2.0000 0.0000 Constraint 222 274 0.8000 1.0000 2.0000 0.0000 Constraint 222 263 0.8000 1.0000 2.0000 0.0000 Constraint 222 256 0.8000 1.0000 2.0000 0.0000 Constraint 222 249 0.8000 1.0000 2.0000 0.0000 Constraint 222 241 0.8000 1.0000 2.0000 0.0000 Constraint 222 233 0.8000 1.0000 2.0000 0.0000 Constraint 222 227 0.8000 1.0000 2.0000 0.0000 Constraint 216 1788 0.8000 1.0000 2.0000 0.0000 Constraint 216 1777 0.8000 1.0000 2.0000 0.0000 Constraint 216 1772 0.8000 1.0000 2.0000 0.0000 Constraint 216 1764 0.8000 1.0000 2.0000 0.0000 Constraint 216 1739 0.8000 1.0000 2.0000 0.0000 Constraint 216 1703 0.8000 1.0000 2.0000 0.0000 Constraint 216 1683 0.8000 1.0000 2.0000 0.0000 Constraint 216 1678 0.8000 1.0000 2.0000 0.0000 Constraint 216 1662 0.8000 1.0000 2.0000 0.0000 Constraint 216 1657 0.8000 1.0000 2.0000 0.0000 Constraint 216 1649 0.8000 1.0000 2.0000 0.0000 Constraint 216 1634 0.8000 1.0000 2.0000 0.0000 Constraint 216 1620 0.8000 1.0000 2.0000 0.0000 Constraint 216 1611 0.8000 1.0000 2.0000 0.0000 Constraint 216 1587 0.8000 1.0000 2.0000 0.0000 Constraint 216 1511 0.8000 1.0000 2.0000 0.0000 Constraint 216 1334 0.8000 1.0000 2.0000 0.0000 Constraint 216 1325 0.8000 1.0000 2.0000 0.0000 Constraint 216 1284 0.8000 1.0000 2.0000 0.0000 Constraint 216 1251 0.8000 1.0000 2.0000 0.0000 Constraint 216 1228 0.8000 1.0000 2.0000 0.0000 Constraint 216 1220 0.8000 1.0000 2.0000 0.0000 Constraint 216 1149 0.8000 1.0000 2.0000 0.0000 Constraint 216 988 0.8000 1.0000 2.0000 0.0000 Constraint 216 944 0.8000 1.0000 2.0000 0.0000 Constraint 216 921 0.8000 1.0000 2.0000 0.0000 Constraint 216 859 0.8000 1.0000 2.0000 0.0000 Constraint 216 836 0.8000 1.0000 2.0000 0.0000 Constraint 216 616 0.8000 1.0000 2.0000 0.0000 Constraint 216 435 0.8000 1.0000 2.0000 0.0000 Constraint 216 274 0.8000 1.0000 2.0000 0.0000 Constraint 216 263 0.8000 1.0000 2.0000 0.0000 Constraint 216 256 0.8000 1.0000 2.0000 0.0000 Constraint 216 249 0.8000 1.0000 2.0000 0.0000 Constraint 216 241 0.8000 1.0000 2.0000 0.0000 Constraint 216 233 0.8000 1.0000 2.0000 0.0000 Constraint 216 227 0.8000 1.0000 2.0000 0.0000 Constraint 216 222 0.8000 1.0000 2.0000 0.0000 Constraint 208 1788 0.8000 1.0000 2.0000 0.0000 Constraint 208 1777 0.8000 1.0000 2.0000 0.0000 Constraint 208 1772 0.8000 1.0000 2.0000 0.0000 Constraint 208 1764 0.8000 1.0000 2.0000 0.0000 Constraint 208 1756 0.8000 1.0000 2.0000 0.0000 Constraint 208 1748 0.8000 1.0000 2.0000 0.0000 Constraint 208 1739 0.8000 1.0000 2.0000 0.0000 Constraint 208 1720 0.8000 1.0000 2.0000 0.0000 Constraint 208 1714 0.8000 1.0000 2.0000 0.0000 Constraint 208 1703 0.8000 1.0000 2.0000 0.0000 Constraint 208 1692 0.8000 1.0000 2.0000 0.0000 Constraint 208 1683 0.8000 1.0000 2.0000 0.0000 Constraint 208 1678 0.8000 1.0000 2.0000 0.0000 Constraint 208 1670 0.8000 1.0000 2.0000 0.0000 Constraint 208 1662 0.8000 1.0000 2.0000 0.0000 Constraint 208 1657 0.8000 1.0000 2.0000 0.0000 Constraint 208 1649 0.8000 1.0000 2.0000 0.0000 Constraint 208 1548 0.8000 1.0000 2.0000 0.0000 Constraint 208 1519 0.8000 1.0000 2.0000 0.0000 Constraint 208 1511 0.8000 1.0000 2.0000 0.0000 Constraint 208 1503 0.8000 1.0000 2.0000 0.0000 Constraint 208 1494 0.8000 1.0000 2.0000 0.0000 Constraint 208 1488 0.8000 1.0000 2.0000 0.0000 Constraint 208 1479 0.8000 1.0000 2.0000 0.0000 Constraint 208 1447 0.8000 1.0000 2.0000 0.0000 Constraint 208 1399 0.8000 1.0000 2.0000 0.0000 Constraint 208 1334 0.8000 1.0000 2.0000 0.0000 Constraint 208 1268 0.8000 1.0000 2.0000 0.0000 Constraint 208 1167 0.8000 1.0000 2.0000 0.0000 Constraint 208 1133 0.8000 1.0000 2.0000 0.0000 Constraint 208 1117 0.8000 1.0000 2.0000 0.0000 Constraint 208 1109 0.8000 1.0000 2.0000 0.0000 Constraint 208 1092 0.8000 1.0000 2.0000 0.0000 Constraint 208 988 0.8000 1.0000 2.0000 0.0000 Constraint 208 980 0.8000 1.0000 2.0000 0.0000 Constraint 208 937 0.8000 1.0000 2.0000 0.0000 Constraint 208 921 0.8000 1.0000 2.0000 0.0000 Constraint 208 913 0.8000 1.0000 2.0000 0.0000 Constraint 208 908 0.8000 1.0000 2.0000 0.0000 Constraint 208 899 0.8000 1.0000 2.0000 0.0000 Constraint 208 859 0.8000 1.0000 2.0000 0.0000 Constraint 208 836 0.8000 1.0000 2.0000 0.0000 Constraint 208 829 0.8000 1.0000 2.0000 0.0000 Constraint 208 808 0.8000 1.0000 2.0000 0.0000 Constraint 208 800 0.8000 1.0000 2.0000 0.0000 Constraint 208 792 0.8000 1.0000 2.0000 0.0000 Constraint 208 783 0.8000 1.0000 2.0000 0.0000 Constraint 208 769 0.8000 1.0000 2.0000 0.0000 Constraint 208 761 0.8000 1.0000 2.0000 0.0000 Constraint 208 739 0.8000 1.0000 2.0000 0.0000 Constraint 208 713 0.8000 1.0000 2.0000 0.0000 Constraint 208 681 0.8000 1.0000 2.0000 0.0000 Constraint 208 608 0.8000 1.0000 2.0000 0.0000 Constraint 208 375 0.8000 1.0000 2.0000 0.0000 Constraint 208 368 0.8000 1.0000 2.0000 0.0000 Constraint 208 263 0.8000 1.0000 2.0000 0.0000 Constraint 208 256 0.8000 1.0000 2.0000 0.0000 Constraint 208 249 0.8000 1.0000 2.0000 0.0000 Constraint 208 241 0.8000 1.0000 2.0000 0.0000 Constraint 208 233 0.8000 1.0000 2.0000 0.0000 Constraint 208 227 0.8000 1.0000 2.0000 0.0000 Constraint 208 222 0.8000 1.0000 2.0000 0.0000 Constraint 208 216 0.8000 1.0000 2.0000 0.0000 Constraint 196 1777 0.8000 1.0000 2.0000 0.0000 Constraint 196 1772 0.8000 1.0000 2.0000 0.0000 Constraint 196 1764 0.8000 1.0000 2.0000 0.0000 Constraint 196 1748 0.8000 1.0000 2.0000 0.0000 Constraint 196 1703 0.8000 1.0000 2.0000 0.0000 Constraint 196 1692 0.8000 1.0000 2.0000 0.0000 Constraint 196 1683 0.8000 1.0000 2.0000 0.0000 Constraint 196 1678 0.8000 1.0000 2.0000 0.0000 Constraint 196 1662 0.8000 1.0000 2.0000 0.0000 Constraint 196 1657 0.8000 1.0000 2.0000 0.0000 Constraint 196 1634 0.8000 1.0000 2.0000 0.0000 Constraint 196 1620 0.8000 1.0000 2.0000 0.0000 Constraint 196 1611 0.8000 1.0000 2.0000 0.0000 Constraint 196 1603 0.8000 1.0000 2.0000 0.0000 Constraint 196 1575 0.8000 1.0000 2.0000 0.0000 Constraint 196 1548 0.8000 1.0000 2.0000 0.0000 Constraint 196 1511 0.8000 1.0000 2.0000 0.0000 Constraint 196 1494 0.8000 1.0000 2.0000 0.0000 Constraint 196 1479 0.8000 1.0000 2.0000 0.0000 Constraint 196 1447 0.8000 1.0000 2.0000 0.0000 Constraint 196 1391 0.8000 1.0000 2.0000 0.0000 Constraint 196 1382 0.8000 1.0000 2.0000 0.0000 Constraint 196 1366 0.8000 1.0000 2.0000 0.0000 Constraint 196 1251 0.8000 1.0000 2.0000 0.0000 Constraint 196 1228 0.8000 1.0000 2.0000 0.0000 Constraint 196 1220 0.8000 1.0000 2.0000 0.0000 Constraint 196 1022 0.8000 1.0000 2.0000 0.0000 Constraint 196 913 0.8000 1.0000 2.0000 0.0000 Constraint 196 908 0.8000 1.0000 2.0000 0.0000 Constraint 196 899 0.8000 1.0000 2.0000 0.0000 Constraint 196 859 0.8000 1.0000 2.0000 0.0000 Constraint 196 783 0.8000 1.0000 2.0000 0.0000 Constraint 196 756 0.8000 1.0000 2.0000 0.0000 Constraint 196 698 0.8000 1.0000 2.0000 0.0000 Constraint 196 690 0.8000 1.0000 2.0000 0.0000 Constraint 196 681 0.8000 1.0000 2.0000 0.0000 Constraint 196 639 0.8000 1.0000 2.0000 0.0000 Constraint 196 616 0.8000 1.0000 2.0000 0.0000 Constraint 196 608 0.8000 1.0000 2.0000 0.0000 Constraint 196 435 0.8000 1.0000 2.0000 0.0000 Constraint 196 429 0.8000 1.0000 2.0000 0.0000 Constraint 196 384 0.8000 1.0000 2.0000 0.0000 Constraint 196 375 0.8000 1.0000 2.0000 0.0000 Constraint 196 347 0.8000 1.0000 2.0000 0.0000 Constraint 196 256 0.8000 1.0000 2.0000 0.0000 Constraint 196 249 0.8000 1.0000 2.0000 0.0000 Constraint 196 241 0.8000 1.0000 2.0000 0.0000 Constraint 196 233 0.8000 1.0000 2.0000 0.0000 Constraint 196 227 0.8000 1.0000 2.0000 0.0000 Constraint 196 222 0.8000 1.0000 2.0000 0.0000 Constraint 196 216 0.8000 1.0000 2.0000 0.0000 Constraint 196 208 0.8000 1.0000 2.0000 0.0000 Constraint 189 1777 0.8000 1.0000 2.0000 0.0000 Constraint 189 1764 0.8000 1.0000 2.0000 0.0000 Constraint 189 1703 0.8000 1.0000 2.0000 0.0000 Constraint 189 1683 0.8000 1.0000 2.0000 0.0000 Constraint 189 1678 0.8000 1.0000 2.0000 0.0000 Constraint 189 1662 0.8000 1.0000 2.0000 0.0000 Constraint 189 1657 0.8000 1.0000 2.0000 0.0000 Constraint 189 1649 0.8000 1.0000 2.0000 0.0000 Constraint 189 1620 0.8000 1.0000 2.0000 0.0000 Constraint 189 1611 0.8000 1.0000 2.0000 0.0000 Constraint 189 1603 0.8000 1.0000 2.0000 0.0000 Constraint 189 1548 0.8000 1.0000 2.0000 0.0000 Constraint 189 1541 0.8000 1.0000 2.0000 0.0000 Constraint 189 1511 0.8000 1.0000 2.0000 0.0000 Constraint 189 1427 0.8000 1.0000 2.0000 0.0000 Constraint 189 1358 0.8000 1.0000 2.0000 0.0000 Constraint 189 1301 0.8000 1.0000 2.0000 0.0000 Constraint 189 1276 0.8000 1.0000 2.0000 0.0000 Constraint 189 1251 0.8000 1.0000 2.0000 0.0000 Constraint 189 1228 0.8000 1.0000 2.0000 0.0000 Constraint 189 1220 0.8000 1.0000 2.0000 0.0000 Constraint 189 1204 0.8000 1.0000 2.0000 0.0000 Constraint 189 1149 0.8000 1.0000 2.0000 0.0000 Constraint 189 1125 0.8000 1.0000 2.0000 0.0000 Constraint 189 1014 0.8000 1.0000 2.0000 0.0000 Constraint 189 988 0.8000 1.0000 2.0000 0.0000 Constraint 189 930 0.8000 1.0000 2.0000 0.0000 Constraint 189 616 0.8000 1.0000 2.0000 0.0000 Constraint 189 579 0.8000 1.0000 2.0000 0.0000 Constraint 189 457 0.8000 1.0000 2.0000 0.0000 Constraint 189 435 0.8000 1.0000 2.0000 0.0000 Constraint 189 429 0.8000 1.0000 2.0000 0.0000 Constraint 189 355 0.8000 1.0000 2.0000 0.0000 Constraint 189 347 0.8000 1.0000 2.0000 0.0000 Constraint 189 249 0.8000 1.0000 2.0000 0.0000 Constraint 189 241 0.8000 1.0000 2.0000 0.0000 Constraint 189 233 0.8000 1.0000 2.0000 0.0000 Constraint 189 227 0.8000 1.0000 2.0000 0.0000 Constraint 189 222 0.8000 1.0000 2.0000 0.0000 Constraint 189 216 0.8000 1.0000 2.0000 0.0000 Constraint 189 208 0.8000 1.0000 2.0000 0.0000 Constraint 189 196 0.8000 1.0000 2.0000 0.0000 Constraint 180 1788 0.8000 1.0000 2.0000 0.0000 Constraint 180 1777 0.8000 1.0000 2.0000 0.0000 Constraint 180 1739 0.8000 1.0000 2.0000 0.0000 Constraint 180 1731 0.8000 1.0000 2.0000 0.0000 Constraint 180 1720 0.8000 1.0000 2.0000 0.0000 Constraint 180 1714 0.8000 1.0000 2.0000 0.0000 Constraint 180 1703 0.8000 1.0000 2.0000 0.0000 Constraint 180 1692 0.8000 1.0000 2.0000 0.0000 Constraint 180 1683 0.8000 1.0000 2.0000 0.0000 Constraint 180 1678 0.8000 1.0000 2.0000 0.0000 Constraint 180 1670 0.8000 1.0000 2.0000 0.0000 Constraint 180 1657 0.8000 1.0000 2.0000 0.0000 Constraint 180 1649 0.8000 1.0000 2.0000 0.0000 Constraint 180 1620 0.8000 1.0000 2.0000 0.0000 Constraint 180 1611 0.8000 1.0000 2.0000 0.0000 Constraint 180 1596 0.8000 1.0000 2.0000 0.0000 Constraint 180 1587 0.8000 1.0000 2.0000 0.0000 Constraint 180 1541 0.8000 1.0000 2.0000 0.0000 Constraint 180 1519 0.8000 1.0000 2.0000 0.0000 Constraint 180 1494 0.8000 1.0000 2.0000 0.0000 Constraint 180 1479 0.8000 1.0000 2.0000 0.0000 Constraint 180 1427 0.8000 1.0000 2.0000 0.0000 Constraint 180 1416 0.8000 1.0000 2.0000 0.0000 Constraint 180 1358 0.8000 1.0000 2.0000 0.0000 Constraint 180 1343 0.8000 1.0000 2.0000 0.0000 Constraint 180 1334 0.8000 1.0000 2.0000 0.0000 Constraint 180 1325 0.8000 1.0000 2.0000 0.0000 Constraint 180 1284 0.8000 1.0000 2.0000 0.0000 Constraint 180 1276 0.8000 1.0000 2.0000 0.0000 Constraint 180 1251 0.8000 1.0000 2.0000 0.0000 Constraint 180 1246 0.8000 1.0000 2.0000 0.0000 Constraint 180 1178 0.8000 1.0000 2.0000 0.0000 Constraint 180 1149 0.8000 1.0000 2.0000 0.0000 Constraint 180 1125 0.8000 1.0000 2.0000 0.0000 Constraint 180 1109 0.8000 1.0000 2.0000 0.0000 Constraint 180 1092 0.8000 1.0000 2.0000 0.0000 Constraint 180 1084 0.8000 1.0000 2.0000 0.0000 Constraint 180 1068 0.8000 1.0000 2.0000 0.0000 Constraint 180 1035 0.8000 1.0000 2.0000 0.0000 Constraint 180 1014 0.8000 1.0000 2.0000 0.0000 Constraint 180 988 0.8000 1.0000 2.0000 0.0000 Constraint 180 955 0.8000 1.0000 2.0000 0.0000 Constraint 180 937 0.8000 1.0000 2.0000 0.0000 Constraint 180 930 0.8000 1.0000 2.0000 0.0000 Constraint 180 921 0.8000 1.0000 2.0000 0.0000 Constraint 180 913 0.8000 1.0000 2.0000 0.0000 Constraint 180 908 0.8000 1.0000 2.0000 0.0000 Constraint 180 899 0.8000 1.0000 2.0000 0.0000 Constraint 180 892 0.8000 1.0000 2.0000 0.0000 Constraint 180 884 0.8000 1.0000 2.0000 0.0000 Constraint 180 836 0.8000 1.0000 2.0000 0.0000 Constraint 180 808 0.8000 1.0000 2.0000 0.0000 Constraint 180 713 0.8000 1.0000 2.0000 0.0000 Constraint 180 706 0.8000 1.0000 2.0000 0.0000 Constraint 180 403 0.8000 1.0000 2.0000 0.0000 Constraint 180 241 0.8000 1.0000 2.0000 0.0000 Constraint 180 233 0.8000 1.0000 2.0000 0.0000 Constraint 180 227 0.8000 1.0000 2.0000 0.0000 Constraint 180 222 0.8000 1.0000 2.0000 0.0000 Constraint 180 216 0.8000 1.0000 2.0000 0.0000 Constraint 180 208 0.8000 1.0000 2.0000 0.0000 Constraint 180 196 0.8000 1.0000 2.0000 0.0000 Constraint 180 189 0.8000 1.0000 2.0000 0.0000 Constraint 172 1788 0.8000 1.0000 2.0000 0.0000 Constraint 172 1777 0.8000 1.0000 2.0000 0.0000 Constraint 172 1772 0.8000 1.0000 2.0000 0.0000 Constraint 172 1764 0.8000 1.0000 2.0000 0.0000 Constraint 172 1748 0.8000 1.0000 2.0000 0.0000 Constraint 172 1739 0.8000 1.0000 2.0000 0.0000 Constraint 172 1720 0.8000 1.0000 2.0000 0.0000 Constraint 172 1714 0.8000 1.0000 2.0000 0.0000 Constraint 172 1703 0.8000 1.0000 2.0000 0.0000 Constraint 172 1692 0.8000 1.0000 2.0000 0.0000 Constraint 172 1683 0.8000 1.0000 2.0000 0.0000 Constraint 172 1678 0.8000 1.0000 2.0000 0.0000 Constraint 172 1670 0.8000 1.0000 2.0000 0.0000 Constraint 172 1662 0.8000 1.0000 2.0000 0.0000 Constraint 172 1657 0.8000 1.0000 2.0000 0.0000 Constraint 172 1649 0.8000 1.0000 2.0000 0.0000 Constraint 172 1634 0.8000 1.0000 2.0000 0.0000 Constraint 172 1620 0.8000 1.0000 2.0000 0.0000 Constraint 172 1603 0.8000 1.0000 2.0000 0.0000 Constraint 172 1596 0.8000 1.0000 2.0000 0.0000 Constraint 172 1575 0.8000 1.0000 2.0000 0.0000 Constraint 172 1567 0.8000 1.0000 2.0000 0.0000 Constraint 172 1548 0.8000 1.0000 2.0000 0.0000 Constraint 172 1541 0.8000 1.0000 2.0000 0.0000 Constraint 172 1533 0.8000 1.0000 2.0000 0.0000 