# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:# Making conformation for sequence T0359 numbered 1 through 97 Created new target T0359 from T0359.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0359/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0359//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0359/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vj6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1vj6A/merged-good-all-a2m.gz for input Trying 1vj6A/merged-good-all-a2m Error: Couldn't open file 1vj6A/merged-good-all-a2m or 1vj6A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0359 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS # choosing archetypes in rotamer library T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 2 number of extra gaps= 0 total=2 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGSPH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1982 :GDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=4 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fneA)M1954 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2fneA 1980 :PHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDETS Number of specific fragments extracted= 2 number of extra gaps= 0 total=6 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)K29 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)L30 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)E31 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :E 1y8tA 302 :G Number of specific fragments extracted= 8 number of extra gaps= 5 total=14 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)P32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ETS 1y8tA 302 :GGS Number of specific fragments extracted= 8 number of extra gaps= 5 total=22 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0359)G23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0359)Y24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0359)I25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0359)G26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0359)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0359)A45 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0359)H48 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0359)G50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0359)I52 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0359)G63 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0359)T64 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0359)N65 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0359)R91 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0359)R92 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0359)G93 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0359 16 :GLGITIA 1y8tA 230 :SLGVQVT T0359 34 :GIFVKSITKS 1y8tA 243 :GAKIVEVVAG T0359 46 :VE 1y8tA 255 :AA T0359 53 :QIGDQIIAVD 1y8tA 261 :PKGVVVTKVD T0359 66 :LQG 1y8tA 274 :INS T0359 71 :NQQAVEVLRHT 1y8tA 277 :ADALVAAVRSK T0359 82 :GQTVLLTLM 1y8tA 290 :GATVALTFQ T0359 94 :ET 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=30 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNVQ 1qauA 15 :VISVRLFKRKV T0359 16 :GLGITIAGY 1qauA 27 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 36 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qauA 90 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=34 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELTKNV 1qauA 15 :VISVRLFKRK T0359 15 :QGLGITIAGYIG 1qauA 26 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qauA 38 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1qauA 90 :ETHVVLILRGPEGFT Number of specific fragments extracted= 4 number of extra gaps= 0 total=38 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0359)E4 because first residue in template chain is (1qauA)N14 T0359 5 :TFDVELT 1qauA 15 :VISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qauA 23 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1qauA 39 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0359 84 :TVLLTLMRRGET 1qauA 92 :HVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=42 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h2bA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h2bA expands to /projects/compbio/data/pdb/2h2b.pdb.gz 2h2bA:# T0359 read from 2h2bA/merged-good-all-a2m # 2h2bA read from 2h2bA/merged-good-all-a2m # adding 2h2bA to template set # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIG 2h2bA 33 :GFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKG T0359 96 :SV 2h2bA 116 :RT Number of specific fragments extracted= 5 number of extra gaps= 0 total=47 Number of alignments=10 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTKNVQ 2h2bA 18 :IWEQHTVTLHRAPG T0359 16 :GLGITIAGYIGD 2h2bA 33 :GFGIAISGGRDN T0359 28 :KKLEPSGIFVKSITKSSAVE 2h2bA 47 :FQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGG Number of specific fragments extracted= 4 number of extra gaps= 0 total=51 Number of alignments=11 # 2h2bA read from 2h2bA/merged-good-all-a2m # found chain 2h2bA in template set T0359 2 :MSETFDVELTK 2h2bA 18 :IWEQHTVTLHR T0359 13 :NVQGLGITIAGYIG 2h2bA 30 :PGFGFGIAISGGRD T0359 27 :DKKLEPSGIFVKSITKSSAVE 2h2bA 46 :HFQSGETSIVISDVLKGGPAE T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2h2bA 67 :GQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKGGGW Number of specific fragments extracted= 4 number of extra gaps= 0 total=55 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0359 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0359 5 :TFDVELTKNVQGLGITIAGYIGDK 1i16 30 :VCTVTLEKMSAGLGFSLEGGKGSL T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 54 :HGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGE 1i16 107 :DGPVTIVIRRKSL T0359 96 :S 1i16 122 :K Number of specific fragments extracted= 4 number of extra gaps= 0 total=59 Number of alignments=13 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 4 :ETFDVELTKNVQGLGITIAGYIGDKK 1i16 29 :TVCTVTLEKMSAGLGFSLEGGKGSLH T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i16 55 :GDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0359 82 :GQTVLLTLMRRGETS 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 3 number of extra gaps= 0 total=62 Number of alignments=14 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKGS T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1i16 53 :LHGDKPLTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0359 83 :QTVLLTLMRRGETSV 1i16 108 :GPVTIVIRRKSLQSK Number of specific fragments extracted= 3 number of extra gaps= 0 total=65 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0359 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0359 2 :MSETFDVELTKN 1v5lA 3 :SGSSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET T0359 95 :TS 1v5lA 94 :PQ Number of specific fragments extracted= 5 number of extra gaps= 0 total=70 Number of alignments=16 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 4 :ETFDVELTKN 1v5lA 5 :SSGNVVLPGP T0359 15 :QGLGITIAGYIGD 1v5lA 15 :APWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 