Constraint 172 1526 0.8000 1.0000 2.0000 0.0000 Constraint 172 1511 0.8000 1.0000 2.0000 0.0000 Constraint 172 1503 0.8000 1.0000 2.0000 0.0000 Constraint 172 1479 0.8000 1.0000 2.0000 0.0000 Constraint 172 1471 0.8000 1.0000 2.0000 0.0000 Constraint 172 1447 0.8000 1.0000 2.0000 0.0000 Constraint 172 1438 0.8000 1.0000 2.0000 0.0000 Constraint 172 1427 0.8000 1.0000 2.0000 0.0000 Constraint 172 1416 0.8000 1.0000 2.0000 0.0000 Constraint 172 1408 0.8000 1.0000 2.0000 0.0000 Constraint 172 1399 0.8000 1.0000 2.0000 0.0000 Constraint 172 1391 0.8000 1.0000 2.0000 0.0000 Constraint 172 1382 0.8000 1.0000 2.0000 0.0000 Constraint 172 1317 0.8000 1.0000 2.0000 0.0000 Constraint 172 1284 0.8000 1.0000 2.0000 0.0000 Constraint 172 1276 0.8000 1.0000 2.0000 0.0000 Constraint 172 1260 0.8000 1.0000 2.0000 0.0000 Constraint 172 1251 0.8000 1.0000 2.0000 0.0000 Constraint 172 1178 0.8000 1.0000 2.0000 0.0000 Constraint 172 1158 0.8000 1.0000 2.0000 0.0000 Constraint 172 1149 0.8000 1.0000 2.0000 0.0000 Constraint 172 1141 0.8000 1.0000 2.0000 0.0000 Constraint 172 1133 0.8000 1.0000 2.0000 0.0000 Constraint 172 1125 0.8000 1.0000 2.0000 0.0000 Constraint 172 1117 0.8000 1.0000 2.0000 0.0000 Constraint 172 1109 0.8000 1.0000 2.0000 0.0000 Constraint 172 1100 0.8000 1.0000 2.0000 0.0000 Constraint 172 1084 0.8000 1.0000 2.0000 0.0000 Constraint 172 1077 0.8000 1.0000 2.0000 0.0000 Constraint 172 1068 0.8000 1.0000 2.0000 0.0000 Constraint 172 1035 0.8000 1.0000 2.0000 0.0000 Constraint 172 1022 0.8000 1.0000 2.0000 0.0000 Constraint 172 1014 0.8000 1.0000 2.0000 0.0000 Constraint 172 997 0.8000 1.0000 2.0000 0.0000 Constraint 172 988 0.8000 1.0000 2.0000 0.0000 Constraint 172 980 0.8000 1.0000 2.0000 0.0000 Constraint 172 955 0.8000 1.0000 2.0000 0.0000 Constraint 172 944 0.8000 1.0000 2.0000 0.0000 Constraint 172 930 0.8000 1.0000 2.0000 0.0000 Constraint 172 921 0.8000 1.0000 2.0000 0.0000 Constraint 172 913 0.8000 1.0000 2.0000 0.0000 Constraint 172 908 0.8000 1.0000 2.0000 0.0000 Constraint 172 899 0.8000 1.0000 2.0000 0.0000 Constraint 172 876 0.8000 1.0000 2.0000 0.0000 Constraint 172 868 0.8000 1.0000 2.0000 0.0000 Constraint 172 859 0.8000 1.0000 2.0000 0.0000 Constraint 172 829 0.8000 1.0000 2.0000 0.0000 Constraint 172 800 0.8000 1.0000 2.0000 0.0000 Constraint 172 783 0.8000 1.0000 2.0000 0.0000 Constraint 172 778 0.8000 1.0000 2.0000 0.0000 Constraint 172 761 0.8000 1.0000 2.0000 0.0000 Constraint 172 756 0.8000 1.0000 2.0000 0.0000 Constraint 172 739 0.8000 1.0000 2.0000 0.0000 Constraint 172 731 0.8000 1.0000 2.0000 0.0000 Constraint 172 722 0.8000 1.0000 2.0000 0.0000 Constraint 172 713 0.8000 1.0000 2.0000 0.0000 Constraint 172 706 0.8000 1.0000 2.0000 0.0000 Constraint 172 698 0.8000 1.0000 2.0000 0.0000 Constraint 172 690 0.8000 1.0000 2.0000 0.0000 Constraint 172 681 0.8000 1.0000 2.0000 0.0000 Constraint 172 673 0.8000 1.0000 2.0000 0.0000 Constraint 172 639 0.8000 1.0000 2.0000 0.0000 Constraint 172 549 0.8000 1.0000 2.0000 0.0000 Constraint 172 403 0.8000 1.0000 2.0000 0.0000 Constraint 172 368 0.8000 1.0000 2.0000 0.0000 Constraint 172 347 0.8000 1.0000 2.0000 0.0000 Constraint 172 233 0.8000 1.0000 2.0000 0.0000 Constraint 172 227 0.8000 1.0000 2.0000 0.0000 Constraint 172 222 0.8000 1.0000 2.0000 0.0000 Constraint 172 216 0.8000 1.0000 2.0000 0.0000 Constraint 172 208 0.8000 1.0000 2.0000 0.0000 Constraint 172 196 0.8000 1.0000 2.0000 0.0000 Constraint 172 189 0.8000 1.0000 2.0000 0.0000 Constraint 172 180 0.8000 1.0000 2.0000 0.0000 Constraint 164 1772 0.8000 1.0000 2.0000 0.0000 Constraint 164 1764 0.8000 1.0000 2.0000 0.0000 Constraint 164 1731 0.8000 1.0000 2.0000 0.0000 Constraint 164 1720 0.8000 1.0000 2.0000 0.0000 Constraint 164 1692 0.8000 1.0000 2.0000 0.0000 Constraint 164 1683 0.8000 1.0000 2.0000 0.0000 Constraint 164 1662 0.8000 1.0000 2.0000 0.0000 Constraint 164 1657 0.8000 1.0000 2.0000 0.0000 Constraint 164 1649 0.8000 1.0000 2.0000 0.0000 Constraint 164 1634 0.8000 1.0000 2.0000 0.0000 Constraint 164 1620 0.8000 1.0000 2.0000 0.0000 Constraint 164 1611 0.8000 1.0000 2.0000 0.0000 Constraint 164 1596 0.8000 1.0000 2.0000 0.0000 Constraint 164 1567 0.8000 1.0000 2.0000 0.0000 Constraint 164 1541 0.8000 1.0000 2.0000 0.0000 Constraint 164 1519 0.8000 1.0000 2.0000 0.0000 Constraint 164 1511 0.8000 1.0000 2.0000 0.0000 Constraint 164 1427 0.8000 1.0000 2.0000 0.0000 Constraint 164 1416 0.8000 1.0000 2.0000 0.0000 Constraint 164 1391 0.8000 1.0000 2.0000 0.0000 Constraint 164 1276 0.8000 1.0000 2.0000 0.0000 Constraint 164 1251 0.8000 1.0000 2.0000 0.0000 Constraint 164 1246 0.8000 1.0000 2.0000 0.0000 Constraint 164 1228 0.8000 1.0000 2.0000 0.0000 Constraint 164 1213 0.8000 1.0000 2.0000 0.0000 Constraint 164 1158 0.8000 1.0000 2.0000 0.0000 Constraint 164 1149 0.8000 1.0000 2.0000 0.0000 Constraint 164 1125 0.8000 1.0000 2.0000 0.0000 Constraint 164 1100 0.8000 1.0000 2.0000 0.0000 Constraint 164 921 0.8000 1.0000 2.0000 0.0000 Constraint 164 913 0.8000 1.0000 2.0000 0.0000 Constraint 164 908 0.8000 1.0000 2.0000 0.0000 Constraint 164 899 0.8000 1.0000 2.0000 0.0000 Constraint 164 892 0.8000 1.0000 2.0000 0.0000 Constraint 164 783 0.8000 1.0000 2.0000 0.0000 Constraint 164 769 0.8000 1.0000 2.0000 0.0000 Constraint 164 739 0.8000 1.0000 2.0000 0.0000 Constraint 164 713 0.8000 1.0000 2.0000 0.0000 Constraint 164 557 0.8000 1.0000 2.0000 0.0000 Constraint 164 487 0.8000 1.0000 2.0000 0.0000 Constraint 164 435 0.8000 1.0000 2.0000 0.0000 Constraint 164 429 0.8000 1.0000 2.0000 0.0000 Constraint 164 403 0.8000 1.0000 2.0000 0.0000 Constraint 164 368 0.8000 1.0000 2.0000 0.0000 Constraint 164 314 0.8000 1.0000 2.0000 0.0000 Constraint 164 227 0.8000 1.0000 2.0000 0.0000 Constraint 164 222 0.8000 1.0000 2.0000 0.0000 Constraint 164 216 0.8000 1.0000 2.0000 0.0000 Constraint 164 208 0.8000 1.0000 2.0000 0.0000 Constraint 164 196 0.8000 1.0000 2.0000 0.0000 Constraint 164 189 0.8000 1.0000 2.0000 0.0000 Constraint 164 180 0.8000 1.0000 2.0000 0.0000 Constraint 164 172 0.8000 1.0000 2.0000 0.0000 Constraint 154 1777 0.8000 1.0000 2.0000 0.0000 Constraint 154 1764 0.8000 1.0000 2.0000 0.0000 Constraint 154 1703 0.8000 1.0000 2.0000 0.0000 Constraint 154 1692 0.8000 1.0000 2.0000 0.0000 Constraint 154 1662 0.8000 1.0000 2.0000 0.0000 Constraint 154 1657 0.8000 1.0000 2.0000 0.0000 Constraint 154 1634 0.8000 1.0000 2.0000 0.0000 Constraint 154 1575 0.8000 1.0000 2.0000 0.0000 Constraint 154 1399 0.8000 1.0000 2.0000 0.0000 Constraint 154 1391 0.8000 1.0000 2.0000 0.0000 Constraint 154 1382 0.8000 1.0000 2.0000 0.0000 Constraint 154 1358 0.8000 1.0000 2.0000 0.0000 Constraint 154 1343 0.8000 1.0000 2.0000 0.0000 Constraint 154 1334 0.8000 1.0000 2.0000 0.0000 Constraint 154 1325 0.8000 1.0000 2.0000 0.0000 Constraint 154 1301 0.8000 1.0000 2.0000 0.0000 Constraint 154 1293 0.8000 1.0000 2.0000 0.0000 Constraint 154 1276 0.8000 1.0000 2.0000 0.0000 Constraint 154 1246 0.8000 1.0000 2.0000 0.0000 Constraint 154 1178 0.8000 1.0000 2.0000 0.0000 Constraint 154 1158 0.8000 1.0000 2.0000 0.0000 Constraint 154 1149 0.8000 1.0000 2.0000 0.0000 Constraint 154 1133 0.8000 1.0000 2.0000 0.0000 Constraint 154 1125 0.8000 1.0000 2.0000 0.0000 Constraint 154 1100 0.8000 1.0000 2.0000 0.0000 Constraint 154 1092 0.8000 1.0000 2.0000 0.0000 Constraint 154 988 0.8000 1.0000 2.0000 0.0000 Constraint 154 908 0.8000 1.0000 2.0000 0.0000 Constraint 154 899 0.8000 1.0000 2.0000 0.0000 Constraint 154 892 0.8000 1.0000 2.0000 0.0000 Constraint 154 783 0.8000 1.0000 2.0000 0.0000 Constraint 154 650 0.8000 1.0000 2.0000 0.0000 Constraint 154 630 0.8000 1.0000 2.0000 0.0000 Constraint 154 510 0.8000 1.0000 2.0000 0.0000 Constraint 154 429 0.8000 1.0000 2.0000 0.0000 Constraint 154 333 0.8000 1.0000 2.0000 0.0000 Constraint 154 314 0.8000 1.0000 2.0000 0.0000 Constraint 154 222 0.8000 1.0000 2.0000 0.0000 Constraint 154 216 0.8000 1.0000 2.0000 0.0000 Constraint 154 208 0.8000 1.0000 2.0000 0.0000 Constraint 154 196 0.8000 1.0000 2.0000 0.0000 Constraint 154 189 0.8000 1.0000 2.0000 0.0000 Constraint 154 180 0.8000 1.0000 2.0000 0.0000 Constraint 154 172 0.8000 1.0000 2.0000 0.0000 Constraint 154 164 0.8000 1.0000 2.0000 0.0000 Constraint 145 1788 0.8000 1.0000 2.0000 0.0000 Constraint 145 1777 0.8000 1.0000 2.0000 0.0000 Constraint 145 1764 0.8000 1.0000 2.0000 0.0000 Constraint 145 1748 0.8000 1.0000 2.0000 0.0000 Constraint 145 1739 0.8000 1.0000 2.0000 0.0000 Constraint 145 1720 0.8000 1.0000 2.0000 0.0000 Constraint 145 1714 0.8000 1.0000 2.0000 0.0000 Constraint 145 1703 0.8000 1.0000 2.0000 0.0000 Constraint 145 1692 0.8000 1.0000 2.0000 0.0000 Constraint 145 1683 0.8000 1.0000 2.0000 0.0000 Constraint 145 1678 0.8000 1.0000 2.0000 0.0000 Constraint 145 1670 0.8000 1.0000 2.0000 0.0000 Constraint 145 1662 0.8000 1.0000 2.0000 0.0000 Constraint 145 1634 0.8000 1.0000 2.0000 0.0000 Constraint 145 1620 0.8000 1.0000 2.0000 0.0000 Constraint 145 1611 0.8000 1.0000 2.0000 0.0000 Constraint 145 1603 0.8000 1.0000 2.0000 0.0000 Constraint 145 1596 0.8000 1.0000 2.0000 0.0000 Constraint 145 1587 0.8000 1.0000 2.0000 0.0000 Constraint 145 1567 0.8000 1.0000 2.0000 0.0000 Constraint 145 1548 0.8000 1.0000 2.0000 0.0000 Constraint 145 1541 0.8000 1.0000 2.0000 0.0000 Constraint 145 1533 0.8000 1.0000 2.0000 0.0000 Constraint 145 1455 0.8000 1.0000 2.0000 0.0000 Constraint 145 1427 0.8000 1.0000 2.0000 0.0000 Constraint 145 1416 0.8000 1.0000 2.0000 0.0000 Constraint 145 1399 0.8000 1.0000 2.0000 0.0000 Constraint 145 1391 0.8000 1.0000 2.0000 0.0000 Constraint 145 1382 0.8000 1.0000 2.0000 0.0000 Constraint 145 1358 0.8000 1.0000 2.0000 0.0000 Constraint 145 1325 0.8000 1.0000 2.0000 0.0000 Constraint 145 1317 0.8000 1.0000 2.0000 0.0000 Constraint 145 1309 0.8000 1.0000 2.0000 0.0000 Constraint 145 1301 0.8000 1.0000 2.0000 0.0000 Constraint 145 1293 0.8000 1.0000 2.0000 0.0000 Constraint 145 1284 0.8000 1.0000 2.0000 0.0000 Constraint 145 1276 0.8000 1.0000 2.0000 0.0000 Constraint 145 1251 0.8000 1.0000 2.0000 0.0000 Constraint 145 1193 0.8000 1.0000 2.0000 0.0000 Constraint 145 1178 0.8000 1.0000 2.0000 0.0000 Constraint 145 1158 0.8000 1.0000 2.0000 0.0000 Constraint 145 1149 0.8000 1.0000 2.0000 0.0000 Constraint 145 1141 0.8000 1.0000 2.0000 0.0000 Constraint 145 1133 0.8000 1.0000 2.0000 0.0000 Constraint 145 1125 0.8000 1.0000 2.0000 0.0000 Constraint 145 1117 0.8000 1.0000 2.0000 0.0000 Constraint 145 1109 0.8000 1.0000 2.0000 0.0000 Constraint 145 1100 0.8000 1.0000 2.0000 0.0000 Constraint 145 1092 0.8000 1.0000 2.0000 0.0000 Constraint 145 1084 0.8000 1.0000 2.0000 0.0000 Constraint 145 1077 0.8000 1.0000 2.0000 0.0000 Constraint 145 1068 0.8000 1.0000 2.0000 0.0000 Constraint 145 1059 0.8000 1.0000 2.0000 0.0000 Constraint 145 1054 0.8000 1.0000 2.0000 0.0000 Constraint 145 1022 0.8000 1.0000 2.0000 0.0000 Constraint 145 988 0.8000 1.0000 2.0000 0.0000 Constraint 145 980 0.8000 1.0000 2.0000 0.0000 Constraint 145 963 0.8000 1.0000 2.0000 0.0000 Constraint 145 944 0.8000 1.0000 2.0000 0.0000 Constraint 145 921 0.8000 1.0000 2.0000 0.0000 Constraint 145 913 0.8000 1.0000 2.0000 0.0000 Constraint 145 908 0.8000 1.0000 2.0000 0.0000 Constraint 145 899 0.8000 1.0000 2.0000 0.0000 Constraint 145 892 0.8000 1.0000 2.0000 0.0000 Constraint 145 884 0.8000 1.0000 2.0000 0.0000 Constraint 145 836 0.8000 1.0000 2.0000 0.0000 Constraint 145 829 0.8000 1.0000 2.0000 0.0000 Constraint 145 800 0.8000 1.0000 2.0000 0.0000 Constraint 145 792 0.8000 1.0000 2.0000 0.0000 Constraint 145 783 0.8000 1.0000 2.0000 0.0000 Constraint 145 761 0.8000 1.0000 2.0000 0.0000 Constraint 145 756 0.8000 1.0000 2.0000 0.0000 Constraint 145 748 0.8000 1.0000 2.0000 0.0000 Constraint 145 739 0.8000 1.0000 2.0000 0.0000 Constraint 145 722 0.8000 1.0000 2.0000 0.0000 Constraint 145 713 0.8000 1.0000 2.0000 0.0000 Constraint 145 706 0.8000 1.0000 2.0000 0.0000 Constraint 145 690 0.8000 1.0000 2.0000 0.0000 Constraint 145 681 0.8000 1.0000 2.0000 0.0000 Constraint 145 673 0.8000 1.0000 2.0000 0.0000 Constraint 145 650 0.8000 1.0000 2.0000 0.0000 Constraint 145 572 0.8000 1.0000 2.0000 0.0000 Constraint 145 510 0.8000 1.0000 2.0000 0.0000 Constraint 145 479 0.8000 1.0000 2.0000 0.0000 Constraint 145 457 0.8000 1.0000 2.0000 0.0000 Constraint 145 429 0.8000 1.0000 2.0000 0.0000 Constraint 145 347 0.8000 1.0000 2.0000 0.0000 Constraint 145 325 0.8000 1.0000 2.0000 0.0000 Constraint 145 314 0.8000 1.0000 2.0000 0.0000 Constraint 145 306 0.8000 1.0000 2.0000 0.0000 Constraint 145 216 0.8000 1.0000 2.0000 0.0000 Constraint 145 208 0.8000 1.0000 2.0000 0.0000 Constraint 145 196 0.8000 1.0000 2.0000 0.0000 Constraint 145 189 0.8000 1.0000 2.0000 0.0000 Constraint 145 180 0.8000 1.0000 2.0000 0.0000 Constraint 145 172 0.8000 1.0000 2.0000 0.0000 Constraint 145 164 0.8000 1.0000 2.0000 0.0000 Constraint 145 154 0.8000 1.0000 2.0000 0.0000 Constraint 136 1788 0.8000 1.0000 2.0000 0.0000 Constraint 136 1777 0.8000 1.0000 2.0000 0.0000 Constraint 136 1772 0.8000 1.0000 2.0000 0.0000 Constraint 136 1764 0.8000 1.0000 2.0000 0.0000 Constraint 136 1756 0.8000 1.0000 2.0000 0.0000 Constraint 136 1748 0.8000 1.0000 2.0000 0.0000 Constraint 136 1739 0.8000 1.0000 2.0000 0.0000 Constraint 136 1731 0.8000 1.0000 2.0000 0.0000 Constraint 136 1720 0.8000 1.0000 2.0000 0.0000 Constraint 136 1714 0.8000 1.0000 2.0000 0.0000 Constraint 136 1703 0.8000 1.0000 2.0000 0.0000 Constraint 136 1692 0.8000 1.0000 2.0000 0.0000 Constraint 136 1670 0.8000 1.0000 2.0000 0.0000 Constraint 136 1662 0.8000 1.0000 2.0000 0.0000 Constraint 136 1657 0.8000 1.0000 2.0000 0.0000 Constraint 136 1649 0.8000 1.0000 2.0000 0.0000 Constraint 136 1620 0.8000 1.0000 2.0000 0.0000 Constraint 136 1611 0.8000 1.0000 2.0000 0.0000 Constraint 136 1603 0.8000 1.0000 2.0000 0.0000 Constraint 136 1596 0.8000 1.0000 2.0000 0.0000 Constraint 136 1587 0.8000 1.0000 2.0000 0.0000 Constraint 136 1575 0.8000 1.0000 2.0000 0.0000 Constraint 136 1567 0.8000 1.0000 2.0000 0.0000 Constraint 136 1519 0.8000 1.0000 2.0000 0.0000 Constraint 136 1511 0.8000 1.0000 2.0000 0.0000 Constraint 136 1503 0.8000 1.0000 2.0000 0.0000 Constraint 136 1471 0.8000 1.0000 2.0000 0.0000 Constraint 136 1466 0.8000 1.0000 2.0000 0.0000 Constraint 136 1455 0.8000 1.0000 2.0000 0.0000 Constraint 136 1447 0.8000 1.0000 2.0000 0.0000 Constraint 136 1427 0.8000 1.0000 2.0000 0.0000 Constraint 136 1416 0.8000 1.0000 2.0000 0.0000 Constraint 136 1408 0.8000 1.0000 2.0000 0.0000 Constraint 136 1382 0.8000 1.0000 2.0000 0.0000 Constraint 136 1343 0.8000 1.0000 2.0000 0.0000 Constraint 136 1309 0.8000 1.0000 2.0000 0.0000 Constraint 136 1293 0.8000 1.0000 2.0000 0.0000 Constraint 136 1284 0.8000 1.0000 2.0000 0.0000 Constraint 136 1276 0.8000 1.0000 2.0000 0.0000 Constraint 136 1246 0.8000 1.0000 2.0000 0.0000 Constraint 136 1228 0.8000 1.0000 2.0000 0.0000 Constraint 136 1213 0.8000 1.0000 2.0000 0.0000 Constraint 136 1204 0.8000 1.0000 2.0000 0.0000 Constraint 136 1178 0.8000 1.0000 2.0000 0.0000 Constraint 136 1158 0.8000 1.0000 2.0000 0.0000 Constraint 136 1141 0.8000 1.0000 2.0000 0.0000 Constraint 136 1133 0.8000 1.0000 2.0000 0.0000 Constraint 136 1125 0.8000 1.0000 2.0000 0.0000 Constraint 136 1100 0.8000 1.0000 2.0000 0.0000 Constraint 136 1077 0.8000 1.0000 2.0000 0.0000 Constraint 136 1068 0.8000 1.0000 2.0000 0.0000 Constraint 136 1035 0.8000 1.0000 2.0000 0.0000 Constraint 136 963 0.8000 1.0000 2.0000 0.0000 Constraint 136 944 0.8000 1.0000 2.0000 0.0000 Constraint 136 937 0.8000 1.0000 2.0000 0.0000 Constraint 136 930 0.8000 1.0000 2.0000 0.0000 Constraint 136 921 0.8000 1.0000 2.0000 0.0000 Constraint 136 913 0.8000 1.0000 2.0000 0.0000 Constraint 136 908 0.8000 1.0000 2.0000 0.0000 Constraint 136 899 0.8000 1.0000 2.0000 0.0000 Constraint 136 836 0.8000 1.0000 2.0000 0.0000 Constraint 136 756 0.8000 1.0000 2.0000 0.0000 Constraint 136 748 0.8000 1.0000 2.0000 0.0000 Constraint 136 739 0.8000 1.0000 2.0000 0.0000 Constraint 136 731 0.8000 1.0000 2.0000 0.0000 Constraint 136 713 0.8000 1.0000 2.0000 0.0000 Constraint 136 706 0.8000 1.0000 2.0000 0.0000 Constraint 136 690 0.8000 1.0000 2.0000 0.0000 Constraint 136 681 0.8000 1.0000 2.0000 0.0000 Constraint 136 639 0.8000 1.0000 2.0000 0.0000 Constraint 136 572 0.8000 1.0000 2.0000 0.0000 Constraint 136 521 0.8000 1.0000 2.0000 0.0000 Constraint 136 487 0.8000 1.0000 2.0000 0.0000 Constraint 136 479 0.8000 1.0000 2.0000 0.0000 Constraint 136 429 0.8000 1.0000 2.0000 0.0000 Constraint 136 208 0.8000 1.0000 2.0000 0.0000 Constraint 136 196 0.8000 1.0000 2.0000 0.0000 Constraint 136 189 0.8000 1.0000 2.0000 0.0000 Constraint 136 180 0.8000 1.0000 2.0000 0.0000 Constraint 136 172 0.8000 1.0000 2.0000 0.0000 Constraint 136 164 0.8000 1.0000 2.0000 0.0000 Constraint 136 154 0.8000 1.0000 2.0000 0.0000 Constraint 136 145 0.8000 1.0000 2.0000 0.0000 Constraint 128 1788 0.8000 1.0000 2.0000 0.0000 Constraint 128 1777 0.8000 1.0000 2.0000 0.0000 Constraint 128 1772 0.8000 1.0000 2.0000 0.0000 Constraint 128 1764 0.8000 1.0000 2.0000 0.0000 Constraint 128 1756 0.8000 1.0000 2.0000 0.0000 Constraint 128 1748 0.8000 1.0000 2.0000 0.0000 Constraint 128 1739 0.8000 1.0000 2.0000 0.0000 Constraint 128 1731 0.8000 1.0000 2.0000 0.0000 Constraint 128 1703 0.8000 1.0000 2.0000 0.0000 Constraint 128 1692 0.8000 1.0000 2.0000 0.0000 Constraint 128 1670 0.8000 1.0000 2.0000 0.0000 Constraint 128 1662 0.8000 1.0000 2.0000 0.0000 Constraint 128 1649 0.8000 1.0000 2.0000 0.0000 Constraint 128 1634 0.8000 1.0000 2.0000 0.0000 Constraint 128 1611 0.8000 1.0000 2.0000 0.0000 Constraint 128 1567 0.8000 1.0000 2.0000 0.0000 Constraint 128 1548 0.8000 1.0000 2.0000 0.0000 Constraint 128 1541 0.8000 1.0000 2.0000 0.0000 Constraint 128 1533 0.8000 1.0000 2.0000 0.0000 Constraint 128 1519 0.8000 1.0000 2.0000 0.0000 Constraint 128 1466 0.8000 1.0000 2.0000 0.0000 Constraint 128 1455 0.8000 1.0000 2.0000 0.0000 Constraint 128 1427 0.8000 1.0000 2.0000 0.0000 Constraint 128 1358 0.8000 1.0000 2.0000 0.0000 Constraint 128 1334 0.8000 1.0000 2.0000 0.0000 Constraint 128 1309 0.8000 1.0000 2.0000 0.0000 Constraint 128 1301 0.8000 1.0000 2.0000 0.0000 Constraint 128 1284 0.8000 1.0000 2.0000 0.0000 Constraint 128 1276 0.8000 1.0000 2.0000 0.0000 Constraint 128 1251 0.8000 1.0000 2.0000 0.0000 Constraint 128 1246 0.8000 1.0000 2.0000 0.0000 Constraint 128 1213 0.8000 1.0000 2.0000 0.0000 Constraint 128 1178 0.8000 1.0000 2.0000 0.0000 Constraint 128 1149 0.8000 1.0000 2.0000 0.0000 Constraint 128 892 0.8000 1.0000 2.0000 0.0000 Constraint 128 769 0.8000 1.0000 2.0000 0.0000 Constraint 128 761 0.8000 1.0000 2.0000 0.0000 Constraint 128 739 0.8000 1.0000 2.0000 0.0000 Constraint 128 706 0.8000 1.0000 2.0000 0.0000 Constraint 128 429 0.8000 1.0000 2.0000 0.0000 Constraint 128 403 0.8000 1.0000 2.0000 0.0000 Constraint 128 196 0.8000 1.0000 2.0000 0.0000 Constraint 128 189 0.8000 1.0000 2.0000 0.0000 Constraint 128 180 0.8000 1.0000 2.0000 0.0000 Constraint 128 172 0.8000 1.0000 2.0000 0.0000 Constraint 128 164 0.8000 1.0000 2.0000 0.0000 Constraint 128 154 0.8000 1.0000 2.0000 0.0000 Constraint 128 145 0.8000 1.0000 2.0000 0.0000 Constraint 128 136 0.8000 1.0000 2.0000 0.0000 Constraint 121 1788 0.8000 1.0000 2.0000 0.0000 Constraint 121 1777 0.8000 1.0000 2.0000 0.0000 Constraint 121 1772 0.8000 1.0000 2.0000 0.0000 Constraint 121 1764 0.8000 1.0000 2.0000 0.0000 Constraint 121 1748 0.8000 1.0000 2.0000 0.0000 Constraint 121 1739 0.8000 1.0000 2.0000 0.0000 Constraint 121 1670 0.8000 1.0000 2.0000 0.0000 Constraint 121 1662 0.8000 1.0000 2.0000 0.0000 Constraint 121 1649 0.8000 1.0000 2.0000 0.0000 Constraint 121 1634 0.8000 1.0000 2.0000 0.0000 Constraint 121 1620 0.8000 1.0000 2.0000 0.0000 Constraint 121 1611 0.8000 1.0000 2.0000 0.0000 Constraint 121 1596 0.8000 1.0000 2.0000 0.0000 Constraint 121 1587 0.8000 1.0000 2.0000 0.0000 Constraint 121 1575 0.8000 1.0000 2.0000 0.0000 Constraint 121 1567 0.8000 1.0000 2.0000 0.0000 Constraint 121 1548 0.8000 1.0000 2.0000 0.0000 Constraint 121 1541 0.8000 1.0000 2.0000 0.0000 Constraint 121 1533 0.8000 1.0000 2.0000 0.0000 Constraint 121 1519 0.8000 1.0000 2.0000 0.0000 Constraint 121 1511 0.8000 1.0000 2.0000 0.0000 Constraint 121 1488 0.8000 1.0000 2.0000 0.0000 Constraint 121 1466 0.8000 1.0000 2.0000 0.0000 Constraint 121 1455 0.8000 1.0000 2.0000 0.0000 Constraint 121 1427 0.8000 1.0000 2.0000 0.0000 Constraint 121 1416 0.8000 1.0000 2.0000 0.0000 Constraint 121 1391 0.8000 1.0000 2.0000 0.0000 Constraint 121 1382 0.8000 1.0000 2.0000 0.0000 Constraint 121 1366 0.8000 1.0000 2.0000 0.0000 Constraint 121 1358 0.8000 1.0000 2.0000 0.0000 Constraint 121 1343 0.8000 1.0000 2.0000 0.0000 Constraint 121 1334 0.8000 1.0000 2.0000 0.0000 Constraint 121 1325 0.8000 1.0000 2.0000 0.0000 Constraint 121 1309 0.8000 1.0000 2.0000 0.0000 Constraint 121 1301 0.8000 1.0000 2.0000 0.0000 Constraint 121 1293 0.8000 1.0000 2.0000 0.0000 Constraint 121 1284 0.8000 1.0000 2.0000 0.0000 Constraint 121 1276 0.8000 1.0000 2.0000 0.0000 Constraint 121 1251 0.8000 1.0000 2.0000 0.0000 Constraint 121 1220 0.8000 1.0000 2.0000 0.0000 Constraint 121 1178 0.8000 1.0000 2.0000 0.0000 Constraint 121 1158 0.8000 1.0000 2.0000 0.0000 Constraint 121 1149 0.8000 1.0000 2.0000 0.0000 Constraint 121 1141 0.8000 1.0000 2.0000 0.0000 Constraint 121 1117 0.8000 1.0000 2.0000 0.0000 Constraint 121 1022 0.8000 1.0000 2.0000 0.0000 Constraint 121 988 0.8000 1.0000 2.0000 0.0000 Constraint 121 963 0.8000 1.0000 2.0000 0.0000 Constraint 121 955 0.8000 1.0000 2.0000 0.0000 Constraint 121 944 0.8000 1.0000 2.0000 0.0000 Constraint 121 913 0.8000 1.0000 2.0000 0.0000 Constraint 121 892 0.8000 1.0000 2.0000 0.0000 Constraint 121 868 0.8000 1.0000 2.0000 0.0000 Constraint 121 859 0.8000 1.0000 2.0000 0.0000 Constraint 121 836 0.8000 1.0000 2.0000 0.0000 Constraint 121 829 0.8000 1.0000 2.0000 0.0000 Constraint 121 808 0.8000 1.0000 2.0000 0.0000 Constraint 121 783 0.8000 1.0000 2.0000 0.0000 Constraint 121 761 0.8000 1.0000 2.0000 0.0000 Constraint 121 756 0.8000 1.0000 2.0000 0.0000 Constraint 121 748 0.8000 1.0000 2.0000 0.0000 Constraint 121 739 0.8000 1.0000 2.0000 0.0000 Constraint 121 713 0.8000 1.0000 2.0000 0.0000 Constraint 121 690 0.8000 1.0000 2.0000 0.0000 Constraint 121 681 0.8000 1.0000 2.0000 0.0000 Constraint 121 673 0.8000 1.0000 2.0000 0.0000 Constraint 121 650 0.8000 1.0000 2.0000 0.0000 Constraint 121 623 0.8000 1.0000 2.0000 0.0000 Constraint 121 429 0.8000 1.0000 2.0000 0.0000 Constraint 121 368 0.8000 1.0000 2.0000 0.0000 Constraint 121 325 0.8000 1.0000 2.0000 0.0000 Constraint 121 314 0.8000 1.0000 2.0000 0.0000 Constraint 121 189 0.8000 1.0000 2.0000 0.0000 Constraint 121 180 0.8000 1.0000 2.0000 0.0000 Constraint 121 172 0.8000 1.0000 2.0000 0.0000 Constraint 121 164 0.8000 1.0000 2.0000 0.0000 Constraint 121 154 0.8000 1.0000 2.0000 0.0000 Constraint 121 145 0.8000 1.0000 2.0000 0.0000 Constraint 121 136 0.8000 1.0000 2.0000 0.0000 Constraint 121 128 0.8000 1.0000 2.0000 0.0000 Constraint 112 1788 0.8000 1.0000 2.0000 0.0000 Constraint 112 1777 0.8000 1.0000 2.0000 0.0000 Constraint 112 1772 0.8000 1.0000 2.0000 0.0000 Constraint 112 1764 0.8000 1.0000 2.0000 0.0000 Constraint 112 1756 0.8000 1.0000 2.0000 0.0000 Constraint 112 1748 0.8000 1.0000 2.0000 0.0000 Constraint 112 1739 0.8000 1.0000 2.0000 0.0000 Constraint 112 1678 0.8000 1.0000 2.0000 0.0000 Constraint 112 1670 0.8000 1.0000 2.0000 0.0000 Constraint 112 1662 0.8000 1.0000 2.0000 0.0000 Constraint 112 1649 0.8000 1.0000 2.0000 0.0000 Constraint 112 1634 0.8000 1.0000 2.0000 0.0000 Constraint 112 1620 0.8000 1.0000 2.0000 0.0000 Constraint 112 1611 0.8000 1.0000 2.0000 0.0000 Constraint 112 1596 0.8000 1.0000 2.0000 0.0000 Constraint 112 1587 0.8000 1.0000 2.0000 0.0000 Constraint 112 1567 0.8000 1.0000 2.0000 0.0000 Constraint 112 1556 0.8000 1.0000 2.0000 0.0000 Constraint 112 1548 0.8000 1.0000 2.0000 0.0000 Constraint 112 1541 0.8000 1.0000 2.0000 0.0000 Constraint 112 1533 0.8000 1.0000 2.0000 0.0000 Constraint 112 1526 0.8000 1.0000 2.0000 0.0000 Constraint 112 1494 0.8000 1.0000 2.0000 0.0000 Constraint 112 1488 0.8000 1.0000 2.0000 0.0000 Constraint 112 1471 0.8000 1.0000 2.0000 0.0000 Constraint 112 1466 0.8000 1.0000 2.0000 0.0000 Constraint 112 1455 0.8000 1.0000 2.0000 0.0000 Constraint 112 1447 0.8000 1.0000 2.0000 0.0000 Constraint 112 1438 0.8000 1.0000 2.0000 0.0000 Constraint 112 1427 0.8000 1.0000 2.0000 0.0000 Constraint 112 1416 0.8000 1.0000 2.0000 0.0000 Constraint 112 1408 0.8000 1.0000 2.0000 0.0000 Constraint 112 1399 0.8000 1.0000 2.0000 0.0000 Constraint 112 1391 0.8000 1.0000 2.0000 0.0000 Constraint 112 1382 0.8000 1.0000 2.0000 0.0000 Constraint 112 1374 0.8000 1.0000 2.0000 0.0000 Constraint 112 1366 0.8000 1.0000 2.0000 0.0000 Constraint 112 1358 0.8000 1.0000 2.0000 0.0000 Constraint 112 1351 0.8000 1.0000 2.0000 0.0000 Constraint 112 1343 0.8000 1.0000 2.0000 0.0000 Constraint 112 1334 0.8000 1.0000 2.0000 0.0000 Constraint 112 1325 0.8000 1.0000 2.0000 0.0000 Constraint 112 1317 0.8000 1.0000 2.0000 0.0000 Constraint 112 1309 0.8000 1.0000 2.0000 0.0000 Constraint 112 1301 0.8000 1.0000 2.0000 0.0000 Constraint 112 1293 0.8000 1.0000 2.0000 0.0000 Constraint 112 1284 0.8000 1.0000 2.0000 0.0000 Constraint 112 1276 0.8000 1.0000 2.0000 0.0000 Constraint 112 1268 0.8000 1.0000 2.0000 0.0000 Constraint 112 1239 0.8000 1.0000 2.0000 0.0000 Constraint 112 1220 0.8000 1.0000 2.0000 0.0000 Constraint 112 1204 0.8000 1.0000 2.0000 0.0000 Constraint 112 1167 0.8000 1.0000 2.0000 0.0000 Constraint 112 1158 0.8000 1.0000 2.0000 0.0000 Constraint 112 1141 0.8000 1.0000 2.0000 0.0000 Constraint 112 1133 0.8000 1.0000 2.0000 0.0000 Constraint 112 1084 0.8000 1.0000 2.0000 0.0000 Constraint 112 1059 0.8000 1.0000 2.0000 0.0000 Constraint 112 1054 0.8000 1.0000 2.0000 0.0000 Constraint 112 1046 0.8000 1.0000 2.0000 0.0000 Constraint 112 1035 0.8000 1.0000 2.0000 0.0000 Constraint 112 1030 0.8000 1.0000 2.0000 0.0000 Constraint 112 1022 0.8000 1.0000 2.0000 0.0000 Constraint 112 1014 0.8000 1.0000 2.0000 0.0000 Constraint 112 1008 0.8000 1.0000 2.0000 0.0000 Constraint 112 997 0.8000 1.0000 2.0000 0.0000 Constraint 112 980 0.8000 1.0000 2.0000 0.0000 Constraint 112 968 0.8000 1.0000 2.0000 0.0000 Constraint 112 963 0.8000 1.0000 2.0000 0.0000 Constraint 112 944 0.8000 1.0000 2.0000 0.0000 Constraint 112 937 0.8000 1.0000 2.0000 0.0000 Constraint 112 913 0.8000 1.0000 2.0000 0.0000 Constraint 112 908 0.8000 1.0000 2.0000 0.0000 Constraint 112 899 0.8000 1.0000 2.0000 0.0000 Constraint 112 884 0.8000 1.0000 2.0000 0.0000 Constraint 112 876 0.8000 1.0000 2.0000 0.0000 Constraint 112 836 0.8000 1.0000 2.0000 0.0000 Constraint 112 808 0.8000 1.0000 2.0000 0.0000 Constraint 112 783 0.8000 1.0000 2.0000 0.0000 Constraint 112 761 0.8000 1.0000 2.0000 0.0000 Constraint 112 756 0.8000 1.0000 2.0000 0.0000 Constraint 112 748 0.8000 1.0000 2.0000 0.0000 Constraint 112 731 0.8000 1.0000 2.0000 0.0000 Constraint 112 722 0.8000 1.0000 2.0000 0.0000 Constraint 112 713 0.8000 1.0000 2.0000 0.0000 Constraint 112 706 0.8000 1.0000 2.0000 0.0000 Constraint 112 690 0.8000 1.0000 2.0000 0.0000 Constraint 112 681 0.8000 1.0000 2.0000 0.0000 Constraint 112 673 0.8000 1.0000 2.0000 0.0000 Constraint 112 657 0.8000 1.0000 2.0000 0.0000 Constraint 112 639 0.8000 1.0000 2.0000 0.0000 Constraint 112 608 0.8000 1.0000 2.0000 0.0000 Constraint 112 597 0.8000 1.0000 2.0000 0.0000 Constraint 112 564 0.8000 1.0000 2.0000 0.0000 Constraint 112 479 0.8000 1.0000 2.0000 0.0000 Constraint 112 457 0.8000 1.0000 2.0000 0.0000 Constraint 112 368 0.8000 1.0000 2.0000 0.0000 Constraint 112 299 0.8000 1.0000 2.0000 0.0000 Constraint 112 180 0.8000 1.0000 