4 number of extra gaps= 0 total=74 Number of alignments=17 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0359 12 :KNVQGLGITIAGYIGD 1v5lA 12 :PGPAPWGFRLSGGIDF T0359 32 :PSGIFVKSITKSSAVEHDG 1v5lA 28 :NQPLVITRITPGSKAAAAN T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1v5lA 47 :LCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 3 number of extra gaps= 0 total=77 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0359 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGY 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 331 :EDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=80 Number of alignments=19 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=83 Number of alignments=20 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVL 1tp5A 334 :EGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0359 89 :LMRR 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=86 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0359 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHG T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1i92A 31 :EKGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGE 1i92A 85 :AVRLLVVDPEQ T0359 95 :TS 1i92A 97 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=91 Number of alignments=22 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1i92A 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETS 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 4 number of extra gaps= 1 total=95 Number of alignments=23 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0359)G82 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0359)Q83 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1i92A 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1i92A 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAA T0359 84 :TVLLTLMRRGETSV 1i92A 85 :AVRLLVVDPEQDTR Number of specific fragments extracted= 4 number of extra gaps= 1 total=99 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0359 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=101 Number of alignments=25 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=103 Number of alignments=26 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1bfeA 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=105 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGY 1fc6A 162 :GVGLEITYD T0359 29 :KLEPSGIFVKSITKSSAVEHDG 1fc6A 171 :GGSGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=110 Number of alignments=28 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 13 :NVQ 1fc6A 157 :AGS T0359 16 :GLGITIAGYIG 1fc6A 162 :GVGLEITYDGG T0359 31 :EPSGIFVKSITKSSAVEHDG 1fc6A 173 :SGKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 81 :TGQTVLLTLMRRG 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 5 number of extra gaps= 0 total=115 Number of alignments=29 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0359 12 :KNVQGLGITIAGYIGD 1fc6A 158 :GSVTGVGLEITYDGGS T0359 32 :PSGIFVKSITKSSAVEHDG 1fc6A 174 :GKDVVVLTPAPGGPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVL 1fc6A 193 :ARAGDVIVTVDGTAVKGMSLYDVSDLL T0359 79 :RHTGQTVLLTLMR 1fc6A 221 :GEADSQVEVVLHA Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gm1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1gm1A/merged-good-all-a2m.gz for input Trying 1gm1A/merged-good-all-a2m Error: Couldn't open file 1gm1A/merged-good-all-a2m or 1gm1A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0359 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNVQ 1nf3C 152 :PETHRRVRLCKYGT T0359 16 :GLGITIAGYIG 1nf3C 168 :PLGFYIRDGSS T0359 27 :DKKLEP 1nf3C 183 :PHGLEK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 190 :PGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 4 number of extra gaps= 0 total=123 Number of alignments=31 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 2 :MSETFDVELTKNV 1nf3C 152 :PETHRRVRLCKYG T0359 15 :QGLGITIAGYI 1nf3C 167 :KPLGFYIRDGS T0359 26 :GDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 183 :PHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=126 Number of alignments=32 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1nf3C)N253 T0359 4 :ETFDVELT 1nf3C 154 :THRRVRLC T0359 12 :KNVQGLGITIAGYIG 1nf3C 164 :GTEKPLGFYIRDGSS T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1nf3C 184 :HGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQR Number of specific fragments extracted= 3 number of extra gaps= 0 total=129 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0359 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA T0359 97 :V 1wf7A 94 :E Number of specific fragments extracted= 5 number of extra gaps= 0 total=134 Number of alignments=34 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 2 :MSETFDVELT 1wf7A 3 :SGSSGSVSLV T0359 13 :NVQGLGITIAGYIGD 1wf7A 13 :GPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETS 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAA Number of specific fragments extracted= 4 number of extra gaps= 0 total=138 Number of alignments=35 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1wf7A 3 :SGSSGSVSLVGPAPWGFRLQGGKDF T0359 32 :PSGIFVKSITKSSAVEHDG 1wf7A 28 :NMPLTISSLKDGGKASQAH T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1wf7A 47 :VRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAK Number of specific fragments extracted= 3 number of extra gaps= 0 total=141 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIG 2f0aA 264 :FLGISIVGQSN T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=145 Number of alignments=37 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVELT 2f0aA 252 :IITVTLN T0359 16 :GLGITIAGYIGDK 2f0aA 264 :FLGISIVGQSNER T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 277 :GDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=149 Number of alignments=38 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0359)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0359)G93 because last residue in template chain is (2f0aA)E342 T0359 5 :TFDVEL 2f0aA 252 :IITVTL T0359 16 :GLGITIAGYIGD 2f0aA 264 :FLGISIVGQSNE T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 2f0aA 276 :RGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNDINFENMSNDDAVRVLRDI T0359 82 :GQTVLLTLMRR 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=153 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0359 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGY 1n7eA 668 :AIIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1n7eA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTD T0359 96 :SV 1n7eA 758 :PA Number of specific fragments extracted= 3 number of extra gaps= 0 total=156 Number of alignments=40 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=158 Number of alignments=41 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1n7eA)G667 T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1n7eA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQP Number of specific fragments extracted= 2 number of extra gaps= 0 total=160 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0359 32 :PSGIFVKSITKSSAVEHDG 1ky9A 285 :QRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK T0359 95 :TS 1ky9A 350 :VN Number of specific fragments extracted= 5 number of extra gaps= 0 total=165 Number of alignments=43 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 26 :G 1ky9A 283 :D T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9A 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRGE 1ky9A 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=170 Number of alignments=44 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQGF 1ky9A 304 :IKAGDVITSLNGKPISSF T0359 72 :QQAVEVLRHT 1ky9A 322 :AALRAQVGTM T0359 82 :GQTVLLTLMRRG 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=174 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0359 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 30 :LEPS 1ky9B 282 :VDAQ T0359 34 :GIFVKSITKSSAVEHDG 1ky9B 287 :GAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGE 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 5 number of extra gaps= 0 total=179 Number of alignments=46 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)K281 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)K281 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 18 :G 1ky9B 266 :G T0359 24 :YI 1ky9B 270 :TE T0359 30 :L 1ky9B 282 :V T0359 31 :EPSGIFVKSITKSSAVEHDG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 82 :GQTVLLTLMRRGET 1ky9B 334 :GSKLTLGLLRDGKQ Number of specific fragments extracted= 7 number of extra gaps= 0 total=186 Number of alignments=47 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0359)I21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0359)H80 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0359 19 :IT 1ky9B 265 :LG T0359 24 :YIGDKK 1ky9B 270 :TELNSE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAG T0359 52 :IQIGDQIIAVDGTNLQG 1ky9B 304 :IKAGDVITSLNGKPISS T0359 71 :NQQAVEVLR 1ky9B 321 :FAALRAQVG T0359 81 :TGQTVLLTLMRRG 1ky9B 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 6 number of extra gaps= 0 total=192 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 5 :TFDVELTKNV 1mfgA 1280 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 1mfgA 1290 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1327 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=198 Number of alignments=49 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNV 1mfgA 1278 :SMEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 1mfgA 1290 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 1mfgA 1309 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1326 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=204 Number of alignments=50 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0359)Q83 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0359)T84 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0359)L87 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0359)T88 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0359)T95 because last residue in template chain is (1mfgA)S1371 T0359 3 :SETFDVELTKNVQ 1mfgA 1278 :SMEIRVRVEKDPE T0359 17 :LGITIAGYIG 1mfgA 1291 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 1mfgA 1305 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTG 1mfgA 1325 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0359 85 :VL 1mfgA 1361 :VE T0359 89 :LMRRGE 1mfgA 1365 :IVREVS Number of specific fragments extracted= 6 number of extra gaps= 2 total=210 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0359 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0359 4 :ETFDVELTKNV 1b8qA 8 :NVISVRLFKRK T0359 15 :QGLGITIAGYI 1b8qA 20 :GGLGFLVKERV T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 31 :SKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1b8qA 84 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=214 Number of alignments=52 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 1 :SMSET 1b8qA 1 :GSHMI T0359 6 :FDVELTK 1b8qA 10 :ISVRLFK T0359 13 :NVQGLGITIAGYIG 1b8qA 18 :KVGGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1b8qA 32 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGETS 1b8qA 84 :ETHVVLILRGPEGFT Number of specific fragments extracted= 5 number of extra gaps= 0 total=219 Number of alignments=53 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0359 2 :MSETFDVELTK 1b8qA 6 :EPNVISVRLFK T0359 13 :NVQGLGITIAGYIGD 1b8qA 18 :KVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1b8qA 33 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=222 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0359 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=228 Number of alignments=55 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 1 :SM 1nteA 192 :GA T0359 5 :TFDVELTKNVQG 1nteA 196 :PRTITMHKDSTG T0359 17 :LGITIA 1nteA 209 :VGFIFK T0359 32 :PS 1nteA 215 :NG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 6 number of extra gaps= 1 total=234 Number of alignments=56 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0359)S3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0359)E4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0359 5 :TFDVELT 1nteA 196 :PRTITMH T0359 12 :KNVQGLGITIAGY 1nteA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1nteA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1nteA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=238 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0359 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0359)E94 because last residue in template chain is (2fe5A)S314 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=240 Number of alignments=58 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0359)M2 because first residue in template chain is (2fe5A)S221 T0359 3 :SETFDVELTKNVQGLGITIAGYIGDKKL 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIGNQHI T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 251 :GDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=242 Number of alignments=59 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0359 27 :DKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2fe5A 247 :QHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 2 number of extra gaps= 0 total=244 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQ 1r6jA 192 :GAMDPRTITMHKDST T0359 16 :GLGITIAGY 1r6jA 208 :HVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=61 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 1 :SMSETFDVELTKNVQG 1r6jA 192 :GAMDPRTITMHKDSTG T0359 17 :LGITIAGY 1r6jA 209 :VGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=62 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0359 3 :SETFDVELT 1r6jA 194 :MDPRTITMH T0359 12 :KNVQGLGITIAGY 1r6jA 204 :DSTGHVGFIFKNG T0359 36 :FVKSITKSSAVEHDG 1r6jA 217 :KITSIVKDSSAARNG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1r6jA 232 :LLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0359 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0359 2 :MSETFDVELTKNVQ 1qavA 76 :SLQRRRVTVRKADA T0359 16 :GLGITIAGY 1qavA 91 :GLGISIKGG T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 100 :RENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=259 Number of alignments=64 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 1 :SMSETFDVELTKNVQG 1qavA 75 :GSLQRRRVTVRKADAG T0359 17 :LGITIAGYIG 1qavA 92 :LGISIKGGRE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 102 :NKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=262 Number of alignments=65 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0359 2 :MSETFDVELT 1qavA 76 :SLQRRRVTVR T0359 12 :KNVQGLGITIAGYIGD 1qavA 87 :ADAGGLGISIKGGREN T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1qavA 103 :KMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 3 number of extra gaps= 0 total=265 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0359 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNVQ 1qavB 1013 :PNVISVRLFKRKV T0359 16 :GLGITIAGY 1qavB 1027 :GLGFLVKER T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1036 :VSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGE 1qavB 1090 :ETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=269 Number of alignments=67 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0359)M2 because first residue in template chain is (1qavB)Q1012 T0359 3 :SETFDVELTKNV 1qavB 1013 :PNVISVRLFKRK T0359 15 :QGLGITIAGYIG 1qavB 1026 :GGLGFLVKERVS T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1qavB 1038 :KPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGI T0359 82 :GQTVLLTLMRRGET 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=273 Number of alignments=68 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0359 3 :SETFDVELT 1qavB 1013 :PNVISVRLF T0359 12 :KNVQGLGITIAGYIGD 1qavB 1023 :RKVGGLGFLVKERVSK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQT 1qavB 1039 :PPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASE T0359 85 :VLLTLMRRGE 1qavB 1093 :VVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=277 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0359 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set T0359 1 :SMSE 1m5zA 16 :SPTP T0359 5 :TFDVELTKNVQ 1m5zA 22 :LHKVTLYKDSG T0359 16 :GLGITIAGY 1m5zA 35 :DFGFSVADG T0359 30 :LEPSGIFVKSITKSSAVEHDG 1m5zA 44 :LLEKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=282 Number of alignments=70 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 1 :SMS 1m5zA 16 :SPT T0359 4 :ETFDVELTKNVQ 1m5zA 21 :ELHKVTLYKDSG T0359 16 :GLGITIAGYIG 1m5zA 35 :DFGFSVADGLL T0359 32 :PSGIFVKSITKSSAVEHDG 1m5zA 46 :EKGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=287 Number of alignments=71 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0359 2 :MSETFDVELTKNV 1m5zA 19 :PVELHKVTLYKDS T0359 15 :QGLGITIAGYIGD 1m5zA 34 :EDFGFSVADGLLE T0359 33 :SGIFVKSITKSSAVEHDG 1m5zA 47 :KGVYVKNIRPAGPGDLGG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1m5zA 65 :LKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=291 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0359 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYI 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 332 :DGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=293 Number of alignments=73 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=295 Number of alignments=74 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1be9A 333 :GEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=297 Number of alignments=75 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1d5gA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1d5gA/merged-good-all-a2m.gz for input Trying 1d5gA/merged-good-all-a2m Error: Couldn't open file 1d5gA/merged-good-all-a2m or 1d5gA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0359 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 18 :GITIAGYI 1te0A 260 :GIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 33 :SGIFV 1te0A 280 :QGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=306 Number of alignments=76 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L269 Warning: unaligning (T0359)D27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L269 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)E31 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 17 :LGITIAGYI 1te0A 259 :IGIGGREIA T0359 28 :KK 1te0A 270 :HA T0359 34 :GIFV 1te0A 281 :GIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 9 number of extra gaps= 7 total=315 Number of alignments=77 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0359)I25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0359)G26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0359)D27 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0359)K28 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0359)K29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0359)L30 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0359)K38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0359)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0359)S43 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0359)S44 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0359)E47 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0359)H48 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0359)D49 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0359)G50 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0359)D56 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0359)Q57 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0359)L66 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0359)Q67 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0359 31 :EPSGIFV 1te0A 278 :QLQGIVV T0359 40 :ITK 1te0A 287 :VSP T0359 45 :AV 1te0A 292 :PA T0359 52 :IQIG 1te0A 298 :IQVN T0359 58 :IIAVDGTN 1te0A 304 :IISVDNKP T0359 70 :TNQQAVEVLRHT 1te0A 314 :SALETMDQVAEI T0359 82 :GQTVLLTLMRRGE 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=322 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2h3lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2h3lA expands to /projects/compbio/data/pdb/2h3l.pdb.gz 2h3lA:# T0359 read from 2h3lA/merged-good-all-a2m # 2h3lA read from 2h3lA/merged-good-all-a2m # adding 2h3lA to template set # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 5 :TFDVELTKNV 2h3lA 1321 :EIRVRVEKDP T0359 16 :GLGITIAGYIG 2h3lA 1331 :ELGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAVEH 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPASK T0359 51 :RIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1368 :LLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=326 Number of alignments=78 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set Warning: unaligning (T0359)E94 because of BadResidue code HAS_OXT+BAD_PEPTIDE in next template residue (2h3lA)S1412 T0359 4 :ETFDVELTKNV 2h3lA 1320 :QEIRVRVEKDP T0359 16 :GLGITIAGYIGDKKL 2h3lA 1331 :ELGFSISGGVGGRGN T0359 31 :EPSGIFVKSITKSSAVE 2h3lA 1350 :DDDGIFVTRVQPEGPAS T0359 50 :GRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 2h3lA 1367 :KLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREV Number of specific fragments extracted= 4 number of extra gaps= 1 