2.0000 0.0000 Constraint 112 172 0.8000 1.0000 2.0000 0.0000 Constraint 112 164 0.8000 1.0000 2.0000 0.0000 Constraint 112 154 0.8000 1.0000 2.0000 0.0000 Constraint 112 145 0.8000 1.0000 2.0000 0.0000 Constraint 112 136 0.8000 1.0000 2.0000 0.0000 Constraint 112 128 0.8000 1.0000 2.0000 0.0000 Constraint 112 121 0.8000 1.0000 2.0000 0.0000 Constraint 104 1788 0.8000 1.0000 2.0000 0.0000 Constraint 104 1777 0.8000 1.0000 2.0000 0.0000 Constraint 104 1772 0.8000 1.0000 2.0000 0.0000 Constraint 104 1764 0.8000 1.0000 2.0000 0.0000 Constraint 104 1756 0.8000 1.0000 2.0000 0.0000 Constraint 104 1748 0.8000 1.0000 2.0000 0.0000 Constraint 104 1739 0.8000 1.0000 2.0000 0.0000 Constraint 104 1731 0.8000 1.0000 2.0000 0.0000 Constraint 104 1720 0.8000 1.0000 2.0000 0.0000 Constraint 104 1714 0.8000 1.0000 2.0000 0.0000 Constraint 104 1703 0.8000 1.0000 2.0000 0.0000 Constraint 104 1692 0.8000 1.0000 2.0000 0.0000 Constraint 104 1678 0.8000 1.0000 2.0000 0.0000 Constraint 104 1670 0.8000 1.0000 2.0000 0.0000 Constraint 104 1662 0.8000 1.0000 2.0000 0.0000 Constraint 104 1649 0.8000 1.0000 2.0000 0.0000 Constraint 104 1620 0.8000 1.0000 2.0000 0.0000 Constraint 104 1611 0.8000 1.0000 2.0000 0.0000 Constraint 104 1548 0.8000 1.0000 2.0000 0.0000 Constraint 104 1494 0.8000 1.0000 2.0000 0.0000 Constraint 104 1471 0.8000 1.0000 2.0000 0.0000 Constraint 104 1466 0.8000 1.0000 2.0000 0.0000 Constraint 104 1447 0.8000 1.0000 2.0000 0.0000 Constraint 104 1438 0.8000 1.0000 2.0000 0.0000 Constraint 104 1427 0.8000 1.0000 2.0000 0.0000 Constraint 104 1391 0.8000 1.0000 2.0000 0.0000 Constraint 104 1374 0.8000 1.0000 2.0000 0.0000 Constraint 104 1366 0.8000 1.0000 2.0000 0.0000 Constraint 104 1358 0.8000 1.0000 2.0000 0.0000 Constraint 104 1351 0.8000 1.0000 2.0000 0.0000 Constraint 104 1343 0.8000 1.0000 2.0000 0.0000 Constraint 104 1334 0.8000 1.0000 2.0000 0.0000 Constraint 104 1317 0.8000 1.0000 2.0000 0.0000 Constraint 104 1309 0.8000 1.0000 2.0000 0.0000 Constraint 104 1284 0.8000 1.0000 2.0000 0.0000 Constraint 104 1276 0.8000 1.0000 2.0000 0.0000 Constraint 104 1251 0.8000 1.0000 2.0000 0.0000 Constraint 104 1246 0.8000 1.0000 2.0000 0.0000 Constraint 104 1220 0.8000 1.0000 2.0000 0.0000 Constraint 104 1178 0.8000 1.0000 2.0000 0.0000 Constraint 104 1167 0.8000 1.0000 2.0000 0.0000 Constraint 104 1149 0.8000 1.0000 2.0000 0.0000 Constraint 104 1141 0.8000 1.0000 2.0000 0.0000 Constraint 104 1035 0.8000 1.0000 2.0000 0.0000 Constraint 104 1030 0.8000 1.0000 2.0000 0.0000 Constraint 104 1022 0.8000 1.0000 2.0000 0.0000 Constraint 104 1014 0.8000 1.0000 2.0000 0.0000 Constraint 104 944 0.8000 1.0000 2.0000 0.0000 Constraint 104 921 0.8000 1.0000 2.0000 0.0000 Constraint 104 913 0.8000 1.0000 2.0000 0.0000 Constraint 104 908 0.8000 1.0000 2.0000 0.0000 Constraint 104 899 0.8000 1.0000 2.0000 0.0000 Constraint 104 876 0.8000 1.0000 2.0000 0.0000 Constraint 104 868 0.8000 1.0000 2.0000 0.0000 Constraint 104 761 0.8000 1.0000 2.0000 0.0000 Constraint 104 713 0.8000 1.0000 2.0000 0.0000 Constraint 104 706 0.8000 1.0000 2.0000 0.0000 Constraint 104 681 0.8000 1.0000 2.0000 0.0000 Constraint 104 639 0.8000 1.0000 2.0000 0.0000 Constraint 104 597 0.8000 1.0000 2.0000 0.0000 Constraint 104 403 0.8000 1.0000 2.0000 0.0000 Constraint 104 172 0.8000 1.0000 2.0000 0.0000 Constraint 104 164 0.8000 1.0000 2.0000 0.0000 Constraint 104 154 0.8000 1.0000 2.0000 0.0000 Constraint 104 145 0.8000 1.0000 2.0000 0.0000 Constraint 104 136 0.8000 1.0000 2.0000 0.0000 Constraint 104 128 0.8000 1.0000 2.0000 0.0000 Constraint 104 121 0.8000 1.0000 2.0000 0.0000 Constraint 104 112 0.8000 1.0000 2.0000 0.0000 Constraint 97 1788 0.8000 1.0000 2.0000 0.0000 Constraint 97 1777 0.8000 1.0000 2.0000 0.0000 Constraint 97 1772 0.8000 1.0000 2.0000 0.0000 Constraint 97 1764 0.8000 1.0000 2.0000 0.0000 Constraint 97 1756 0.8000 1.0000 2.0000 0.0000 Constraint 97 1748 0.8000 1.0000 2.0000 0.0000 Constraint 97 1739 0.8000 1.0000 2.0000 0.0000 Constraint 97 1720 0.8000 1.0000 2.0000 0.0000 Constraint 97 1714 0.8000 1.0000 2.0000 0.0000 Constraint 97 1692 0.8000 1.0000 2.0000 0.0000 Constraint 97 1683 0.8000 1.0000 2.0000 0.0000 Constraint 97 1678 0.8000 1.0000 2.0000 0.0000 Constraint 97 1662 0.8000 1.0000 2.0000 0.0000 Constraint 97 1611 0.8000 1.0000 2.0000 0.0000 Constraint 97 1575 0.8000 1.0000 2.0000 0.0000 Constraint 97 1519 0.8000 1.0000 2.0000 0.0000 Constraint 97 1511 0.8000 1.0000 2.0000 0.0000 Constraint 97 1494 0.8000 1.0000 2.0000 0.0000 Constraint 97 1488 0.8000 1.0000 2.0000 0.0000 Constraint 97 1466 0.8000 1.0000 2.0000 0.0000 Constraint 97 1427 0.8000 1.0000 2.0000 0.0000 Constraint 97 1416 0.8000 1.0000 2.0000 0.0000 Constraint 97 1391 0.8000 1.0000 2.0000 0.0000 Constraint 97 1382 0.8000 1.0000 2.0000 0.0000 Constraint 97 1374 0.8000 1.0000 2.0000 0.0000 Constraint 97 1366 0.8000 1.0000 2.0000 0.0000 Constraint 97 1351 0.8000 1.0000 2.0000 0.0000 Constraint 97 1334 0.8000 1.0000 2.0000 0.0000 Constraint 97 1309 0.8000 1.0000 2.0000 0.0000 Constraint 97 1268 0.8000 1.0000 2.0000 0.0000 Constraint 97 1178 0.8000 1.0000 2.0000 0.0000 Constraint 97 1167 0.8000 1.0000 2.0000 0.0000 Constraint 97 1149 0.8000 1.0000 2.0000 0.0000 Constraint 97 1046 0.8000 1.0000 2.0000 0.0000 Constraint 97 1022 0.8000 1.0000 2.0000 0.0000 Constraint 97 913 0.8000 1.0000 2.0000 0.0000 Constraint 97 908 0.8000 1.0000 2.0000 0.0000 Constraint 97 892 0.8000 1.0000 2.0000 0.0000 Constraint 97 884 0.8000 1.0000 2.0000 0.0000 Constraint 97 808 0.8000 1.0000 2.0000 0.0000 Constraint 97 792 0.8000 1.0000 2.0000 0.0000 Constraint 97 783 0.8000 1.0000 2.0000 0.0000 Constraint 97 778 0.8000 1.0000 2.0000 0.0000 Constraint 97 769 0.8000 1.0000 2.0000 0.0000 Constraint 97 761 0.8000 1.0000 2.0000 0.0000 Constraint 97 756 0.8000 1.0000 2.0000 0.0000 Constraint 97 748 0.8000 1.0000 2.0000 0.0000 Constraint 97 731 0.8000 1.0000 2.0000 0.0000 Constraint 97 713 0.8000 1.0000 2.0000 0.0000 Constraint 97 706 0.8000 1.0000 2.0000 0.0000 Constraint 97 690 0.8000 1.0000 2.0000 0.0000 Constraint 97 681 0.8000 1.0000 2.0000 0.0000 Constraint 97 673 0.8000 1.0000 2.0000 0.0000 Constraint 97 623 0.8000 1.0000 2.0000 0.0000 Constraint 97 429 0.8000 1.0000 2.0000 0.0000 Constraint 97 403 0.8000 1.0000 2.0000 0.0000 Constraint 97 392 0.8000 1.0000 2.0000 0.0000 Constraint 97 375 0.8000 1.0000 2.0000 0.0000 Constraint 97 347 0.8000 1.0000 2.0000 0.0000 Constraint 97 294 0.8000 1.0000 2.0000 0.0000 Constraint 97 249 0.8000 1.0000 2.0000 0.0000 Constraint 97 172 0.8000 1.0000 2.0000 0.0000 Constraint 97 164 0.8000 1.0000 2.0000 0.0000 Constraint 97 154 0.8000 1.0000 2.0000 0.0000 Constraint 97 145 0.8000 1.0000 2.0000 0.0000 Constraint 97 136 0.8000 1.0000 2.0000 0.0000 Constraint 97 128 0.8000 1.0000 2.0000 0.0000 Constraint 97 121 0.8000 1.0000 2.0000 0.0000 Constraint 97 112 0.8000 1.0000 2.0000 0.0000 Constraint 97 104 0.8000 1.0000 2.0000 0.0000 Constraint 91 1788 0.8000 1.0000 2.0000 0.0000 Constraint 91 1777 0.8000 1.0000 2.0000 0.0000 Constraint 91 1772 0.8000 1.0000 2.0000 0.0000 Constraint 91 1764 0.8000 1.0000 2.0000 0.0000 Constraint 91 1756 0.8000 1.0000 2.0000 0.0000 Constraint 91 1748 0.8000 1.0000 2.0000 0.0000 Constraint 91 1739 0.8000 1.0000 2.0000 0.0000 Constraint 91 1683 0.8000 1.0000 2.0000 0.0000 Constraint 91 1634 0.8000 1.0000 2.0000 0.0000 Constraint 91 1620 0.8000 1.0000 2.0000 0.0000 Constraint 91 1611 0.8000 1.0000 2.0000 0.0000 Constraint 91 1603 0.8000 1.0000 2.0000 0.0000 Constraint 91 1596 0.8000 1.0000 2.0000 0.0000 Constraint 91 1587 0.8000 1.0000 2.0000 0.0000 Constraint 91 1575 0.8000 1.0000 2.0000 0.0000 Constraint 91 1567 0.8000 1.0000 2.0000 0.0000 Constraint 91 1556 0.8000 1.0000 2.0000 0.0000 Constraint 91 1548 0.8000 1.0000 2.0000 0.0000 Constraint 91 1541 0.8000 1.0000 2.0000 0.0000 Constraint 91 1494 0.8000 1.0000 2.0000 0.0000 Constraint 91 1488 0.8000 1.0000 2.0000 0.0000 Constraint 91 1479 0.8000 1.0000 2.0000 0.0000 Constraint 91 1471 0.8000 1.0000 2.0000 0.0000 Constraint 91 1466 0.8000 1.0000 2.0000 0.0000 Constraint 91 1427 0.8000 1.0000 2.0000 0.0000 Constraint 91 1416 0.8000 1.0000 2.0000 0.0000 Constraint 91 1391 0.8000 1.0000 2.0000 0.0000 Constraint 91 1382 0.8000 1.0000 2.0000 0.0000 Constraint 91 1366 0.8000 1.0000 2.0000 0.0000 Constraint 91 1358 0.8000 1.0000 2.0000 0.0000 Constraint 91 1351 0.8000 1.0000 2.0000 0.0000 Constraint 91 1343 0.8000 1.0000 2.0000 0.0000 Constraint 91 1334 0.8000 1.0000 2.0000 0.0000 Constraint 91 1325 0.8000 1.0000 2.0000 0.0000 Constraint 91 1317 0.8000 1.0000 2.0000 0.0000 Constraint 91 1309 0.8000 1.0000 2.0000 0.0000 Constraint 91 1293 0.8000 1.0000 2.0000 0.0000 Constraint 91 1284 0.8000 1.0000 2.0000 0.0000 Constraint 91 1276 0.8000 1.0000 2.0000 0.0000 Constraint 91 1268 0.8000 1.0000 2.0000 0.0000 Constraint 91 1251 0.8000 1.0000 2.0000 0.0000 Constraint 91 1246 0.8000 1.0000 2.0000 0.0000 Constraint 91 1239 0.8000 1.0000 2.0000 0.0000 Constraint 91 1178 0.8000 1.0000 2.0000 0.0000 Constraint 91 1167 0.8000 1.0000 2.0000 0.0000 Constraint 91 1158 0.8000 1.0000 2.0000 0.0000 Constraint 91 1149 0.8000 1.0000 2.0000 0.0000 Constraint 91 1141 0.8000 1.0000 2.0000 0.0000 Constraint 91 1125 0.8000 1.0000 2.0000 0.0000 Constraint 91 1117 0.8000 1.0000 2.0000 0.0000 Constraint 91 1092 0.8000 1.0000 2.0000 0.0000 Constraint 91 1084 0.8000 1.0000 2.0000 0.0000 Constraint 91 1077 0.8000 1.0000 2.0000 0.0000 Constraint 91 1068 0.8000 1.0000 2.0000 0.0000 Constraint 91 1059 0.8000 1.0000 2.0000 0.0000 Constraint 91 1054 0.8000 1.0000 2.0000 0.0000 Constraint 91 1046 0.8000 1.0000 2.0000 0.0000 Constraint 91 1035 0.8000 1.0000 2.0000 0.0000 Constraint 91 1030 0.8000 1.0000 2.0000 0.0000 Constraint 91 1022 0.8000 1.0000 2.0000 0.0000 Constraint 91 1014 0.8000 1.0000 2.0000 0.0000 Constraint 91 1008 0.8000 1.0000 2.0000 0.0000 Constraint 91 997 0.8000 1.0000 2.0000 0.0000 Constraint 91 980 0.8000 1.0000 2.0000 0.0000 Constraint 91 963 0.8000 1.0000 2.0000 0.0000 Constraint 91 944 0.8000 1.0000 2.0000 0.0000 Constraint 91 930 0.8000 1.0000 2.0000 0.0000 Constraint 91 884 0.8000 1.0000 2.0000 0.0000 Constraint 91 868 0.8000 1.0000 2.0000 0.0000 Constraint 91 859 0.8000 1.0000 2.0000 0.0000 Constraint 91 836 0.8000 1.0000 2.0000 0.0000 Constraint 91 800 0.8000 1.0000 2.0000 0.0000 Constraint 91 792 0.8000 1.0000 2.0000 0.0000 Constraint 91 783 0.8000 1.0000 2.0000 0.0000 Constraint 91 778 0.8000 1.0000 2.0000 0.0000 Constraint 91 769 0.8000 1.0000 2.0000 0.0000 Constraint 91 756 0.8000 1.0000 2.0000 0.0000 Constraint 91 748 0.8000 1.0000 2.0000 0.0000 Constraint 91 731 0.8000 1.0000 2.0000 0.0000 Constraint 91 722 0.8000 1.0000 2.0000 0.0000 Constraint 91 713 0.8000 1.0000 2.0000 0.0000 Constraint 91 706 0.8000 1.0000 2.0000 0.0000 Constraint 91 698 0.8000 1.0000 2.0000 0.0000 Constraint 91 690 0.8000 1.0000 2.0000 0.0000 Constraint 91 681 0.8000 1.0000 2.0000 0.0000 Constraint 91 673 0.8000 1.0000 2.0000 0.0000 Constraint 91 665 0.8000 1.0000 2.0000 0.0000 Constraint 91 657 0.8000 1.0000 2.0000 0.0000 Constraint 91 650 0.8000 1.0000 2.0000 0.0000 Constraint 91 639 0.8000 1.0000 2.0000 0.0000 Constraint 91 630 0.8000 1.0000 2.0000 0.0000 Constraint 91 623 0.8000 1.0000 2.0000 0.0000 Constraint 91 501 0.8000 1.0000 2.0000 0.0000 Constraint 91 466 0.8000 1.0000 2.0000 0.0000 Constraint 91 457 0.8000 1.0000 2.0000 0.0000 Constraint 91 448 0.8000 1.0000 2.0000 0.0000 Constraint 91 435 0.8000 1.0000 2.0000 0.0000 Constraint 91 429 0.8000 1.0000 2.0000 0.0000 Constraint 91 392 0.8000 1.0000 2.0000 0.0000 Constraint 91 347 0.8000 1.0000 2.0000 0.0000 Constraint 91 314 0.8000 1.0000 2.0000 0.0000 Constraint 91 306 0.8000 1.0000 2.0000 0.0000 Constraint 91 299 0.8000 1.0000 2.0000 0.0000 Constraint 91 294 0.8000 1.0000 2.0000 0.0000 Constraint 91 285 0.8000 1.0000 2.0000 0.0000 Constraint 91 256 0.8000 1.0000 2.0000 0.0000 Constraint 91 233 0.8000 1.0000 2.0000 0.0000 Constraint 91 154 0.8000 1.0000 2.0000 0.0000 Constraint 91 145 0.8000 1.0000 2.0000 0.0000 Constraint 91 136 0.8000 1.0000 2.0000 0.0000 Constraint 91 128 0.8000 1.0000 2.0000 0.0000 Constraint 91 121 0.8000 1.0000 2.0000 0.0000 Constraint 91 112 0.8000 1.0000 2.0000 0.0000 Constraint 91 104 0.8000 1.0000 2.0000 0.0000 Constraint 91 97 0.8000 1.0000 2.0000 0.0000 Constraint 82 1788 0.8000 1.0000 2.0000 0.0000 Constraint 82 1777 0.8000 1.0000 2.0000 0.0000 Constraint 82 1772 0.8000 1.0000 2.0000 0.0000 Constraint 82 1764 0.8000 1.0000 2.0000 0.0000 Constraint 82 1756 0.8000 1.0000 2.0000 0.0000 Constraint 82 1748 0.8000 1.0000 2.0000 0.0000 Constraint 82 1739 0.8000 1.0000 2.0000 0.0000 Constraint 82 1731 0.8000 1.0000 2.0000 0.0000 Constraint 82 1720 0.8000 1.0000 2.0000 0.0000 Constraint 82 1714 0.8000 1.0000 2.0000 0.0000 Constraint 82 1703 0.8000 1.0000 2.0000 0.0000 Constraint 82 1692 0.8000 1.0000 2.0000 0.0000 Constraint 82 1683 0.8000 1.0000 2.0000 0.0000 Constraint 82 1678 0.8000 1.0000 2.0000 0.0000 Constraint 82 1670 0.8000 1.0000 2.0000 0.0000 Constraint 82 1662 0.8000 1.0000 2.0000 0.0000 Constraint 82 1649 0.8000 1.0000 2.0000 0.0000 Constraint 82 1620 0.8000 1.0000 2.0000 0.0000 Constraint 82 1611 0.8000 1.0000 2.0000 0.0000 Constraint 82 1596 0.8000 1.0000 2.0000 0.0000 Constraint 82 1587 0.8000 1.0000 2.0000 0.0000 Constraint 82 1575 0.8000 1.0000 2.0000 0.0000 Constraint 82 1567 0.8000 1.0000 2.0000 0.0000 Constraint 82 1556 0.8000 1.0000 2.0000 0.0000 Constraint 82 1526 0.8000 1.0000 2.0000 0.0000 Constraint 82 1519 0.8000 1.0000 2.0000 0.0000 Constraint 82 1511 0.8000 1.0000 2.0000 0.0000 Constraint 82 1494 0.8000 1.0000 2.0000 0.0000 Constraint 82 1488 0.8000 1.0000 2.0000 0.0000 Constraint 82 1479 0.8000 1.0000 2.0000 0.0000 Constraint 82 1471 0.8000 1.0000 2.0000 0.0000 Constraint 82 1447 0.8000 1.0000 2.0000 0.0000 Constraint 82 1438 0.8000 1.0000 2.0000 0.0000 Constraint 82 1416 0.8000 1.0000 2.0000 0.0000 Constraint 82 1408 0.8000 1.0000 2.0000 0.0000 Constraint 82 1399 0.8000 1.0000 2.0000 0.0000 Constraint 82 1391 0.8000 1.0000 2.0000 0.0000 Constraint 82 1382 0.8000 1.0000 2.0000 0.0000 Constraint 82 1374 0.8000 1.0000 2.0000 0.0000 Constraint 82 1366 0.8000 1.0000 2.0000 0.0000 Constraint 82 1358 0.8000 1.0000 2.0000 0.0000 Constraint 82 1351 0.8000 1.0000 2.0000 0.0000 Constraint 82 1343 0.8000 1.0000 2.0000 0.0000 Constraint 82 1334 0.8000 1.0000 2.0000 0.0000 Constraint 82 1325 0.8000 1.0000 2.0000 0.0000 Constraint 82 1317 0.8000 1.0000 2.0000 0.0000 Constraint 82 1309 0.8000 1.0000 2.0000 0.0000 Constraint 82 1293 0.8000 1.0000 2.0000 0.0000 Constraint 82 1284 0.8000 1.0000 2.0000 0.0000 Constraint 82 1260 0.8000 1.0000 2.0000 0.0000 Constraint 82 1251 0.8000 1.0000 2.0000 0.0000 Constraint 82 1246 0.8000 1.0000 2.0000 0.0000 Constraint 82 1239 0.8000 1.0000 2.0000 0.0000 Constraint 82 1204 0.8000 1.0000 2.0000 0.0000 Constraint 82 1193 0.8000 1.0000 2.0000 0.0000 Constraint 82 1178 0.8000 1.0000 2.0000 0.0000 Constraint 82 1167 0.8000 1.0000 2.0000 0.0000 Constraint 82 1149 0.8000 1.0000 2.0000 0.0000 Constraint 82 1141 0.8000 1.0000 2.0000 0.0000 Constraint 82 1125 0.8000 1.0000 2.0000 0.0000 Constraint 82 1117 0.8000 1.0000 2.0000 0.0000 Constraint 82 1109 0.8000 1.0000 2.0000 0.0000 Constraint 82 1084 0.8000 1.0000 2.0000 0.0000 Constraint 82 1077 0.8000 1.0000 2.0000 0.0000 Constraint 82 1059 0.8000 1.0000 2.0000 0.0000 Constraint 82 1054 0.8000 1.0000 2.0000 0.0000 Constraint 82 1046 0.8000 1.0000 2.0000 0.0000 Constraint 82 1035 0.8000 1.0000 2.0000 0.0000 Constraint 82 1030 0.8000 1.0000 2.0000 0.0000 Constraint 82 1022 0.8000 1.0000 2.0000 0.0000 Constraint 82 1014 0.8000 1.0000 2.0000 0.0000 Constraint 82 1008 0.8000 1.0000 2.0000 0.0000 Constraint 82 980 0.8000 1.0000 2.0000 0.0000 Constraint 82 930 0.8000 1.0000 2.0000 0.0000 Constraint 82 848 0.8000 1.0000 2.0000 0.0000 Constraint 82 836 0.8000 1.0000 2.0000 0.0000 Constraint 82 818 0.8000 1.0000 2.0000 0.0000 Constraint 82 783 0.8000 1.0000 2.0000 0.0000 Constraint 82 748 0.8000 1.0000 2.0000 0.0000 Constraint 82 739 0.8000 1.0000 2.0000 0.0000 Constraint 82 731 0.8000 1.0000 2.0000 0.0000 Constraint 82 722 0.8000 1.0000 2.0000 0.0000 Constraint 82 713 0.8000 1.0000 2.0000 0.0000 Constraint 82 706 0.8000 1.0000 2.0000 0.0000 Constraint 82 698 0.8000 1.0000 2.0000 0.0000 Constraint 82 681 0.8000 1.0000 2.0000 0.0000 Constraint 82 673 0.8000 1.0000 2.0000 0.0000 Constraint 82 665 0.8000 1.0000 2.0000 0.0000 Constraint 82 630 0.8000 1.0000 2.0000 0.0000 Constraint 82 501 0.8000 1.0000 2.0000 0.0000 Constraint 82 493 0.8000 1.0000 2.0000 0.0000 Constraint 82 487 0.8000 1.0000 2.0000 0.0000 Constraint 82 448 0.8000 1.0000 2.0000 0.0000 Constraint 82 443 0.8000 1.0000 2.0000 0.0000 Constraint 82 435 0.8000 1.0000 2.0000 0.0000 Constraint 82 421 0.8000 1.0000 2.0000 0.0000 Constraint 82 403 0.8000 1.0000 2.0000 0.0000 Constraint 82 392 0.8000 1.0000 2.0000 0.0000 Constraint 82 368 0.8000 1.0000 2.0000 0.0000 Constraint 82 233 0.8000 1.0000 2.0000 0.0000 Constraint 82 227 0.8000 1.0000 2.0000 0.0000 Constraint 82 216 0.8000 1.0000 2.0000 0.0000 Constraint 82 208 0.8000 1.0000 2.0000 0.0000 Constraint 82 145 0.8000 1.0000 2.0000 0.0000 Constraint 82 136 0.8000 1.0000 2.0000 0.0000 Constraint 82 128 0.8000 1.0000 2.0000 0.0000 Constraint 82 121 0.8000 1.0000 2.0000 0.0000 Constraint 82 112 0.8000 1.0000 2.0000 0.0000 Constraint 82 104 0.8000 1.0000 2.0000 0.0000 Constraint 82 97 0.8000 1.0000 2.0000 0.0000 Constraint 82 91 0.8000 1.0000 2.0000 0.0000 Constraint 77 1788 0.8000 1.0000 2.0000 0.0000 Constraint 77 1777 0.8000 1.0000 2.0000 0.0000 Constraint 77 1772 0.8000 1.0000 2.0000 0.0000 Constraint 77 1764 0.8000 1.0000 2.0000 0.0000 Constraint 77 1756 0.8000 1.0000 2.0000 0.0000 Constraint 77 1748 0.8000 1.0000 2.0000 0.0000 Constraint 77 1739 0.8000 1.0000 2.0000 0.0000 Constraint 77 1731 0.8000 1.0000 2.0000 0.0000 Constraint 77 1720 0.8000 1.0000 2.0000 0.0000 Constraint 77 1714 0.8000 1.0000 2.0000 0.0000 Constraint 77 1703 0.8000 1.0000 2.0000 0.0000 Constraint 77 1692 0.8000 1.0000 2.0000 0.0000 Constraint 77 1670 0.8000 1.0000 2.0000 0.0000 Constraint 77 1662 0.8000 1.0000 2.0000 0.0000 Constraint 77 1649 0.8000 1.0000 2.0000 0.0000 Constraint 77 1620 0.8000 1.0000 2.0000 0.0000 Constraint 77 1596 0.8000 1.0000 2.0000 0.0000 Constraint 77 1587 0.8000 1.0000 2.0000 0.0000 Constraint 77 1575 0.8000 1.0000 2.0000 0.0000 Constraint 77 1567 0.8000 1.0000 2.0000 0.0000 Constraint 77 1556 0.8000 1.0000 2.0000 0.0000 Constraint 77 1548 0.8000 1.0000 2.0000 0.0000 Constraint 77 1519 0.8000 1.0000 2.0000 0.0000 Constraint 77 1511 0.8000 1.0000 2.0000 0.0000 Constraint 77 1494 0.8000 1.0000 2.0000 0.0000 Constraint 77 1488 0.8000 1.0000 2.0000 0.0000 Constraint 77 1479 0.8000 1.0000 2.0000 0.0000 Constraint 77 1471 0.8000 1.0000 2.0000 0.0000 Constraint 77 1466 0.8000 1.0000 2.0000 0.0000 Constraint 77 1455 0.8000 1.0000 2.0000 0.0000 Constraint 77 1447 0.8000 1.0000 2.0000 0.0000 Constraint 77 1438 0.8000 1.0000 2.0000 0.0000 Constraint 77 1427 0.8000 1.0000 2.0000 0.0000 Constraint 77 1416 0.8000 1.0000 2.0000 0.0000 Constraint 77 1408 0.8000 1.0000 2.0000 0.0000 Constraint 77 1399 0.8000 1.0000 2.0000 0.0000 Constraint 77 1391 0.8000 1.0000 2.0000 0.0000 Constraint 77 1382 0.8000 1.0000 2.0000 0.0000 Constraint 77 1374 0.8000 1.0000 2.0000 0.0000 Constraint 77 1366 0.8000 1.0000 2.0000 0.0000 Constraint 77 1358 0.8000 1.0000 2.0000 0.0000 Constraint 77 1351 0.8000 1.0000 2.0000 0.0000 Constraint 77 1343 0.8000 1.0000 2.0000 0.0000 Constraint 77 1334 0.8000 1.0000 2.0000 0.0000 Constraint 77 1317 0.8000 1.0000 2.0000 0.0000 Constraint 77 1309 0.8000 1.0000 2.0000 0.0000 Constraint 77 1284 0.8000 1.0000 2.0000 0.0000 Constraint 77 1276 0.8000 1.0000 2.0000 0.0000 Constraint 77 1239 0.8000 1.0000 2.0000 0.0000 Constraint 77 1204 0.8000 1.0000 2.0000 0.0000 Constraint 77 1149 0.8000 1.0000 2.0000 0.0000 Constraint 77 1141 0.8000 1.0000 2.0000 0.0000 Constraint 77 1125 0.8000 1.0000 2.0000 0.0000 Constraint 77 1109 0.8000 1.0000 2.0000 0.0000 Constraint 77 1077 0.8000 1.0000 2.0000 0.0000 Constraint 77 1054 0.8000 1.0000 2.0000 0.0000 Constraint 77 1035 0.8000 1.0000 2.0000 0.0000 Constraint 77 1030 0.8000 1.0000 2.0000 0.0000 Constraint 77 1022 0.8000 1.0000 2.0000 0.0000 Constraint 77 1014 0.8000 1.0000 2.0000 0.0000 Constraint 77 1008 0.8000 1.0000 2.0000 0.0000 Constraint 77 930 0.8000 1.0000 2.0000 0.0000 Constraint 77 908 0.8000 1.0000 2.0000 0.0000 Constraint 77 868 0.8000 1.0000 2.0000 0.0000 Constraint 77 859 0.8000 1.0000 2.0000 0.0000 Constraint 77 848 0.8000 1.0000 2.0000 0.0000 Constraint 77 836 0.8000 1.0000 2.0000 0.0000 Constraint 77 818 0.8000 1.0000 2.0000 0.0000 Constraint 77 783 0.8000 1.0000 2.0000 0.0000 Constraint 77 761 0.8000 1.0000 2.0000 0.0000 Constraint 77 756 0.8000 1.0000 2.0000 0.0000 Constraint 77 748 0.8000 1.0000 2.0000 0.0000 Constraint 77 739 0.8000 1.0000 2.0000 0.0000 Constraint 77 722 0.8000 1.0000 2.0000 0.0000 Constraint 77 713 0.8000 1.0000 2.0000 0.0000 Constraint 77 706 0.8000 1.0000 2.0000 0.0000 Constraint 77 698 0.8000 1.0000 2.0000 0.0000 Constraint 77 690 0.8000 1.0000 2.0000 0.0000 Constraint 77 681 0.8000 1.0000 2.0000 0.0000 Constraint 77 673 0.8000 1.0000 2.0000 0.0000 Constraint 77 564 0.8000 1.0000 2.0000 0.0000 Constraint 77 403 0.8000 1.0000 2.0000 0.0000 Constraint 77 392 0.8000 1.0000 2.0000 0.0000 Constraint 77 375 0.8000 1.0000 2.0000 0.0000 Constraint 77 347 0.8000 1.0000 2.0000 0.0000 Constraint 77 233 0.8000 1.0000 2.0000 0.0000 Constraint 77 227 0.8000 1.0000 2.0000 0.0000 Constraint 77 222 0.8000 1.0000 2.0000 0.0000 Constraint 77 136 0.8000 1.0000 2.0000 0.0000 Constraint 77 128 0.8000 1.0000 2.0000 0.0000 Constraint 77 121 0.8000 1.0000 2.0000 0.0000 Constraint 77 112 0.8000 1.0000 2.0000 0.0000 Constraint 77 104 0.8000 1.0000 2.0000 0.0000 Constraint 77 97 0.8000 1.0000 2.0000 0.0000 Constraint 77 91 0.8000 1.0000 2.0000 0.0000 Constraint 77 82 0.8000 1.0000 2.0000 0.0000 Constraint 66 1788 0.8000 1.0000 2.0000 0.0000 Constraint 66 1777 0.8000 1.0000 2.0000 0.0000 Constraint 66 1764 0.8000 1.0000 2.0000 0.0000 Constraint 66 1756 0.8000 1.0000 2.0000 0.0000 Constraint 66 1748 0.8000 1.0000 2.0000 0.0000 Constraint 66 1739 0.8000 1.0000 2.0000 0.0000 Constraint 66 1731 0.8000 1.0000 2.0000 0.0000 Constraint 66 1720 0.8000 1.0000 2.0000 0.0000 Constraint 66 1714 0.8000 1.0000 2.0000 0.0000 Constraint 66 1692 0.8000 1.0000 2.0000 0.0000 Constraint 66 1611 0.8000 1.0000 2.0000 0.0000 Constraint 66 1603 0.8000 1.0000 2.0000 0.0000 Constraint 66 1596 0.8000 1.0000 2.0000 0.0000 Constraint 66 1587 0.8000 1.0000 2.0000 0.0000 Constraint 66 1575 0.8000 1.0000 2.0000 0.0000 Constraint 66 1548 0.8000 1.0000 2.0000 0.0000 Constraint 66 1541 0.8000 1.0000 2.0000 0.0000 Constraint 66 1519 0.8000 1.0000 2.0000 0.0000 Constraint 66 1511 0.8000 1.0000 2.0000 0.0000 Constraint 66 1503 0.8000 1.0000 2.0000 0.0000 Constraint 66 1494 0.8000 1.0000 2.0000 0.0000 Constraint 66 1488 0.8000 1.0000 2.0000 0.0000 Constraint 66 1479 0.8000 1.0000 2.0000 0.0000 Constraint 66 1466 0.8000 1.0000 2.0000 0.0000 Constraint 66 1455 0.8000 1.0000 2.0000 0.0000 Constraint 66 1447 0.8000 1.0000 2.0000 0.0000 Constraint 66 1427 0.8000 1.0000 2.0000 0.0000 Constraint 66 1416 0.8000 1.0000 2.0000 0.0000 Constraint 66 1391 0.8000 1.0000 2.0000 0.0000 Constraint 66 1382 0.8000 1.0000 2.0000 0.0000 Constraint 66 1366 0.8000 1.0000 2.0000 0.0000 Constraint 66 1351 0.8000 1.0000 2.0000 0.0000 Constraint 66 1343 0.8000 1.0000 2.0000 0.0000 Constraint 66 1334 0.8000 1.0000 2.0000 0.0000 Constraint 66 1317 0.8000 1.0000 2.0000 0.0000 Constraint 66 1309 0.8000 1.0000 2.0000 0.0000 Constraint 66 1239 0.8000 1.0000 2.0000 0.0000 Constraint 66 1220 0.8000 1.0000 2.0000 0.0000 Constraint 66 1158 0.8000 1.0000 2.0000 0.0000 Constraint 66 1149 0.8000 1.0000 2.0000 0.0000 Constraint 66 1141 0.8000 1.0000 2.0000 0.0000 Constraint 66 1117 0.8000 1.0000 2.0000 0.0000 Constraint 66 1077 0.8000 1.0000 2.0000 0.0000 Constraint 66 1068 0.8000 1.0000 2.0000 0.0000 Constraint 66 1022 0.8000 1.0000 2.0000 0.0000 Constraint 66 1008 0.8000 1.0000 2.0000 0.0000 Constraint 66 988 0.8000 1.0000 2.0000 0.0000 Constraint 66 930 0.8000 1.0000 2.0000 0.0000 Constraint 66 859 0.8000 1.0000 2.0000 0.0000 Constraint 66 836 0.8000 1.0000 2.0000 0.0000 Constraint 66 818 0.8000 1.0000 2.0000 0.0000 Constraint 66 783 0.8000 1.0000 2.0000 0.0000 Constraint 66 778 0.8000 1.0000 2.0000 0.0000 Constraint 66 748 0.8000 1.0000 2.0000 0.0000 Constraint 66 739 0.8000 1.0000 2.0000 0.0000 Constraint 66 722 0.8000 1.0000 2.0000 0.0000 Constraint 66 713 0.8000 1.0000 2.0000 0.0000 Constraint 66 706 0.8000 1.0000 2.0000 0.0000 Constraint 66 698 0.8000 1.0000 2.0000 0.0000 Constraint 66 690 0.8000 1.0000 2.0000 0.0000 Constraint 66 681 0.8000 1.0000 2.0000 0.0000 Constraint 66 673 0.8000 1.0000 2.0000 0.0000 Constraint 66 665 0.8000 1.0000 2.0000 0.0000 Constraint 66 657 0.8000 1.0000 2.0000 0.0000 Constraint 66 639 0.8000 1.0000 2.0000 0.0000 Constraint 66 368 0.8000 1.0000 2.0000 0.0000 Constraint 66 347 0.8000 1.0000 2.0000 0.0000 Constraint 66 314 0.8000 1.0000 2.0000 0.0000 Constraint 66 128 0.8000 1.0000 2.0000 0.0000 Constraint 66 121 0.8000 1.0000 2.0000 0.0000 Constraint 66 112 0.8000 1.0000 2.0000 0.0000 Constraint 66 104 0.8000 1.0000 2.0000 0.0000 Constraint 66 97 0.8000 1.0000 2.0000 0.0000 Constraint 66 91 0.8000 1.0000 2.0000 0.0000 Constraint 66 82 0.8000 1.0000 2.0000 0.0000 Constraint 66 77 0.8000 1.0000 2.0000 0.0000 Constraint 59 1777 0.8000 1.0000 2.0000 0.0000 Constraint 59 1764 0.8000 1.0000 2.0000 0.0000 Constraint 59 1756 0.8000 1.0000 2.0000 0.0000 Constraint 59 1748 0.8000 1.0000 2.0000 0.0000 Constraint 59 1739 0.8000 1.0000 2.0000 0.0000 Constraint 59 1731 0.8000 1.0000 2.0000 0.0000 Constraint 59 1720 0.8000 1.0000 2.0000 0.0000 Constraint 59 1714 0.8000 1.0000 2.0000 0.0000 Constraint 59 1703 0.8000 1.0000 2.0000 0.0000 Constraint 59 1692 0.8000 1.0000 2.0000 0.0000 Constraint 59 1634 0.8000 1.0000 2.0000 0.0000 Constraint 59 1620 0.8000 1.0000 2.0000 0.0000 Constraint 59 1611 0.8000 1.0000 2.0000 0.0000 Constraint 59 1603 0.8000 1.0000 2.0000 0.0000 Constraint 59 1596 0.8000 1.0000 2.0000 0.0000 Constraint 59 1575 0.8000 1.0000 2.0000 0.0000 Constraint 59 1567 0.8000 1.0000 2.0000 0.0000 Constraint 59 1548 0.8000 1.0000 2.0000 0.0000 Constraint 59 1541 0.8000 1.0000 2.0000 0.0000 Constraint 59 1533 0.8000 1.0000 2.0000 0.0000 Constraint 59 1526 0.8000 1.0000 2.0000 0.0000 Constraint 59 1519 0.8000 1.0000 2.0000 0.0000 Constraint 59 1511 0.8000 1.0000 2.0000 0.0000 Constraint 59 1488 0.8000 1.0000 2.0000 0.0000 Constraint 59 1479 0.8000 1.0000 2.0000 0.0000 Constraint 59 1466 0.8000 1.0000 2.0000 0.0000 Constraint 59 1455 0.8000 1.0000 2.0000 0.0000 Constraint 59 1447 0.8000 1.0000 2.0000 0.0000 Constraint 59 1438 0.8000 1.0000 2.0000 0.0000 Constraint 59 1427 0.8000 1.0000 2.0000 0.0000 Constraint 59 1416 0.8000 1.0000 2.0000 0.0000 Constraint 59 1408 0.8000 1.0000 2.0000 0.0000 Constraint 59 1399 0.8000 1.0000 2.0000 0.0000 Constraint 59 1391 0.8000 1.0000 2.0000 0.0000 Constraint 59 1382 0.8000 1.0000 2.0000 0.0000 Constraint 59 1366 0.8000 1.0000 2.0000 0.0000 Constraint 59 1358 0.8000 1.0000 2.0000 0.0000 Constraint 59 1351 0.8000 1.0000 2.0000 0.0000 Constraint 59 1343 0.8000 1.0000 2.0000 0.0000 Constraint 59 1334 0.8000 1.0000 2.0000 0.0000 Constraint 59 1325 0.8000 1.0000 2.0000 0.0000 Constraint 59 1317 0.8000 1.0000 2.0000 0.0000 Constraint 59 1309 0.8000 1.0000 2.0000 0.0000 Constraint 59 1284 0.8000 1.0000 2.0000 0.0000 Constraint 59 1276 0.8000 1.0000 2.0000 0.0000 Constraint 59 1260 0.8000 1.0000 2.0000 0.0000 Constraint 59 1251 0.8000 1.0000 2.0000 0.0000 