total=330 Number of alignments=79 # 2h3lA read from 2h3lA/merged-good-all-a2m # found chain 2h3lA in template set T0359 2 :MSETFDVELTKNVQ 2h3lA 1318 :AKQEIRVRVEKDPE T0359 17 :LGITIAGYIG 2h3lA 1332 :LGFSISGGVG T0359 27 :DKKLEPSGIFVKSITKSSAV 2h3lA 1346 :PFRPDDDGIFVTRVQPEGPA T0359 49 :DGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 2h3lA 1366 :SKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=334 Number of alignments=80 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0359 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=337 Number of alignments=81 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)V14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 1 :SMSETFDVELTKN 2fcfA 1145 :QSMQPRRVELWRE T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 3 number of extra gaps= 1 total=340 Number of alignments=82 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0359)N13 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0359)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0359)I25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0359)G26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0359 2 :MSETFDVELT 2fcfA 1146 :SMQPRRVELW T0359 12 :K 2fcfA 1157 :E T0359 16 :GLGITIAGY 2fcfA 1161 :SLGISIVGG T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 2fcfA 1185 :IFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIISTRL Number of specific fragments extracted= 4 number of extra gaps= 1 total=344 Number of alignments=83 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0359 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0359 26 :GDKKLEP 1lcyA 247 :REPSFPD T0359 33 :SGIFVKSITKSSAVEHDG 1lcyA 256 :HGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=349 Number of alignments=84 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 16 :GLGITIAG 1lcyA 228 :YIGVMMLT T0359 24 :YIGDKKL 1lcyA 245 :QLREPSF T0359 31 :EPSGIFVKSITKSSAVEHDG 1lcyA 254 :VQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTGQ 1lcyA 291 :AEDVYEAVRTQSQ T0359 85 :VLLTLMRRGET 1lcyA 304 :LAVQIRRGRET Number of specific fragments extracted= 6 number of extra gaps= 0 total=355 Number of alignments=85 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0359 27 :DK 1lcyA 250 :SF T0359 30 :LEPSGIFVKSITKSSAVEHDG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAG T0359 52 :IQIGDQIIAVDGTNLQG 1lcyA 274 :LRPGDVILAIGEQMVQN T0359 71 :NQQAVEVLRHTG 1lcyA 291 :AEDVYEAVRTQS T0359 84 :TVLLTLMRRGE 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=360 Number of alignments=86 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQG 1sotA 298 :IQVNDLIISVDNKPAIS T0359 71 :NQQAVEVLRHT 1sotA 315 :ALETMDQVAEI T0359 82 :GQTVLL 1sotA 328 :GSVIPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=364 Number of alignments=87 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)L89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0359)T95 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHT 1sotA 314 :SALETMDQVAEI T0359 82 :GQTVLLT 1sotA 328 :GSVIPVV T0359 96 :S 1sotA 342 :L Number of specific fragments extracted= 5 number of extra gaps= 0 total=369 Number of alignments=88 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0359)G34 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0359)R91 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 T0359 35 :IFVKSITKSSAVEHDG 1sotA 282 :IVVNEVSPDGPAANAG T0359 52 :IQIGDQIIAVDGTNLQ 1sotA 298 :IQVNDLIISVDNKPAI T0359 70 :TNQQAVEVLRHTGQTVLLTLM 1sotA 314 :SALETMDQVAEIRPGSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=372 Number of alignments=89 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0359 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=376 Number of alignments=90 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIA 2f5yA 16 :YRQITIPRGKDGFGFTIC T0359 31 :EPSGIFVKSITKSSAVEHDG 2f5yA 34 :CDSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=380 Number of alignments=91 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0359)S3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0359)E4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0359)Q67 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0359)G68 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0359)G93 because last residue in template chain is (2f5yA)V95 T0359 5 :TFDVELTKNVQGLGITIAG 2f5yA 16 :YRQITIPRGKDGFGFTICC T0359 32 :PSGIFVKSITKSSAVEHDG 2f5yA 35 :DSPVRVQAVDSGGPAERAG T0359 52 :IQIGDQIIAVDGTNL 2f5yA 54 :LQQLDTVLQLNERPV T0359 69 :FTNQQAVEVLRHTGQTVLLTLMRR 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 4 number of extra gaps= 1 total=384 Number of alignments=92 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0359 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAG 1kwaA 500 :PMGITLKM T0359 26 :G 1kwaA 508 :N T0359 29 :KLEP 1kwaA 509 :ELNH T0359 35 :IFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 513 :CIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 5 number of extra gaps= 0 total=389 Number of alignments=93 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaA)R487 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELTKNVQ 1kwaA 488 :SRLVQFQKNTD T0359 16 :GLGITIAGY 1kwaA 500 :PMGITLKMN T0359 27 :D 1kwaA 509 :E T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 510 :LNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=393 Number of alignments=94 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaA)F574 T0359 5 :TFDVELT 1kwaA 488 :SRLVQFQ T0359 12 :KNVQGLGITIAGYIGD 1kwaA 496 :NTDEPMGITLKMNELN T0359 34 :GIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaA 512 :HCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 0 total=396 Number of alignments=95 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0359 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRG 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 3 number of extra gaps= 1 total=399 Number of alignments=96 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 Warning: unaligning (T0359)S96 because last residue in template chain is (1kwaB)F574 T0359 5 :TFDVELTKNVQ 1kwaB 488 :SRLVQFQKNTD T0359 16 :GLGITIA 1kwaB 500 :PMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGET 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYRE Number of specific fragments extracted= 3 number of extra gaps= 1 total=402 Number of alignments=97 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0359)G23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0359)P32 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0359 5 :TFDVELT 1kwaB 488 :SRLVQFQ T0359 12 :KNVQGLGITIA 1kwaB 496 :NTDEPMGITLK T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1kwaB 511 :NHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 3 number of extra gaps= 1 total=405 Number of alignments=98 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0359 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0359 1 :SMSETFDVELTKNVQGLGITIAGY 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGG T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 484 :EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=407 