Constraint 59 1246 0.8000 1.0000 2.0000 0.0000 Constraint 59 1239 0.8000 1.0000 2.0000 0.0000 Constraint 59 1228 0.8000 1.0000 2.0000 0.0000 Constraint 59 1193 0.8000 1.0000 2.0000 0.0000 Constraint 59 1178 0.8000 1.0000 2.0000 0.0000 Constraint 59 1158 0.8000 1.0000 2.0000 0.0000 Constraint 59 1141 0.8000 1.0000 2.0000 0.0000 Constraint 59 1125 0.8000 1.0000 2.0000 0.0000 Constraint 59 1117 0.8000 1.0000 2.0000 0.0000 Constraint 59 1100 0.8000 1.0000 2.0000 0.0000 Constraint 59 1092 0.8000 1.0000 2.0000 0.0000 Constraint 59 1035 0.8000 1.0000 2.0000 0.0000 Constraint 59 988 0.8000 1.0000 2.0000 0.0000 Constraint 59 913 0.8000 1.0000 2.0000 0.0000 Constraint 59 868 0.8000 1.0000 2.0000 0.0000 Constraint 59 859 0.8000 1.0000 2.0000 0.0000 Constraint 59 836 0.8000 1.0000 2.0000 0.0000 Constraint 59 829 0.8000 1.0000 2.0000 0.0000 Constraint 59 818 0.8000 1.0000 2.0000 0.0000 Constraint 59 783 0.8000 1.0000 2.0000 0.0000 Constraint 59 748 0.8000 1.0000 2.0000 0.0000 Constraint 59 722 0.8000 1.0000 2.0000 0.0000 Constraint 59 713 0.8000 1.0000 2.0000 0.0000 Constraint 59 698 0.8000 1.0000 2.0000 0.0000 Constraint 59 690 0.8000 1.0000 2.0000 0.0000 Constraint 59 681 0.8000 1.0000 2.0000 0.0000 Constraint 59 673 0.8000 1.0000 2.0000 0.0000 Constraint 59 665 0.8000 1.0000 2.0000 0.0000 Constraint 59 657 0.8000 1.0000 2.0000 0.0000 Constraint 59 650 0.8000 1.0000 2.0000 0.0000 Constraint 59 639 0.8000 1.0000 2.0000 0.0000 Constraint 59 630 0.8000 1.0000 2.0000 0.0000 Constraint 59 623 0.8000 1.0000 2.0000 0.0000 Constraint 59 616 0.8000 1.0000 2.0000 0.0000 Constraint 59 608 0.8000 1.0000 2.0000 0.0000 Constraint 59 597 0.8000 1.0000 2.0000 0.0000 Constraint 59 579 0.8000 1.0000 2.0000 0.0000 Constraint 59 538 0.8000 1.0000 2.0000 0.0000 Constraint 59 530 0.8000 1.0000 2.0000 0.0000 Constraint 59 501 0.8000 1.0000 2.0000 0.0000 Constraint 59 493 0.8000 1.0000 2.0000 0.0000 Constraint 59 479 0.8000 1.0000 2.0000 0.0000 Constraint 59 466 0.8000 1.0000 2.0000 0.0000 Constraint 59 448 0.8000 1.0000 2.0000 0.0000 Constraint 59 443 0.8000 1.0000 2.0000 0.0000 Constraint 59 435 0.8000 1.0000 2.0000 0.0000 Constraint 59 429 0.8000 1.0000 2.0000 0.0000 Constraint 59 412 0.8000 1.0000 2.0000 0.0000 Constraint 59 375 0.8000 1.0000 2.0000 0.0000 Constraint 59 368 0.8000 1.0000 2.0000 0.0000 Constraint 59 355 0.8000 1.0000 2.0000 0.0000 Constraint 59 333 0.8000 1.0000 2.0000 0.0000 Constraint 59 314 0.8000 1.0000 2.0000 0.0000 Constraint 59 285 0.8000 1.0000 2.0000 0.0000 Constraint 59 172 0.8000 1.0000 2.0000 0.0000 Constraint 59 121 0.8000 1.0000 2.0000 0.0000 Constraint 59 112 0.8000 1.0000 2.0000 0.0000 Constraint 59 104 0.8000 1.0000 2.0000 0.0000 Constraint 59 97 0.8000 1.0000 2.0000 0.0000 Constraint 59 91 0.8000 1.0000 2.0000 0.0000 Constraint 59 82 0.8000 1.0000 2.0000 0.0000 Constraint 59 77 0.8000 1.0000 2.0000 0.0000 Constraint 59 66 0.8000 1.0000 2.0000 0.0000 Constraint 47 1788 0.8000 1.0000 2.0000 0.0000 Constraint 47 1777 0.8000 1.0000 2.0000 0.0000 Constraint 47 1772 0.8000 1.0000 2.0000 0.0000 Constraint 47 1764 0.8000 1.0000 2.0000 0.0000 Constraint 47 1756 0.8000 1.0000 2.0000 0.0000 Constraint 47 1739 0.8000 1.0000 2.0000 0.0000 Constraint 47 1731 0.8000 1.0000 2.0000 0.0000 Constraint 47 1720 0.8000 1.0000 2.0000 0.0000 Constraint 47 1714 0.8000 1.0000 2.0000 0.0000 Constraint 47 1703 0.8000 1.0000 2.0000 0.0000 Constraint 47 1692 0.8000 1.0000 2.0000 0.0000 Constraint 47 1683 0.8000 1.0000 2.0000 0.0000 Constraint 47 1678 0.8000 1.0000 2.0000 0.0000 Constraint 47 1670 0.8000 1.0000 2.0000 0.0000 Constraint 47 1662 0.8000 1.0000 2.0000 0.0000 Constraint 47 1649 0.8000 1.0000 2.0000 0.0000 Constraint 47 1634 0.8000 1.0000 2.0000 0.0000 Constraint 47 1620 0.8000 1.0000 2.0000 0.0000 Constraint 47 1611 0.8000 1.0000 2.0000 0.0000 Constraint 47 1603 0.8000 1.0000 2.0000 0.0000 Constraint 47 1596 0.8000 1.0000 2.0000 0.0000 Constraint 47 1587 0.8000 1.0000 2.0000 0.0000 Constraint 47 1575 0.8000 1.0000 2.0000 0.0000 Constraint 47 1567 0.8000 1.0000 2.0000 0.0000 Constraint 47 1556 0.8000 1.0000 2.0000 0.0000 Constraint 47 1548 0.8000 1.0000 2.0000 0.0000 Constraint 47 1541 0.8000 1.0000 2.0000 0.0000 Constraint 47 1533 0.8000 1.0000 2.0000 0.0000 Constraint 47 1526 0.8000 1.0000 2.0000 0.0000 Constraint 47 1519 0.8000 1.0000 2.0000 0.0000 Constraint 47 1511 0.8000 1.0000 2.0000 0.0000 Constraint 47 1503 0.8000 1.0000 2.0000 0.0000 Constraint 47 1494 0.8000 1.0000 2.0000 0.0000 Constraint 47 1488 0.8000 1.0000 2.0000 0.0000 Constraint 47 1479 0.8000 1.0000 2.0000 0.0000 Constraint 47 1466 0.8000 1.0000 2.0000 0.0000 Constraint 47 1455 0.8000 1.0000 2.0000 0.0000 Constraint 47 1447 0.8000 1.0000 2.0000 0.0000 Constraint 47 1438 0.8000 1.0000 2.0000 0.0000 Constraint 47 1427 0.8000 1.0000 2.0000 0.0000 Constraint 47 1416 0.8000 1.0000 2.0000 0.0000 Constraint 47 1408 0.8000 1.0000 2.0000 0.0000 Constraint 47 1391 0.8000 1.0000 2.0000 0.0000 Constraint 47 1382 0.8000 1.0000 2.0000 0.0000 Constraint 47 1374 0.8000 1.0000 2.0000 0.0000 Constraint 47 1366 0.8000 1.0000 2.0000 0.0000 Constraint 47 1351 0.8000 1.0000 2.0000 0.0000 Constraint 47 1343 0.8000 1.0000 2.0000 0.0000 Constraint 47 1334 0.8000 1.0000 2.0000 0.0000 Constraint 47 1317 0.8000 1.0000 2.0000 0.0000 Constraint 47 1309 0.8000 1.0000 2.0000 0.0000 Constraint 47 1284 0.8000 1.0000 2.0000 0.0000 Constraint 47 1276 0.8000 1.0000 2.0000 0.0000 Constraint 47 1246 0.8000 1.0000 2.0000 0.0000 Constraint 47 1239 0.8000 1.0000 2.0000 0.0000 Constraint 47 1178 0.8000 1.0000 2.0000 0.0000 Constraint 47 1158 0.8000 1.0000 2.0000 0.0000 Constraint 47 1133 0.8000 1.0000 2.0000 0.0000 Constraint 47 1077 0.8000 1.0000 2.0000 0.0000 Constraint 47 1022 0.8000 1.0000 2.0000 0.0000 Constraint 47 988 0.8000 1.0000 2.0000 0.0000 Constraint 47 859 0.8000 1.0000 2.0000 0.0000 Constraint 47 848 0.8000 1.0000 2.0000 0.0000 Constraint 47 836 0.8000 1.0000 2.0000 0.0000 Constraint 47 829 0.8000 1.0000 2.0000 0.0000 Constraint 47 808 0.8000 1.0000 2.0000 0.0000 Constraint 47 792 0.8000 1.0000 2.0000 0.0000 Constraint 47 783 0.8000 1.0000 2.0000 0.0000 Constraint 47 778 0.8000 1.0000 2.0000 0.0000 Constraint 47 769 0.8000 1.0000 2.0000 0.0000 Constraint 47 761 0.8000 1.0000 2.0000 0.0000 Constraint 47 756 0.8000 1.0000 2.0000 0.0000 Constraint 47 748 0.8000 1.0000 2.0000 0.0000 Constraint 47 739 0.8000 1.0000 2.0000 0.0000 Constraint 47 722 0.8000 1.0000 2.0000 0.0000 Constraint 47 713 0.8000 1.0000 2.0000 0.0000 Constraint 47 698 0.8000 1.0000 2.0000 0.0000 Constraint 47 690 0.8000 1.0000 2.0000 0.0000 Constraint 47 681 0.8000 1.0000 2.0000 0.0000 Constraint 47 673 0.8000 1.0000 2.0000 0.0000 Constraint 47 657 0.8000 1.0000 2.0000 0.0000 Constraint 47 557 0.8000 1.0000 2.0000 0.0000 Constraint 47 549 0.8000 1.0000 2.0000 0.0000 Constraint 47 538 0.8000 1.0000 2.0000 0.0000 Constraint 47 521 0.8000 1.0000 2.0000 0.0000 Constraint 47 501 0.8000 1.0000 2.0000 0.0000 Constraint 47 493 0.8000 1.0000 2.0000 0.0000 Constraint 47 487 0.8000 1.0000 2.0000 0.0000 Constraint 47 448 0.8000 1.0000 2.0000 0.0000 Constraint 47 429 0.8000 1.0000 2.0000 0.0000 Constraint 47 368 0.8000 1.0000 2.0000 0.0000 Constraint 47 347 0.8000 1.0000 2.0000 0.0000 Constraint 47 333 0.8000 1.0000 2.0000 0.0000 Constraint 47 314 0.8000 1.0000 2.0000 0.0000 Constraint 47 299 0.8000 1.0000 2.0000 0.0000 Constraint 47 104 0.8000 1.0000 2.0000 0.0000 Constraint 47 97 0.8000 1.0000 2.0000 0.0000 Constraint 47 91 0.8000 1.0000 2.0000 0.0000 Constraint 47 82 0.8000 1.0000 2.0000 0.0000 Constraint 47 77 0.8000 1.0000 2.0000 0.0000 Constraint 47 66 0.8000 1.0000 2.0000 0.0000 Constraint 47 59 0.8000 1.0000 2.0000 0.0000 Constraint 39 1788 0.8000 1.0000 2.0000 0.0000 Constraint 39 1777 0.8000 1.0000 2.0000 0.0000 Constraint 39 1772 0.8000 1.0000 2.0000 0.0000 Constraint 39 1764 0.8000 1.0000 2.0000 0.0000 Constraint 39 1756 0.8000 1.0000 2.0000 0.0000 Constraint 39 1731 0.8000 1.0000 2.0000 0.0000 Constraint 39 1703 0.8000 1.0000 2.0000 0.0000 Constraint 39 1692 0.8000 1.0000 2.0000 0.0000 Constraint 39 1683 0.8000 1.0000 2.0000 0.0000 Constraint 39 1649 0.8000 1.0000 2.0000 0.0000 Constraint 39 1620 0.8000 1.0000 2.0000 0.0000 Constraint 39 1611 0.8000 1.0000 2.0000 0.0000 Constraint 39 1603 0.8000 1.0000 2.0000 0.0000 Constraint 39 1596 0.8000 1.0000 2.0000 0.0000 Constraint 39 1587 0.8000 1.0000 2.0000 0.0000 Constraint 39 1575 0.8000 1.0000 2.0000 0.0000 Constraint 39 1567 0.8000 1.0000 2.0000 0.0000 Constraint 39 1541 0.8000 1.0000 2.0000 0.0000 Constraint 39 1533 0.8000 1.0000 2.0000 0.0000 Constraint 39 1526 0.8000 1.0000 2.0000 0.0000 Constraint 39 1494 0.8000 1.0000 2.0000 0.0000 Constraint 39 1488 0.8000 1.0000 2.0000 0.0000 Constraint 39 1447 0.8000 1.0000 2.0000 0.0000 Constraint 39 1416 0.8000 1.0000 2.0000 0.0000 Constraint 39 1408 0.8000 1.0000 2.0000 0.0000 Constraint 39 1399 0.8000 1.0000 2.0000 0.0000 Constraint 39 1391 0.8000 1.0000 2.0000 0.0000 Constraint 39 1382 0.8000 1.0000 2.0000 0.0000 Constraint 39 1366 0.8000 1.0000 2.0000 0.0000 Constraint 39 1358 0.8000 1.0000 2.0000 0.0000 Constraint 39 1351 0.8000 1.0000 2.0000 0.0000 Constraint 39 1343 0.8000 1.0000 2.0000 0.0000 Constraint 39 1334 0.8000 1.0000 2.0000 0.0000 Constraint 39 1317 0.8000 1.0000 2.0000 0.0000 Constraint 39 1309 0.8000 1.0000 2.0000 0.0000 Constraint 39 1284 0.8000 1.0000 2.0000 0.0000 Constraint 39 1276 0.8000 1.0000 2.0000 0.0000 Constraint 39 1239 0.8000 1.0000 2.0000 0.0000 Constraint 39 1228 0.8000 1.0000 2.0000 0.0000 Constraint 39 1178 0.8000 1.0000 2.0000 0.0000 Constraint 39 1167 0.8000 1.0000 2.0000 0.0000 Constraint 39 1158 0.8000 1.0000 2.0000 0.0000 Constraint 39 1149 0.8000 1.0000 2.0000 0.0000 Constraint 39 1141 0.8000 1.0000 2.0000 0.0000 Constraint 39 1133 0.8000 1.0000 2.0000 0.0000 Constraint 39 1125 0.8000 1.0000 2.0000 0.0000 Constraint 39 1100 0.8000 1.0000 2.0000 0.0000 Constraint 39 1077 0.8000 1.0000 2.0000 0.0000 Constraint 39 988 0.8000 1.0000 2.0000 0.0000 Constraint 39 963 0.8000 1.0000 2.0000 0.0000 Constraint 39 913 0.8000 1.0000 2.0000 0.0000 Constraint 39 908 0.8000 1.0000 2.0000 0.0000 Constraint 39 899 0.8000 1.0000 2.0000 0.0000 Constraint 39 876 0.8000 1.0000 2.0000 0.0000 Constraint 39 868 0.8000 1.0000 2.0000 0.0000 Constraint 39 859 0.8000 1.0000 2.0000 0.0000 Constraint 39 848 0.8000 1.0000 2.0000 0.0000 Constraint 39 829 0.8000 1.0000 2.0000 0.0000 Constraint 39 818 0.8000 1.0000 2.0000 0.0000 Constraint 39 808 0.8000 1.0000 2.0000 0.0000 Constraint 39 800 0.8000 1.0000 2.0000 0.0000 Constraint 39 792 0.8000 1.0000 2.0000 0.0000 Constraint 39 769 0.8000 1.0000 2.0000 0.0000 Constraint 39 761 0.8000 1.0000 2.0000 0.0000 Constraint 39 748 0.8000 1.0000 2.0000 0.0000 Constraint 39 739 0.8000 1.0000 2.0000 0.0000 Constraint 39 713 0.8000 1.0000 2.0000 0.0000 Constraint 39 706 0.8000 1.0000 2.0000 0.0000 Constraint 39 698 0.8000 1.0000 2.0000 0.0000 Constraint 39 690 0.8000 1.0000 2.0000 0.0000 Constraint 39 681 0.8000 1.0000 2.0000 0.0000 Constraint 39 673 0.8000 1.0000 2.0000 0.0000 Constraint 39 665 0.8000 1.0000 2.0000 0.0000 Constraint 39 657 0.8000 1.0000 2.0000 0.0000 Constraint 39 639 0.8000 1.0000 2.0000 0.0000 Constraint 39 630 0.8000 1.0000 2.0000 0.0000 Constraint 39 616 0.8000 1.0000 2.0000 0.0000 Constraint 39 608 0.8000 1.0000 2.0000 0.0000 Constraint 39 589 0.8000 1.0000 2.0000 0.0000 Constraint 39 572 0.8000 1.0000 2.0000 0.0000 Constraint 39 557 0.8000 1.0000 2.0000 0.0000 Constraint 39 549 0.8000 1.0000 2.0000 0.0000 Constraint 39 538 0.8000 1.0000 2.0000 0.0000 Constraint 39 521 0.8000 1.0000 2.0000 0.0000 Constraint 39 487 0.8000 1.0000 2.0000 0.0000 Constraint 39 457 0.8000 1.0000 2.0000 0.0000 Constraint 39 429 0.8000 1.0000 2.0000 0.0000 Constraint 39 375 0.8000 1.0000 2.0000 0.0000 Constraint 39 368 0.8000 1.0000 2.0000 0.0000 Constraint 39 355 0.8000 1.0000 2.0000 0.0000 Constraint 39 333 0.8000 1.0000 2.0000 0.0000 Constraint 39 314 0.8000 1.0000 2.0000 0.0000 Constraint 39 306 0.8000 1.0000 2.0000 0.0000 Constraint 39 294 0.8000 1.0000 2.0000 0.0000 Constraint 39 97 0.8000 1.0000 2.0000 0.0000 Constraint 39 91 0.8000 1.0000 2.0000 0.0000 Constraint 39 82 0.8000 1.0000 2.0000 0.0000 Constraint 39 77 0.8000 1.0000 2.0000 0.0000 Constraint 39 66 0.8000 1.0000 2.0000 0.0000 Constraint 39 59 0.8000 1.0000 2.0000 0.0000 Constraint 39 47 0.8000 1.0000 2.0000 0.0000 Constraint 33 1788 0.8000 1.0000 2.0000 0.0000 Constraint 33 1777 0.8000 1.0000 2.0000 0.0000 Constraint 33 1772 0.8000 1.0000 2.0000 0.0000 Constraint 33 1764 0.8000 1.0000 2.0000 0.0000 Constraint 33 1748 0.8000 1.0000 2.0000 0.0000 Constraint 33 1739 0.8000 1.0000 2.0000 0.0000 Constraint 33 1731 0.8000 1.0000 2.0000 0.0000 Constraint 33 1720 0.8000 1.0000 2.0000 0.0000 Constraint 33 1714 0.8000 1.0000 2.0000 0.0000 Constraint 33 1703 0.8000 1.0000 2.0000 0.0000 Constraint 33 1692 0.8000 1.0000 2.0000 0.0000 Constraint 33 1683 0.8000 1.0000 2.0000 0.0000 Constraint 33 1670 0.8000 1.0000 2.0000 0.0000 Constraint 33 1620 0.8000 1.0000 2.0000 0.0000 Constraint 33 1611 0.8000 1.0000 2.0000 0.0000 Constraint 33 1596 0.8000 1.0000 2.0000 0.0000 Constraint 33 1587 0.8000 1.0000 2.0000 0.0000 Constraint 33 1575 0.8000 1.0000 2.0000 0.0000 Constraint 33 1567 0.8000 1.0000 2.0000 0.0000 Constraint 33 1556 0.8000 1.0000 2.0000 0.0000 Constraint 33 1548 0.8000 1.0000 2.0000 0.0000 Constraint 33 1541 0.8000 1.0000 2.0000 0.0000 Constraint 33 1533 0.8000 1.0000 2.0000 0.0000 Constraint 33 1494 0.8000 1.0000 2.0000 0.0000 Constraint 33 1488 0.8000 1.0000 2.0000 0.0000 Constraint 33 1466 0.8000 1.0000 2.0000 0.0000 Constraint 33 1447 0.8000 1.0000 2.0000 0.0000 Constraint 33 1438 0.8000 1.0000 2.0000 0.0000 Constraint 33 1427 0.8000 1.0000 2.0000 0.0000 Constraint 33 1416 0.8000 1.0000 2.0000 0.0000 Constraint 33 1408 0.8000 1.0000 2.0000 0.0000 Constraint 33 1399 0.8000 1.0000 2.0000 0.0000 Constraint 33 1391 0.8000 1.0000 2.0000 0.0000 Constraint 33 1382 0.8000 1.0000 2.0000 0.0000 Constraint 33 1374 0.8000 1.0000 2.0000 0.0000 Constraint 33 1366 0.8000 1.0000 2.0000 0.0000 Constraint 33 1358 0.8000 1.0000 2.0000 0.0000 Constraint 33 1351 0.8000 1.0000 2.0000 0.0000 Constraint 33 1343 0.8000 1.0000 2.0000 0.0000 Constraint 33 1317 0.8000 1.0000 2.0000 0.0000 Constraint 33 1309 0.8000 1.0000 2.0000 0.0000 Constraint 33 1293 0.8000 1.0000 2.0000 0.0000 Constraint 33 1284 0.8000 1.0000 2.0000 0.0000 Constraint 33 1276 0.8000 1.0000 2.0000 0.0000 Constraint 33 1260 0.8000 1.0000 2.0000 0.0000 Constraint 33 1251 0.8000 1.0000 2.0000 0.0000 Constraint 33 1228 0.8000 1.0000 2.0000 0.0000 Constraint 33 1193 0.8000 1.0000 2.0000 0.0000 Constraint 33 1178 0.8000 1.0000 2.0000 0.0000 Constraint 33 1158 0.8000 1.0000 2.0000 0.0000 Constraint 33 1133 0.8000 1.0000 2.0000 0.0000 Constraint 33 1109 0.8000 1.0000 2.0000 0.0000 Constraint 33 1100 0.8000 1.0000 2.0000 0.0000 Constraint 33 1084 0.8000 1.0000 2.0000 0.0000 Constraint 33 1077 0.8000 1.0000 2.0000 0.0000 Constraint 33 1014 0.8000 1.0000 2.0000 0.0000 Constraint 33 1008 0.8000 1.0000 2.0000 0.0000 Constraint 33 997 0.8000 1.0000 2.0000 0.0000 Constraint 33 968 0.8000 1.0000 2.0000 0.0000 Constraint 33 963 0.8000 1.0000 2.0000 0.0000 Constraint 33 913 0.8000 1.0000 2.0000 0.0000 Constraint 33 899 0.8000 1.0000 2.0000 0.0000 Constraint 33 892 0.8000 1.0000 2.0000 0.0000 Constraint 33 868 0.8000 1.0000 2.0000 0.0000 Constraint 33 859 0.8000 1.0000 2.0000 0.0000 Constraint 33 848 0.8000 1.0000 2.0000 0.0000 Constraint 33 836 0.8000 1.0000 2.0000 0.0000 Constraint 33 829 0.8000 1.0000 2.0000 0.0000 Constraint 33 818 0.8000 1.0000 2.0000 0.0000 Constraint 33 808 0.8000 1.0000 2.0000 0.0000 Constraint 33 800 0.8000 1.0000 2.0000 0.0000 Constraint 33 792 0.8000 1.0000 2.0000 0.0000 Constraint 33 783 0.8000 1.0000 2.0000 0.0000 Constraint 33 778 0.8000 1.0000 2.0000 0.0000 Constraint 33 769 0.8000 1.0000 2.0000 0.0000 Constraint 33 761 0.8000 1.0000 2.0000 0.0000 Constraint 33 756 0.8000 1.0000 2.0000 0.0000 Constraint 33 748 0.8000 1.0000 2.0000 0.0000 Constraint 33 713 0.8000 1.0000 2.0000 0.0000 Constraint 33 690 0.8000 1.0000 2.0000 0.0000 Constraint 33 681 0.8000 1.0000 2.0000 0.0000 Constraint 33 673 0.8000 1.0000 2.0000 0.0000 Constraint 33 657 0.8000 1.0000 2.0000 0.0000 Constraint 33 650 0.8000 1.0000 2.0000 0.0000 Constraint 33 630 0.8000 1.0000 2.0000 0.0000 Constraint 33 623 0.8000 1.0000 2.0000 0.0000 Constraint 33 608 0.8000 1.0000 2.0000 0.0000 Constraint 33 597 0.8000 1.0000 2.0000 0.0000 Constraint 33 589 0.8000 1.0000 2.0000 0.0000 Constraint 33 579 0.8000 1.0000 2.0000 0.0000 Constraint 33 564 0.8000 1.0000 2.0000 0.0000 Constraint 33 557 0.8000 1.0000 2.0000 0.0000 Constraint 33 549 0.8000 1.0000 2.0000 0.0000 Constraint 33 538 0.8000 1.0000 2.0000 0.0000 Constraint 33 530 0.8000 1.0000 2.0000 0.0000 Constraint 33 521 0.8000 1.0000 2.0000 0.0000 Constraint 33 510 0.8000 1.0000 2.0000 0.0000 Constraint 33 501 0.8000 1.0000 2.0000 0.0000 Constraint 33 493 0.8000 1.0000 2.0000 0.0000 Constraint 33 487 0.8000 1.0000 2.0000 0.0000 Constraint 33 479 0.8000 1.0000 2.0000 0.0000 Constraint 33 466 0.8000 1.0000 2.0000 0.0000 Constraint 33 457 0.8000 1.0000 2.0000 0.0000 Constraint 33 435 0.8000 1.0000 2.0000 0.0000 Constraint 33 429 0.8000 1.0000 2.0000 0.0000 Constraint 33 421 0.8000 1.0000 2.0000 0.0000 Constraint 33 412 0.8000 1.0000 2.0000 0.0000 Constraint 33 403 0.8000 1.0000 2.0000 0.0000 Constraint 33 392 0.8000 1.0000 2.0000 0.0000 Constraint 33 375 0.8000 1.0000 2.0000 0.0000 Constraint 33 368 0.8000 1.0000 2.0000 0.0000 Constraint 33 363 0.8000 1.0000 2.0000 0.0000 Constraint 33 347 0.8000 1.0000 2.0000 0.0000 Constraint 33 314 0.8000 1.0000 2.0000 0.0000 Constraint 33 306 0.8000 1.0000 2.0000 0.0000 Constraint 33 285 0.8000 1.0000 2.0000 0.0000 Constraint 33 274 0.8000 1.0000 2.0000 0.0000 Constraint 33 112 0.8000 1.0000 2.0000 0.0000 Constraint 33 97 0.8000 1.0000 2.0000 0.0000 Constraint 33 91 0.8000 1.0000 2.0000 0.0000 Constraint 33 82 0.8000 1.0000 2.0000 0.0000 Constraint 33 77 0.8000 1.0000 2.0000 0.0000 Constraint 33 66 0.8000 1.0000 2.0000 0.0000 Constraint 33 59 0.8000 1.0000 2.0000 0.0000 Constraint 33 47 0.8000 1.0000 2.0000 0.0000 Constraint 33 39 0.8000 1.0000 2.0000 0.0000 Constraint 25 1788 0.8000 1.0000 2.0000 0.0000 Constraint 25 1777 0.8000 1.0000 2.0000 0.0000 Constraint 25 1772 0.8000 1.0000 2.0000 0.0000 Constraint 25 1764 0.8000 1.0000 2.0000 0.0000 Constraint 25 1756 0.8000 1.0000 2.0000 0.0000 Constraint 25 1748 0.8000 1.0000 2.0000 0.0000 Constraint 25 1739 0.8000 1.0000 2.0000 0.0000 Constraint 25 1731 0.8000 1.0000 2.0000 0.0000 Constraint 25 1720 0.8000 1.0000 2.0000 0.0000 Constraint 25 1714 0.8000 1.0000 2.0000 0.0000 Constraint 25 1703 0.8000 1.0000 2.0000 0.0000 Constraint 25 1692 0.8000 1.0000 2.0000 0.0000 Constraint 25 1683 0.8000 1.0000 2.0000 0.0000 Constraint 25 1670 0.8000 1.0000 2.0000 0.0000 Constraint 25 1662 0.8000 1.0000 2.0000 0.0000 Constraint 25 1620 0.8000 1.0000 2.0000 0.0000 Constraint 25 1611 0.8000 1.0000 2.0000 0.0000 Constraint 25 1596 0.8000 1.0000 2.0000 0.0000 Constraint 25 1587 0.8000 1.0000 2.0000 0.0000 Constraint 25 1575 0.8000 1.0000 2.0000 0.0000 Constraint 25 1567 0.8000 1.0000 2.0000 0.0000 Constraint 25 1556 0.8000 1.0000 2.0000 0.0000 Constraint 25 1548 0.8000 1.0000 2.0000 0.0000 Constraint 25 1541 0.8000 1.0000 2.0000 0.0000 Constraint 25 1533 0.8000 1.0000 2.0000 0.0000 Constraint 25 1526 0.8000 1.0000 2.0000 0.0000 Constraint 25 1519 0.8000 1.0000 2.0000 0.0000 Constraint 25 1511 0.8000 1.0000 2.0000 0.0000 Constraint 25 1494 0.8000 1.0000 2.0000 0.0000 Constraint 25 1488 0.8000 1.0000 2.0000 0.0000 Constraint 25 1479 0.8000 1.0000 2.0000 0.0000 Constraint 25 1471 0.8000 1.0000 2.0000 0.0000 Constraint 25 1466 0.8000 1.0000 2.0000 0.0000 Constraint 25 1447 0.8000 1.0000 2.0000 0.0000 Constraint 25 1438 0.8000 1.0000 2.0000 0.0000 Constraint 25 1427 0.8000 1.0000 2.0000 0.0000 Constraint 25 1416 0.8000 1.0000 2.0000 0.0000 Constraint 25 1408 0.8000 1.0000 2.0000 0.0000 Constraint 25 1399 0.8000 1.0000 2.0000 0.0000 Constraint 25 1391 0.8000 1.0000 2.0000 0.0000 Constraint 25 1382 0.8000 1.0000 2.0000 0.0000 Constraint 25 1374 0.8000 1.0000 2.0000 0.0000 Constraint 25 1366 0.8000 1.0000 2.0000 0.0000 Constraint 25 1351 0.8000 1.0000 2.0000 0.0000 Constraint 25 1343 0.8000 1.0000 2.0000 0.0000 Constraint 25 1317 0.8000 1.0000 2.0000 0.0000 Constraint 25 1309 0.8000 1.0000 2.0000 0.0000 Constraint 25 1293 0.8000 1.0000 2.0000 0.0000 Constraint 25 1284 0.8000 1.0000 2.0000 0.0000 Constraint 25 1260 0.8000 1.0000 2.0000 0.0000 Constraint 25 1251 0.8000 1.0000 2.0000 0.0000 Constraint 25 1246 0.8000 1.0000 2.0000 0.0000 Constraint 25 1228 0.8000 1.0000 2.0000 0.0000 Constraint 25 1167 0.8000 1.0000 2.0000 0.0000 Constraint 25 1158 0.8000 1.0000 2.0000 0.0000 Constraint 25 1133 0.8000 1.0000 2.0000 0.0000 Constraint 25 1109 0.8000 1.0000 2.0000 0.0000 Constraint 25 1077 0.8000 1.0000 2.0000 0.0000 Constraint 25 1046 0.8000 1.0000 2.0000 0.0000 Constraint 25 997 0.8000 1.0000 2.0000 0.0000 Constraint 25 944 0.8000 1.0000 2.0000 0.0000 Constraint 25 937 0.8000 1.0000 2.0000 0.0000 Constraint 25 930 0.8000 1.0000 2.0000 0.0000 Constraint 25 921 0.8000 1.0000 2.0000 0.0000 Constraint 25 913 0.8000 1.0000 2.0000 0.0000 Constraint 25 899 0.8000 1.0000 2.0000 0.0000 Constraint 25 884 0.8000 1.0000 2.0000 0.0000 Constraint 25 868 0.8000 1.0000 2.0000 0.0000 Constraint 25 859 0.8000 1.0000 2.0000 0.0000 Constraint 25 848 0.8000 1.0000 2.0000 0.0000 Constraint 25 836 0.8000 1.0000 2.0000 0.0000 Constraint 25 829 0.8000 1.0000 2.0000 0.0000 Constraint 25 783 0.8000 1.0000 2.0000 0.0000 Constraint 25 769 0.8000 1.0000 2.0000 0.0000 Constraint 25 761 0.8000 1.0000 2.0000 0.0000 Constraint 25 756 0.8000 1.0000 2.0000 0.0000 Constraint 25 731 0.8000 1.0000 2.0000 0.0000 Constraint 25 722 0.8000 1.0000 2.0000 0.0000 Constraint 25 698 0.8000 1.0000 2.0000 0.0000 Constraint 25 690 0.8000 1.0000 2.0000 0.0000 Constraint 25 681 0.8000 1.0000 2.0000 0.0000 Constraint 25 673 0.8000 1.0000 2.0000 0.0000 Constraint 25 665 0.8000 1.0000 2.0000 0.0000 Constraint 25 657 0.8000 1.0000 2.0000 0.0000 Constraint 25 639 0.8000 1.0000 2.0000 0.0000 Constraint 25 608 0.8000 1.0000 2.0000 0.0000 Constraint 25 597 0.8000 1.0000 2.0000 0.0000 Constraint 25 589 0.8000 1.0000 2.0000 0.0000 Constraint 25 579 0.8000 1.0000 2.0000 0.0000 Constraint 25 572 0.8000 1.0000 2.0000 0.0000 Constraint 25 564 0.8000 1.0000 2.0000 0.0000 Constraint 25 549 0.8000 1.0000 2.0000 0.0000 Constraint 25 538 0.8000 1.0000 2.0000 0.0000 Constraint 25 530 0.8000 1.0000 2.0000 0.0000 Constraint 25 521 0.8000 1.0000 2.0000 0.0000 Constraint 25 510 0.8000 1.0000 2.0000 0.0000 Constraint 25 501 0.8000 1.0000 2.0000 0.0000 Constraint 25 493 0.8000 1.0000 2.0000 0.0000 Constraint 25 466 0.8000 1.0000 2.0000 0.0000 Constraint 25 457 0.8000 1.0000 2.0000 0.0000 Constraint 25 448 0.8000 1.0000 2.0000 0.0000 Constraint 25 443 0.8000 1.0000 2.0000 0.0000 Constraint 25 435 0.8000 1.0000 2.0000 0.0000 Constraint 25 429 0.8000 1.0000 2.0000 0.0000 Constraint 25 421 0.8000 1.0000 2.0000 0.0000 Constraint 25 412 0.8000 1.0000 2.0000 0.0000 Constraint 25 403 0.8000 1.0000 2.0000 0.0000 Constraint 25 392 0.8000 1.0000 2.0000 0.0000 Constraint 25 384 0.8000 1.0000 2.0000 0.0000 Constraint 25 375 0.8000 1.0000 2.0000 0.0000 Constraint 25 368 0.8000 1.0000 2.0000 0.0000 Constraint 25 363 0.8000 1.0000 2.0000 0.0000 Constraint 25 347 0.8000 1.0000 2.0000 0.0000 Constraint 25 333 0.8000 1.0000 2.0000 0.0000 Constraint 25 306 0.8000 1.0000 2.0000 0.0000 Constraint 25 154 0.8000 1.0000 2.0000 0.0000 Constraint 25 145 0.8000 1.0000 2.0000 0.0000 Constraint 25 82 0.8000 1.0000 2.0000 0.0000 Constraint 25 77 0.8000 1.0000 2.0000 0.0000 Constraint 25 66 0.8000 1.0000 2.0000 0.0000 Constraint 25 59 0.8000 1.0000 2.0000 0.0000 Constraint 25 47 0.8000 1.0000 2.0000 0.0000 Constraint 25 39 0.8000 1.0000 2.0000 0.0000 Constraint 25 33 0.8000 1.0000 2.0000 0.0000 Constraint 18 1777 0.8000 1.0000 2.0000 0.0000 Constraint 18 1772 0.8000 1.0000 2.0000 0.0000 Constraint 18 1764 0.8000 1.0000 2.0000 0.0000 Constraint 18 1756 0.8000 1.0000 2.0000 0.0000 Constraint 18 1739 0.8000 1.0000 2.0000 0.0000 Constraint 18 1731 0.8000 1.0000 2.0000 0.0000 Constraint 18 1670 0.8000 1.0000 2.0000 0.0000 Constraint 18 1662 0.8000 1.0000 2.0000 0.0000 Constraint 18 1611 0.8000 1.0000 2.0000 0.0000 Constraint 18 1596 0.8000 1.0000 2.0000 0.0000 Constraint 18 1587 0.8000 1.0000 2.0000 0.0000 Constraint 18 1575 0.8000 1.0000 2.0000 0.0000 Constraint 18 1567 0.8000 1.0000 2.0000 0.0000 Constraint 18 1556 0.8000 1.0000 2.0000 0.0000 Constraint 18 1541 0.8000 1.0000 2.0000 0.0000 Constraint 18 1494 0.8000 1.0000 2.0000 0.0000 Constraint 18 1488 0.8000 1.0000 2.0000 0.0000 Constraint 18 1479 0.8000 1.0000 2.0000 0.0000 Constraint 18 1471 0.8000 1.0000 2.0000 0.0000 Constraint 18 1447 0.8000 1.0000 2.0000 0.0000 Constraint 18 1438 0.8000 1.0000 2.0000 0.0000 Constraint 18 1416 0.8000 1.0000 2.0000 0.0000 Constraint 18 1408 0.8000 1.0000 2.0000 0.0000 Constraint 18 1399 0.8000 1.0000 2.0000 0.0000 Constraint 18 1391 0.8000 1.0000 2.0000 0.0000 Constraint 18 1382 0.8000 1.0000 2.0000 0.0000 Constraint 18 1374 0.8000 1.0000 2.0000 0.0000 Constraint 18 1366 0.8000 1.0000 2.0000 0.0000 Constraint 18 1343 0.8000 1.0000 2.0000 0.0000 Constraint 18 1325 0.8000 1.0000 2.0000 0.0000 Constraint 18 1317 0.8000 1.0000 2.0000 0.0000 Constraint 18 1293 0.8000 1.0000 2.0000 0.0000 Constraint 18 1284 0.8000 1.0000 2.0000 0.0000 Constraint 18 1260 0.8000 1.0000 2.0000 0.0000 Constraint 18 1251 0.8000 1.0000 2.0000 0.0000 Constraint 18 1246 0.8000 1.0000 2.0000 0.0000 Constraint 18 1193 0.8000 1.0000 2.0000 0.0000 Constraint 18 1178 0.8000 1.0000 2.0000 0.0000 Constraint 18 1167 0.8000 1.0000 2.0000 0.0000 Constraint 18 1149 0.8000 1.0000 2.0000 0.0000 Constraint 18 1141 0.8000 1.0000 2.0000 0.0000 Constraint 18 1133 0.8000 1.0000 2.0000 0.0000 Constraint 18 1100 0.8000 1.0000 2.0000 0.0000 Constraint 18 1059 0.8000 1.0000 2.0000 0.0000 Constraint 18 1008 0.8000 1.0000 2.0000 0.0000 Constraint 18 937 0.8000 1.0000 2.0000 0.0000 Constraint 18 930 0.8000 1.0000 2.0000 0.0000 Constraint 18 899 0.8000 1.0000 2.0000 0.0000 Constraint 18 884 0.8000 1.0000 2.0000 0.0000 Constraint 18 868 0.8000 1.0000 2.0000 0.0000 Constraint 18 829 0.8000 1.0000 2.0000 0.0000 Constraint 18 818 0.8000 1.0000 2.0000 0.0000 Constraint 18 792 0.8000 1.0000 2.0000 0.0000 Constraint 18 778 0.8000 1.0000 2.0000 0.0000 Constraint 18 769 0.8000 1.0000 2.0000 0.0000 Constraint 18 761 0.8000 1.0000 2.0000 0.0000 Constraint 18 748 0.8000 1.0000 2.0000 0.0000 Constraint 18 731 0.8000 1.0000 2.0000 0.0000 Constraint 18 722 0.8000 1.0000 2.0000 0.0000 Constraint 18 713 0.8000 1.0000 2.0000 0.0000 Constraint 18 690 0.8000 1.0000 2.0000 0.0000 Constraint 18 681 0.8000 1.0000 2.0000 0.0000 Constraint 18 673 0.8000 1.0000 2.0000 0.0000 Constraint 18 665 0.8000 1.0000 2.0000 0.0000 Constraint 18 657 0.8000 1.0000 2.0000 0.0000 Constraint 18 639 0.8000 1.0000 2.0000 0.0000 Constraint 18 630 0.8000 1.0000 2.0000 0.0000 Constraint 18 608 0.8000 1.0000 2.0000 0.0000 Constraint 18 597 0.8000 1.0000 2.0000 0.0000 Constraint 18 572 0.8000 1.0000 2.0000 0.0000 Constraint 18 557 0.8000 1.0000 2.0000 0.0000 Constraint 18 538 0.8000 1.0000 2.0000 0.0000 Constraint 18 521 0.8000 1.0000 2.0000 0.0000 Constraint 18 510 0.8000 1.0000 2.0000 0.0000 Constraint 18 493 0.8000 1.0000 2.0000 0.0000 Constraint 18 466 0.8000 1.0000 2.0000 0.0000 Constraint 18 457 0.8000 1.0000 2.0000 0.0000 Constraint 18 448 0.8000 1.0000 2.0000 0.0000 Constraint 18 435 0.8000 1.0000 2.0000 0.0000 Constraint 