Number of alignments=99 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGED T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 486 :GEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=409 Number of alignments=100 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0359 2 :MSETFDVELTKNVQGLGITIAGYIGD 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDG T0359 33 :SGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRR 1pdr 487 :EGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=411 Number of alignments=101 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0359/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRR 1n99A 191 :RDR Number of specific fragments extracted= 6 number of extra gaps= 1 total=417 Number of alignments=102 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELTKNVQG 1n99A 113 :REVILCKDQDG T0359 17 :LGITIAGY 1n99A 125 :IGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHT 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQA T0359 82 :GQTVLL 1n99A 183 :GEKITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=423 Number of alignments=103 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0359)T5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0359 6 :FDVELT 1n99A 113 :REVILC T0359 12 :KNVQGLGITIAGY 1n99A 120 :DQDGKIGLRLKSI T0359 32 :PSGIFVKSITKSSAVEHDG 1n99A 133 :DNGIFVQLVQANSPASLVG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQ 1n99A 152 :LRFGDQVLQINGENCAGWSSDKAHKVLKQAFG T0359 84 :TVLL 1n99A 185 :KITM T0359 90 :MRRGE 1n99A 191 :RDRPF Number of specific fragments extracted= 6 number of extra gaps= 1 total=429 Number of alignments=104 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1g9oA)R9 T0359 3 :SETFDVELTKNVQGLGITIAGY 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGE T0359 30 :LEPSGIFVKSITKSSAVEHDG 1g9oA 32 :KGKLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPET T0359 95 :TSV 1g9oA 97 :EQL Number of specific fragments extracted= 4 number of extra gaps= 0 total=433 Number of alignments=105 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIG 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKG T0359 32 :PSGIFVKSITKSSAVEHDG 1g9oA 34 :KLGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=436 Number of alignments=106 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0359 3 :SETFDVELTKNVQGLGITIAGYIGD 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGK T0359 33 :SGIFVKSITKSSAVEHDG 1g9oA 35 :LGQYIRLVEPGSPAEKAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGETSV 1g9oA 53 :LLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=439 Number of alignments=107 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0359 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 29 :KLE 1l6oA 275 :ERG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=452 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LTK 1l6oA 257 :LNM T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :DK 1l6oA 275 :ER T0359 31 :E 1l6oA 277 :G T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 13 total=466 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0359)E4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0359)V8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0359)E9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0359)K12 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0359)N13 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0359)V14 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N263 Warning: unaligning (T0359)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0359)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0359)L17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0359)I19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0359)T20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0359)I25 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)N274 Warning: unaligning (T0359)G26 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0359)P32 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0359)S33 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0359)G34 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0359)V46 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0359)E47 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0359)D62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0359)G63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0359)N65 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0359)L66 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0359)G68 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0359)F69 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0359)T70 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0359)R79 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0359)H80 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0359)L87 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0359)T88 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0359)L89 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0359)M90 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0359)R92 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0359)G93 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0359)E94 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0359)T95 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 Warning: unaligning (T0359)S96 because last residue in template chain is (1l6oA)H345 T0359 5 :TFD 1l6oA 252 :IIT T0359 10 :LT 1l6oA 257 :LN T0359 18 :G 1l6oA 266 :G T0359 21 :IAGY 1l6oA 269 :IVGQ T0359 27 :D 1l6oA 275 :E T0359 30 :LE 1l6oA 276 :RG T0359 35 :IFVKSITKSSA 1l6oA 281 :IYIGSIMKGGA T0359 48 :HDGRIQIGDQIIAV 1l6oA 294 :ADGRIEPGDMLLQV T0359 64 :T 1l6oA 310 :I T0359 67 :Q 1l6oA 313 :E T0359 71 :NQQAVEVL 1l6oA 317 :NDDAVRVL T0359 81 :T 1l6oA 327 :I T0359 82 :GQTVL 1l6oA 331 :PGPIV T0359 91 :R 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=480 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQ 1q3oA 590 :KTVLLQKKDS T0359 16 :GLGITIAGYIGDKKLEPS 1q3oA 601 :GFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=484 Number of alignments=109 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 6 :FDVELTKNVQG 1q3oA 590 :KTVLLQKKDSE T0359 17 :LGITIAGYIGDKKLEPS 1q3oA 602 :FGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=488 Number of alignments=110 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set Warning: unaligning (T0359)T95 because last residue in template chain is (1q3oA)H687 T0359 5 :TFDVELT 1q3oA 589 :EKTVLLQ T0359 12 :KNVQGLGITIAGYIGDKKLEPS 1q3oA 597 :KDSEGFGFVLRGAKAQTPIEEF T0359 34 :GIFVKSITKSSAVEHDG 1q3oA 627 :LQYLESVDEGGVAWRAG T0359 52 :IQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMRRGE 1q3oA 644 :LRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMVTR Number of specific fragments extracted= 4 number of extra gaps= 0 total=492 Number of alignments=111 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGY 1n7fA 669 :IIYTVELKRYGGPLGITISGT T0359 29 :KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 690 :EEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=494 Number of alignments=112 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIG 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0359 31 :EPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 692 :PFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=496 Number of alignments=113 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0359)S3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0359)R92 because last residue in template chain is (1n7fA)Q753 T0359 4 :ETFDVELTKNVQGLGITIAGYIGD 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEP T0359 32 :PSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1n7fA 693 :FDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 2 number of extra gaps= 0 total=498 Number of alignments=114 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0359 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 4 :ETFDVELTKNV 1ihjA 14 :LIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=502 Number of alignments=115 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYI 1ihjA 26 :KSFGICIVRGE T0359 26 :G 1ihjA 39 :D T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=506 Number of alignments=116 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0359)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0359)D27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0359)K28 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0359)K29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0359)R92 because last residue in template chain is (1ihjA)F105 T0359 3 :SETFDVELTKNV 1ihjA 13 :ELIHMVTLDKTG T0359 15 :QGLGITIAGYIG 1ihjA 26 :KSFGICIVRGEV T0359 30 :LEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 1ihjA 43 :TKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 3 number of extra gaps= 1 total=509 Number of alignments=117 # command:Using radius: 15.0000 NUMB_ALIGNS: 117 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0003, weight 0.9987 evalue: 4 0.0003, weight 0.9987 evalue: 5 0.0003, weight 0.9987 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 1.0000 evalue: 10 0.0000, weight 1.0000 evalue: 11 0.0000, weight 1.0000 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0000, weight 1.0000 evalue: 40 0.0000, weight 1.0000 evalue: 41 0.0000, weight 1.0000 evalue: 42 0.1156, weight 0.4850 evalue: 43 0.1156, weight 0.4850 evalue: 44 0.1156, weight 0.4850 evalue: 45 0.0372, weight 0.8343 evalue: 46 0.0372, weight 0.8343 evalue: 47 0.0372, weight 0.8343 evalue: 48 0.0000, weight 1.0000 evalue: 49 0.0000, weight 1.0000 evalue: 50 0.0000, weight 1.0000 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 1.0000 evalue: 64 0.0000, weight 1.0000 evalue: 65 0.0000, weight 1.0000 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0000, weight 1.0000 evalue: 80 0.0000, weight 1.0000 evalue: 81 0.0000, weight 1.0000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.2020, weight 0.1000 evalue: 87 0.2020, weight 0.1000 evalue: 88 0.2020, weight 0.1000 evalue: 89 0.0000, weight 1.0000 evalue: 90 0.0000, weight 1.0000 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 1.0000 evalue: 95 0.0000, weight 0.9998 evalue: 96 0.0000, weight 0.9998 evalue: 97 0.0000, weight 0.9998 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 evalue: 111 0.0000, weight 1.0000 evalue: 112 0.0000, weight 1.0000 evalue: 113 0.0000, weight 1.0000 evalue: 114 0.0000, weight 1.0000 evalue: 115 0.0000, weight 1.0000 evalue: 116 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 22 RES2ATOM 4 31 RES2ATOM 5 38 RES2ATOM 6 49 RES2ATOM 7 57 RES2ATOM 8 64 RES2ATOM 9 73 RES2ATOM 10 81 RES2ATOM 11 88 RES2ATOM 12 97 RES2ATOM 13 105 RES2ATOM 14 112 RES2ATOM 16 125 RES2ATOM 18 137 RES2ATOM 19 145 RES2ATOM 20 152 RES2ATOM 21 160 RES2ATOM 23 169 RES2ATOM 24 181 RES2ATOM 26 193 RES2ATOM 27 201 RES2ATOM 28 210 RES2ATOM 29 219 RES2ATOM 30 227 RES2ATOM 31 236 RES2ATOM 32 243 RES2ATOM 34 253 RES2ATOM 35 261 RES2ATOM 36 272 RES2ATOM 37 279 RES2ATOM 38 288 RES2ATOM 39 294 RES2ATOM 40 302 RES2ATOM 41 309 RES2ATOM 42 318 RES2ATOM 43 324 RES2ATOM 44 330 RES2ATOM 45 335 RES2ATOM 46 342 RES2ATOM 47 351 RES2ATOM 48 361 RES2ATOM 50 373 RES2ATOM 51 384 RES2ATOM 52 392 RES2ATOM 53 401 RES2ATOM 55 413 RES2ATOM 56 421 RES2ATOM 57 430 RES2ATOM 58 438 RES2ATOM 59 446 RES2ATOM 60 451 RES2ATOM 61 458 RES2ATOM 63 470 RES2ATOM 64 477 RES2ATOM 65 485 RES2ATOM 66 493 RES2ATOM 68 506 RES2ATOM 69 517 RES2ATOM 70 524 RES2ATOM 71 532 RES2ATOM 72 541 RES2ATOM 73 550 RES2ATOM 74 555 RES2ATOM 75 562 RES2ATOM 76 571 RES2ATOM 77 578 RES2ATOM 78 586 RES2ATOM 79 597 RES2ATOM 80 607 RES2ATOM 82 618 RES2ATOM 83 627 RES2ATOM 84 634 RES2ATOM 85 641 RES2ATOM 86 649 RES2ATOM 87 657 RES2ATOM 88 664 RES2ATOM 89 672 RES2ATOM 90 680 RES2ATOM 91 691 RES2ATOM 93 706 RES2ATOM 94 715 RES2ATOM 95 722 RES2ATOM 96 728 Constraint 572 642 9.4425 11.8031 17.7046 112.2527 Constraint 452 642 5.9244 7.4055 11.1083 112.2527 Constraint 452 635 5.2909 6.6136 9.9204 112.2527 Constraint 452 579 5.1384 6.4230 9.6345 112.2527 Constraint 452 572 4.3261 5.4077 8.1115 112.2527 Constraint 452 563 8.2947 10.3684 15.5526 112.2527 Constraint 452 556 8.3487 10.4358 15.6537 112.2527 Constraint 452 551 5.8569 7.3211 10.9816 112.2527 Constraint 452 542 8.1195 10.1494 15.2240 112.2527 Constraint 447 642 6.4590 8.0738 12.1107 112.2527 Constraint 447 579 9.3635 11.7043 17.5565 112.2527 Constraint 447 572 7.8974 9.8717 14.8076 112.2527 Constraint 447 551 8.3459 10.4324 15.6487 112.2527 Constraint 447 542 10.1830 12.7288 19.0931 112.2527 Constraint 439 551 8.8025 11.0031 16.5047 112.2527 Constraint 431 579 7.2814 9.1018 13.6526 112.2527 Constraint 431 556 8.9284 11.1604 16.7407 112.2527 Constraint 431 551 5.8266 7.2833 10.9249 112.2527 Constraint 310 402 9.9559 12.4448 18.6672 112.2527 Constraint 303 402 8.9944 11.2430 16.8644 112.2527 Constraint 303 393 10.1883 12.7353 19.1030 112.2527 Constraint 295 431 9.9468 12.4335 18.6502 112.2527 Constraint 295 402 5.0837 6.3546 9.5319 112.2527 Constraint 295 393 5.6419 7.0524 10.5786 112.2527 Constraint 273 579 9.2594 11.5743 17.3614 112.2527 Constraint 273 556 10.2676 12.8345 19.2517 112.2527 Constraint 273 551 8.9823 11.2279 16.8418 112.2527 Constraint 273 452 9.7635 12.2044 18.3067 112.2527 Constraint 273 447 10.9777 13.7222 20.5833 112.2527 Constraint 273 439 9.2906 11.6133 17.4199 112.2527 Constraint 273 431 5.4223 6.7779 10.1668 112.2527 Constraint 273 402 4.4562 5.5703 8.3555 112.2527 Constraint 273 393 5.5406 6.9257 10.3886 112.2527 Constraint 262 551 8.4426 10.5532 15.8298 112.2527 Constraint 262 447 11.1860 13.9825 20.9738 112.2527 Constraint 262 439 8.6032 10.7540 16.1310 112.2527 Constraint 262 431 5.8462 7.3078 10.9617 112.2527 Constraint 262 402 6.5619 8.2024 12.3036 112.2527 Constraint 262 393 8.4628 10.5785 15.8677 112.2527 Constraint 447 635 8.5325 10.6656 15.9984 111.2527 Constraint 459 642 4.4287 5.5359 8.3039 111.2527 Constraint 459 635 5.0437 6.3046 9.4569 111.2527 Constraint 459 579 7.3694 9.2118 13.8177 111.2527 Constraint 459 572 6.0344 7.5430 11.3145 111.2527 Constraint 459 551 9.2880 11.6100 17.4150 111.2527 Constraint 551 635 9.5791 11.9738 17.9607 111.1527 Constraint 439 642 9.0850 11.3562 17.0343 111.1527 Constraint 439 635 10.8417 13.5521 20.3281 111.1527 Constraint 431 642 8.8443 11.0554 16.5831 111.1527 Constraint 431 635 8.4572 10.5715 15.8573 111.1527 Constraint 452 673 10.5967 13.2459 19.8688 111.0527 Constraint 447 673 7.9952 9.9941 14.9911 111.0527 Constraint 439 673 4.5149 5.6437 8.4655 111.0527 Constraint 431 673 6.6110 8.2638 12.3956 111.0527 Constraint 273 673 8.6109 10.7636 16.1454 111.0527 Constraint 262 673 7.8569 9.8211 14.7316 111.0527 Constraint 452 525 10.1660 12.7075 19.0613 110.7977 Constraint 431 525 8.6105 10.7631 16.1446 110.7977 Constraint 262 525 8.0927 10.1159 15.1738 110.7977 Constraint 262 452 10.8579 13.5724 20.3586 110.7977 Constraint 295 414 7.4355 9.2944 13.9417 110.2528 Constraint 289 431 10.7496 13.4370 20.1555 110.2528 Constraint 289 414 9.0537 11.3171 16.9757 110.2528 Constraint 289 402 5.0369 6.2961 9.4442 110.2528 Constraint 289 393 8.2704 10.3380 15.5069 110.2528 Constraint 280 431 8.9458 11.1823 16.7734 110.2528 Constraint 280 422 8.9927 11.2409 16.8614 110.2528 Constraint 280 414 7.8726 9.8407 14.7611 110.2528 Constraint 280 402 4.9961 6.2451 9.3677 110.2528 Constraint 280 393 8.6321 10.7901 16.1852 110.2528 Constraint 273 422 6.2187 7.7734 11.6601 110.2528 Constraint 273 414 3.7476 4.6845 7.0267 110.2528 Constraint 262 422 4.3214 5.4018 8.1027 110.2528 Constraint 262 414 5.5057 6.8822 10.3232 110.2528 Constraint 336 635 7.9282 9.9102 14.8653 110.2527 Constraint 393 673 9.0365 11.2956 16.9434 110.0527 Constraint 471 579 8.1809 10.2262 15.3393 109.2567 Constraint 471 572 4.9264 6.1580 9.2370 109.2567 Constraint 471 563 8.5898 10.7372 16.1058 109.2567 Constraint 471 556 10.2286 12.7858 19.1786 109.2567 Constraint 471 551 7.3920 9.2400 13.8600 109.2567 Constraint 471 542 7.4983 9.3729 14.0593 109.2567 Constraint 385 452 10.0580 12.5724 18.8587 109.2567 Constraint 331 635 7.1809 8.9762 13.4643 109.2567 Constraint 331 579 9.5664 11.9581 17.9371 109.2567 Constraint 310 385 9.8359 12.2949 18.4423 109.2567 Constraint 303 385 8.3181 10.3976 15.5964 109.2567 Constraint 295 385 4.6294 5.7868 8.6802 109.2567 Constraint 273 385 4.8767 6.0959 9.1438 109.2567 Constraint 262 385 8.9828 11.2285 16.8427 109.2567 Constraint 486 579 7.6049 9.5061 14.2592 109.2528 Constraint 486 572 5.9509 7.4386 11.1579 109.2528 Constraint 486 563 8.8063 11.0079 16.5118 109.2528 Constraint 486 556 8.3486 10.4358 15.6537 109.2528 Constraint 422 486 7.2791 9.0989 13.6484 109.2528 Constraint 414 486 9.7030 12.1287 18.1931 109.2528 Constraint 273 486 9.5114 11.8892 17.8338 109.2528 Constraint 262 486 8.5559 10.6949 16.0424 109.2528 Constraint 439 572 10.1448 12.6810 19.0214 109.2528 Constraint 431 572 7.9789 9.9736 14.9604 109.2528 Constraint 431 542 9.3900 11.7375 17.6063 109.2528 Constraint 459 587 9.8264 12.2830 18.4244 109.2527 Constraint 452 587 8.6332 10.7915 16.1873 109.2527 Constraint 310 393 10.5484 13.1855 19.7783 109.2527 Constraint 262 556 10.4715 13.0894 19.6341 109.2527 Constraint 471 642 8.1772 10.2215 15.3323 109.1567 Constraint 471 635 8.7787 10.9733 16.4600 109.1567 Constraint 486 673 8.8785 11.0981 16.6472 109.0528 Constraint 422 673 3.8296 4.7869 7.1804 109.0528 Constraint 414 673 5.5704 6.9630 10.4446 109.0528 Constraint 439 681 8.5016 10.6270 15.9405 108.9567 Constraint 431 681 8.8830 11.1037 16.6555 108.9567 Constraint 393 681 6.0834 7.6042 11.4064 108.9567 Constraint 385 681 8.0968 10.1210 15.1815 108.9567 Constraint 273 681 8.2407 10.3008 15.4513 108.9567 Constraint 262 681 8.7694 10.9617 16.4426 108.9567 Constraint 280 525 8.9672 11.2089 16.8134 108.7978 Constraint 385 642 9.8877 12.3597 18.5395 108.2568 Constraint 478 572 8.2929 10.3661 15.5491 108.2567 Constraint 478 551 8.4067 10.5084 15.7626 108.2567 Constraint 336 642 10.3388 12.9235 19.3852 108.2527 Constraint 336 579 8.8497 11.0621 16.5931 108.2527 Constraint 336 431 8.8397 11.0496 16.5744 108.2527 Constraint 273 336 6.3165 7.8956 11.8434 108.2527 Constraint 262 336 10.6738 13.3423 20.0134 108.2527 Constraint 459 563 9.8811 12.3514 18.5271 108.2527 Constraint 452 533 10.8910 13.6138 20.4207 108.2527 Constraint 385 635 8.8453 11.0566 16.5849 108.1568 Constraint 486 642 9.7803 12.2254 18.3381 108.1528 Constraint 486 635 9.7253 12.1566 18.2350 108.1528 Constraint 478 673 9.9177 12.3971 18.5956 108.0567 Constraint 385 673 9.5410 11.9262 17.8893 108.0567 Constraint 459 665 10.4975 13.1219 19.6828 108.0528 Constraint 452 665 8.0667 10.0834 15.1251 108.0528 Constraint 447 665 6.9968 8.7460 13.1190 108.0528 Constraint 439 665 5.1929 6.4911 9.7366 108.0528 Constraint 431 665 4.6003 5.7504 8.6256 108.0528 Constraint 402 665 9.0654 11.3318 16.9977 108.0528 Constraint 393 665 6.8942 8.6177 12.9266 108.0528 Constraint 273 665 6.1826 7.7282 11.5924 108.0528 Constraint 262 665 7.7259 9.6574 14.4861 108.0528 Constraint 402 673 10.6326 13.2908 19.9361 107.9528 Constraint 273 525 9.8324 12.2905 18.4358 107.7977 Constraint 325 402 10.4092 13.0115 19.5173 107.2568 Constraint 325 393 10.2875 12.8594 19.2892 107.2568 Constraint 289 385 8.2433 10.3041 15.4561 107.2568 Constraint 280 385 9.0353 11.2941 16.9411 107.2568 Constraint 439 579 10.8366 13.5457 20.3186 107.2529 Constraint 280 556 10.2246 12.7807 19.1711 107.2529 Constraint 422 551 9.0518 11.3148 16.9721 107.2529 Constraint 494 572 9.9235 12.4044 18.6066 107.2528 Constraint 431 494 7.5635 9.4543 14.1815 107.2528 Constraint 422 494 7.6525 9.5656 14.3485 107.2528 Constraint 478 642 10.1970 12.7463 19.1194 107.1568 Constraint 422 681 6.2531 7.8164 11.7246 106.9568 Constraint 414 681 4.7351 5.9189 8.8783 106.9568 Constraint 414 642 11.3069 14.1337 21.2005 106.9529 Constraint 336 452 10.2500 12.8125 19.2187 106.7978 Constraint 452 608 5.6986 7.1232 10.6848 106.7499 Constraint 447 608 9.7307 12.1633 18.2450 106.7499 Constraint 459 598 7.7307 9.6633 14.4950 106.7499 Constraint 331 642 10.1700 12.7125 19.0687 106.2573 Constraint 325 635 10.0863 12.6079 18.9118 106.2569 Constraint 385 579 10.0880 12.6100 18.9150 106.2568 Constraint 336 414 7.8636 9.8295 14.7443 106.2528 Constraint 431 563 10.7889 13.4861 20.2292 106.2528 Constraint 459 628 6.9376 8.6720 13.0080 106.2528 Constraint 254 579 7.8289 9.7861 14.6792 106.2527 Constraint 254 572 8.2031 10.2538 15.3808 106.2527 Constraint 254 556 7.2856 9.1070 13.6605 106.2527 Constraint 254 551 4.1775 5.2218 7.8327 106.2527 Constraint 254 542 7.5434 9.4293 14.1439 106.2527 Constraint 254 533 8.5870 10.7337 16.1006 106.2527 Constraint 254 452 7.3320 9.1650 13.7475 106.2527 Constraint 254 447 8.1743 10.2178 15.3268 106.2527 Constraint 254 439 6.8138 8.5173 12.7759 106.2527 Constraint 254 431 3.8770 4.8462 7.2693 106.2527 Constraint 254 402 10.2770 12.8462 19.2694 106.2527 Constraint 452 628 9.0480 11.3100 16.9649 106.1528 Constraint 486 665 8.2636 10.3295 15.4942 106.0529 Constraint 422 665 5.1198 6.3997 9.5996 106.0529 Constraint 414 665 3.5898 4.4872 6.7309 106.0529 Constraint 551 665 10.1658 12.7073 19.0610