18 429 0.8000 1.0000 2.0000 0.0000 Constraint 18 421 0.8000 1.0000 2.0000 0.0000 Constraint 18 412 0.8000 1.0000 2.0000 0.0000 Constraint 18 403 0.8000 1.0000 2.0000 0.0000 Constraint 18 392 0.8000 1.0000 2.0000 0.0000 Constraint 18 384 0.8000 1.0000 2.0000 0.0000 Constraint 18 375 0.8000 1.0000 2.0000 0.0000 Constraint 18 368 0.8000 1.0000 2.0000 0.0000 Constraint 18 363 0.8000 1.0000 2.0000 0.0000 Constraint 18 355 0.8000 1.0000 2.0000 0.0000 Constraint 18 347 0.8000 1.0000 2.0000 0.0000 Constraint 18 333 0.8000 1.0000 2.0000 0.0000 Constraint 18 314 0.8000 1.0000 2.0000 0.0000 Constraint 18 306 0.8000 1.0000 2.0000 0.0000 Constraint 18 294 0.8000 1.0000 2.0000 0.0000 Constraint 18 263 0.8000 1.0000 2.0000 0.0000 Constraint 18 196 0.8000 1.0000 2.0000 0.0000 Constraint 18 172 0.8000 1.0000 2.0000 0.0000 Constraint 18 154 0.8000 1.0000 2.0000 0.0000 Constraint 18 77 0.8000 1.0000 2.0000 0.0000 Constraint 18 66 0.8000 1.0000 2.0000 0.0000 Constraint 18 59 0.8000 1.0000 2.0000 0.0000 Constraint 18 47 0.8000 1.0000 2.0000 0.0000 Constraint 18 39 0.8000 1.0000 2.0000 0.0000 Constraint 18 33 0.8000 1.0000 2.0000 0.0000 Constraint 18 25 0.8000 1.0000 2.0000 0.0000 Constraint 11 1777 0.8000 1.0000 2.0000 0.0000 Constraint 11 1772 0.8000 1.0000 2.0000 0.0000 Constraint 11 1764 0.8000 1.0000 2.0000 0.0000 Constraint 11 1748 0.8000 1.0000 2.0000 0.0000 Constraint 11 1739 0.8000 1.0000 2.0000 0.0000 Constraint 11 1731 0.8000 1.0000 2.0000 0.0000 Constraint 11 1720 0.8000 1.0000 2.0000 0.0000 Constraint 11 1714 0.8000 1.0000 2.0000 0.0000 Constraint 11 1703 0.8000 1.0000 2.0000 0.0000 Constraint 11 1692 0.8000 1.0000 2.0000 0.0000 Constraint 11 1634 0.8000 1.0000 2.0000 0.0000 Constraint 11 1611 0.8000 1.0000 2.0000 0.0000 Constraint 11 1575 0.8000 1.0000 2.0000 0.0000 Constraint 11 1503 0.8000 1.0000 2.0000 0.0000 Constraint 11 1494 0.8000 1.0000 2.0000 0.0000 Constraint 11 1488 0.8000 1.0000 2.0000 0.0000 Constraint 11 1479 0.8000 1.0000 2.0000 0.0000 Constraint 11 1471 0.8000 1.0000 2.0000 0.0000 Constraint 11 1466 0.8000 1.0000 2.0000 0.0000 Constraint 11 1455 0.8000 1.0000 2.0000 0.0000 Constraint 11 1447 0.8000 1.0000 2.0000 0.0000 Constraint 11 1438 0.8000 1.0000 2.0000 0.0000 Constraint 11 1427 0.8000 1.0000 2.0000 0.0000 Constraint 11 1416 0.8000 1.0000 2.0000 0.0000 Constraint 11 1408 0.8000 1.0000 2.0000 0.0000 Constraint 11 1399 0.8000 1.0000 2.0000 0.0000 Constraint 11 1391 0.8000 1.0000 2.0000 0.0000 Constraint 11 1382 0.8000 1.0000 2.0000 0.0000 Constraint 11 1374 0.8000 1.0000 2.0000 0.0000 Constraint 11 1366 0.8000 1.0000 2.0000 0.0000 Constraint 11 1358 0.8000 1.0000 2.0000 0.0000 Constraint 11 1351 0.8000 1.0000 2.0000 0.0000 Constraint 11 1343 0.8000 1.0000 2.0000 0.0000 Constraint 11 1334 0.8000 1.0000 2.0000 0.0000 Constraint 11 1325 0.8000 1.0000 2.0000 0.0000 Constraint 11 1317 0.8000 1.0000 2.0000 0.0000 Constraint 11 1309 0.8000 1.0000 2.0000 0.0000 Constraint 11 1301 0.8000 1.0000 2.0000 0.0000 Constraint 11 1293 0.8000 1.0000 2.0000 0.0000 Constraint 11 1284 0.8000 1.0000 2.0000 0.0000 Constraint 11 1276 0.8000 1.0000 2.0000 0.0000 Constraint 11 1260 0.8000 1.0000 2.0000 0.0000 Constraint 11 1251 0.8000 1.0000 2.0000 0.0000 Constraint 11 1239 0.8000 1.0000 2.0000 0.0000 Constraint 11 1228 0.8000 1.0000 2.0000 0.0000 Constraint 11 1220 0.8000 1.0000 2.0000 0.0000 Constraint 11 1213 0.8000 1.0000 2.0000 0.0000 Constraint 11 1204 0.8000 1.0000 2.0000 0.0000 Constraint 11 1193 0.8000 1.0000 2.0000 0.0000 Constraint 11 1178 0.8000 1.0000 2.0000 0.0000 Constraint 11 1167 0.8000 1.0000 2.0000 0.0000 Constraint 11 1158 0.8000 1.0000 2.0000 0.0000 Constraint 11 1149 0.8000 1.0000 2.0000 0.0000 Constraint 11 1141 0.8000 1.0000 2.0000 0.0000 Constraint 11 1133 0.8000 1.0000 2.0000 0.0000 Constraint 11 1125 0.8000 1.0000 2.0000 0.0000 Constraint 11 1100 0.8000 1.0000 2.0000 0.0000 Constraint 11 1092 0.8000 1.0000 2.0000 0.0000 Constraint 11 1084 0.8000 1.0000 2.0000 0.0000 Constraint 11 1077 0.8000 1.0000 2.0000 0.0000 Constraint 11 1068 0.8000 1.0000 2.0000 0.0000 Constraint 11 997 0.8000 1.0000 2.0000 0.0000 Constraint 11 968 0.8000 1.0000 2.0000 0.0000 Constraint 11 930 0.8000 1.0000 2.0000 0.0000 Constraint 11 913 0.8000 1.0000 2.0000 0.0000 Constraint 11 899 0.8000 1.0000 2.0000 0.0000 Constraint 11 859 0.8000 1.0000 2.0000 0.0000 Constraint 11 848 0.8000 1.0000 2.0000 0.0000 Constraint 11 836 0.8000 1.0000 2.0000 0.0000 Constraint 11 829 0.8000 1.0000 2.0000 0.0000 Constraint 11 818 0.8000 1.0000 2.0000 0.0000 Constraint 11 808 0.8000 1.0000 2.0000 0.0000 Constraint 11 800 0.8000 1.0000 2.0000 0.0000 Constraint 11 792 0.8000 1.0000 2.0000 0.0000 Constraint 11 778 0.8000 1.0000 2.0000 0.0000 Constraint 11 769 0.8000 1.0000 2.0000 0.0000 Constraint 11 761 0.8000 1.0000 2.0000 0.0000 Constraint 11 756 0.8000 1.0000 2.0000 0.0000 Constraint 11 748 0.8000 1.0000 2.0000 0.0000 Constraint 11 731 0.8000 1.0000 2.0000 0.0000 Constraint 11 713 0.8000 1.0000 2.0000 0.0000 Constraint 11 706 0.8000 1.0000 2.0000 0.0000 Constraint 11 690 0.8000 1.0000 2.0000 0.0000 Constraint 11 673 0.8000 1.0000 2.0000 0.0000 Constraint 11 665 0.8000 1.0000 2.0000 0.0000 Constraint 11 657 0.8000 1.0000 2.0000 0.0000 Constraint 11 650 0.8000 1.0000 2.0000 0.0000 Constraint 11 639 0.8000 1.0000 2.0000 0.0000 Constraint 11 630 0.8000 1.0000 2.0000 0.0000 Constraint 11 623 0.8000 1.0000 2.0000 0.0000 Constraint 11 616 0.8000 1.0000 2.0000 0.0000 Constraint 11 608 0.8000 1.0000 2.0000 0.0000 Constraint 11 597 0.8000 1.0000 2.0000 0.0000 Constraint 11 589 0.8000 1.0000 2.0000 0.0000 Constraint 11 579 0.8000 1.0000 2.0000 0.0000 Constraint 11 572 0.8000 1.0000 2.0000 0.0000 Constraint 11 564 0.8000 1.0000 2.0000 0.0000 Constraint 11 557 0.8000 1.0000 2.0000 0.0000 Constraint 11 549 0.8000 1.0000 2.0000 0.0000 Constraint 11 538 0.8000 1.0000 2.0000 0.0000 Constraint 11 530 0.8000 1.0000 2.0000 0.0000 Constraint 11 521 0.8000 1.0000 2.0000 0.0000 Constraint 11 510 0.8000 1.0000 2.0000 0.0000 Constraint 11 501 0.8000 1.0000 2.0000 0.0000 Constraint 11 493 0.8000 1.0000 2.0000 0.0000 Constraint 11 487 0.8000 1.0000 2.0000 0.0000 Constraint 11 479 0.8000 1.0000 2.0000 0.0000 Constraint 11 466 0.8000 1.0000 2.0000 0.0000 Constraint 11 457 0.8000 1.0000 2.0000 0.0000 Constraint 11 448 0.8000 1.0000 2.0000 0.0000 Constraint 11 443 0.8000 1.0000 2.0000 0.0000 Constraint 11 435 0.8000 1.0000 2.0000 0.0000 Constraint 11 429 0.8000 1.0000 2.0000 0.0000 Constraint 11 421 0.8000 1.0000 2.0000 0.0000 Constraint 11 412 0.8000 1.0000 2.0000 0.0000 Constraint 11 403 0.8000 1.0000 2.0000 0.0000 Constraint 11 392 0.8000 1.0000 2.0000 0.0000 Constraint 11 375 0.8000 1.0000 2.0000 0.0000 Constraint 11 368 0.8000 1.0000 2.0000 0.0000 Constraint 11 347 0.8000 1.0000 2.0000 0.0000 Constraint 11 333 0.8000 1.0000 2.0000 0.0000 Constraint 11 325 0.8000 1.0000 2.0000 0.0000 Constraint 11 314 0.8000 1.0000 2.0000 0.0000 Constraint 11 306 0.8000 1.0000 2.0000 0.0000 Constraint 11 294 0.8000 1.0000 2.0000 0.0000 Constraint 11 285 0.8000 1.0000 2.0000 0.0000 Constraint 11 274 0.8000 1.0000 2.0000 0.0000 Constraint 11 263 0.8000 1.0000 2.0000 0.0000 Constraint 11 256 0.8000 1.0000 2.0000 0.0000 Constraint 11 249 0.8000 1.0000 2.0000 0.0000 Constraint 11 233 0.8000 1.0000 2.0000 0.0000 Constraint 11 216 0.8000 1.0000 2.0000 0.0000 Constraint 11 208 0.8000 1.0000 2.0000 0.0000 Constraint 11 189 0.8000 1.0000 2.0000 0.0000 Constraint 11 180 0.8000 1.0000 2.0000 0.0000 Constraint 11 121 0.8000 1.0000 2.0000 0.0000 Constraint 11 112 0.8000 1.0000 2.0000 0.0000 Constraint 11 104 0.8000 1.0000 2.0000 0.0000 Constraint 11 66 0.8000 1.0000 2.0000 0.0000 Constraint 11 59 0.8000 1.0000 2.0000 0.0000 Constraint 11 47 0.8000 1.0000 2.0000 0.0000 Constraint 11 39 0.8000 1.0000 2.0000 0.0000 Constraint 11 33 0.8000 1.0000 2.0000 0.0000 Constraint 11 25 0.8000 1.0000 2.0000 0.0000 Constraint 11 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 1788 0.8000 1.0000 2.0000 0.0000 Constraint 3 1777 0.8000 1.0000 2.0000 0.0000 Constraint 3 1772 0.8000 1.0000 2.0000 0.0000 Constraint 3 1748 0.8000 1.0000 2.0000 0.0000 Constraint 3 1739 0.8000 1.0000 2.0000 0.0000 Constraint 3 1731 0.8000 1.0000 2.0000 0.0000 Constraint 3 1720 0.8000 1.0000 2.0000 0.0000 Constraint 3 1714 0.8000 1.0000 2.0000 0.0000 Constraint 3 1703 0.8000 1.0000 2.0000 0.0000 Constraint 3 1692 0.8000 1.0000 2.0000 0.0000 Constraint 3 1670 0.8000 1.0000 2.0000 0.0000 Constraint 3 1662 0.8000 1.0000 2.0000 0.0000 Constraint 3 1649 0.8000 1.0000 2.0000 0.0000 Constraint 3 1620 0.8000 1.0000 2.0000 0.0000 Constraint 3 1611 0.8000 1.0000 2.0000 0.0000 Constraint 3 1603 0.8000 1.0000 2.0000 0.0000 Constraint 3 1596 0.8000 1.0000 2.0000 0.0000 Constraint 3 1587 0.8000 1.0000 2.0000 0.0000 Constraint 3 1575 0.8000 1.0000 2.0000 0.0000 Constraint 3 1567 0.8000 1.0000 2.0000 0.0000 Constraint 3 1556 0.8000 1.0000 2.0000 0.0000 Constraint 3 1548 0.8000 1.0000 2.0000 0.0000 Constraint 3 1541 0.8000 1.0000 2.0000 0.0000 Constraint 3 1533 0.8000 1.0000 2.0000 0.0000 Constraint 3 1519 0.8000 1.0000 2.0000 0.0000 Constraint 3 1511 0.8000 1.0000 2.0000 0.0000 Constraint 3 1494 0.8000 1.0000 2.0000 0.0000 Constraint 3 1466 0.8000 1.0000 2.0000 0.0000 Constraint 3 1438 0.8000 1.0000 2.0000 0.0000 Constraint 3 1427 0.8000 1.0000 2.0000 0.0000 Constraint 3 1416 0.8000 1.0000 2.0000 0.0000 Constraint 3 1408 0.8000 1.0000 2.0000 0.0000 Constraint 3 1399 0.8000 1.0000 2.0000 0.0000 Constraint 3 1391 0.8000 1.0000 2.0000 0.0000 Constraint 3 1382 0.8000 1.0000 2.0000 0.0000 Constraint 3 1374 0.8000 1.0000 2.0000 0.0000 Constraint 3 1366 0.8000 1.0000 2.0000 0.0000 Constraint 3 1358 0.8000 1.0000 2.0000 0.0000 Constraint 3 1351 0.8000 1.0000 2.0000 0.0000 Constraint 3 1343 0.8000 1.0000 2.0000 0.0000 Constraint 3 1334 0.8000 1.0000 2.0000 0.0000 Constraint 3 1325 0.8000 1.0000 2.0000 0.0000 Constraint 3 1317 0.8000 1.0000 2.0000 0.0000 Constraint 3 1309 0.8000 1.0000 2.0000 0.0000 Constraint 3 1293 0.8000 1.0000 2.0000 0.0000 Constraint 3 1284 0.8000 1.0000 2.0000 0.0000 Constraint 3 1276 0.8000 1.0000 2.0000 0.0000 Constraint 3 1260 0.8000 1.0000 2.0000 0.0000 Constraint 3 1251 0.8000 1.0000 2.0000 0.0000 Constraint 3 1228 0.8000 1.0000 2.0000 0.0000 Constraint 3 1220 0.8000 1.0000 2.0000 0.0000 Constraint 3 1204 0.8000 1.0000 2.0000 0.0000 Constraint 3 1193 0.8000 1.0000 2.0000 0.0000 Constraint 3 1178 0.8000 1.0000 2.0000 0.0000 Constraint 3 1167 0.8000 1.0000 2.0000 0.0000 Constraint 3 1158 0.8000 1.0000 2.0000 0.0000 Constraint 3 1149 0.8000 1.0000 2.0000 0.0000 Constraint 3 1133 0.8000 1.0000 2.0000 0.0000 Constraint 3 1125 0.8000 1.0000 2.0000 0.0000 Constraint 3 1077 0.8000 1.0000 2.0000 0.0000 Constraint 3 1068 0.8000 1.0000 2.0000 0.0000 Constraint 3 1059 0.8000 1.0000 2.0000 0.0000 Constraint 3 1008 0.8000 1.0000 2.0000 0.0000 Constraint 3 997 0.8000 1.0000 2.0000 0.0000 Constraint 3 968 0.8000 1.0000 2.0000 0.0000 Constraint 3 963 0.8000 1.0000 2.0000 0.0000 Constraint 3 913 0.8000 1.0000 2.0000 0.0000 Constraint 3 908 0.8000 1.0000 2.0000 0.0000 Constraint 3 899 0.8000 1.0000 2.0000 0.0000 Constraint 3 836 0.8000 1.0000 2.0000 0.0000 Constraint 3 829 0.8000 1.0000 2.0000 0.0000 Constraint 3 818 0.8000 1.0000 2.0000 0.0000 Constraint 3 808 0.8000 1.0000 2.0000 0.0000 Constraint 3 800 0.8000 1.0000 2.0000 0.0000 Constraint 3 792 0.8000 1.0000 2.0000 0.0000 Constraint 3 769 0.8000 1.0000 2.0000 0.0000 Constraint 3 761 0.8000 1.0000 2.0000 0.0000 Constraint 3 756 0.8000 1.0000 2.0000 0.0000 Constraint 3 748 0.8000 1.0000 2.0000 0.0000 Constraint 3 690 0.8000 1.0000 2.0000 0.0000 Constraint 3 681 0.8000 1.0000 2.0000 0.0000 Constraint 3 673 0.8000 1.0000 2.0000 0.0000 Constraint 3 665 0.8000 1.0000 2.0000 0.0000 Constraint 3 657 0.8000 1.0000 2.0000 0.0000 Constraint 3 650 0.8000 1.0000 2.0000 0.0000 Constraint 3 639 0.8000 1.0000 2.0000 0.0000 Constraint 3 630 0.8000 1.0000 2.0000 0.0000 Constraint 3 623 0.8000 1.0000 2.0000 0.0000 Constraint 3 608 0.8000 1.0000 2.0000 0.0000 Constraint 3 597 0.8000 1.0000 2.0000 0.0000 Constraint 3 589 0.8000 1.0000 2.0000 0.0000 Constraint 3 579 0.8000 1.0000 2.0000 0.0000 Constraint 3 572 0.8000 1.0000 2.0000 0.0000 Constraint 3 564 0.8000 1.0000 2.0000 0.0000 Constraint 3 557 0.8000 1.0000 2.0000 0.0000 Constraint 3 549 0.8000 1.0000 2.0000 0.0000 Constraint 3 538 0.8000 1.0000 2.0000 0.0000 Constraint 3 521 0.8000 1.0000 2.0000 0.0000 Constraint 3 510 0.8000 1.0000 2.0000 0.0000 Constraint 3 501 0.8000 1.0000 2.0000 0.0000 Constraint 3 493 0.8000 1.0000 2.0000 0.0000 Constraint 3 487 0.8000 1.0000 2.0000 0.0000 Constraint 3 479 0.8000 1.0000 2.0000 0.0000 Constraint 3 457 0.8000 1.0000 2.0000 0.0000 Constraint 3 448 0.8000 1.0000 2.0000 0.0000 Constraint 3 443 0.8000 1.0000 2.0000 0.0000 Constraint 3 435 0.8000 1.0000 2.0000 0.0000 Constraint 3 429 0.8000 1.0000 2.0000 0.0000 Constraint 3 421 0.8000 1.0000 2.0000 0.0000 Constraint 3 412 0.8000 1.0000 2.0000 0.0000 Constraint 3 403 0.8000 1.0000 2.0000 0.0000 Constraint 3 392 0.8000 1.0000 2.0000 0.0000 Constraint 3 368 0.8000 1.0000 2.0000 0.0000 Constraint 3 347 0.8000 1.0000 2.0000 0.0000 Constraint 3 333 0.8000 1.0000 2.0000 0.0000 Constraint 3 314 0.8000 1.0000 2.0000 0.0000 Constraint 3 306 0.8000 1.0000 2.0000 0.0000 Constraint 3 294 0.8000 1.0000 2.0000 0.0000 Constraint 3 285 0.8000 1.0000 2.0000 0.0000 Constraint 3 249 0.8000 1.0000 2.0000 0.0000 Constraint 3 227 0.8000 1.0000 2.0000 0.0000 Constraint 3 216 0.8000 1.0000 2.0000 0.0000 Constraint 3 59 0.8000 1.0000 2.0000 0.0000 Constraint 3 47 0.8000 1.0000 2.0000 0.0000 Constraint 3 39 0.8000 1.0000 2.0000 0.0000 Constraint 3 33 0.8000 1.0000 2.0000 0.0000 Constraint 3 25 0.8000 1.0000 2.0000 0.0000 Constraint 3 18 0.8000 1.0000 2.0000 0.0000 Constraint 3 11 0.8000 1.0000 2.0000 0.0000 Done printing distance constraints # command: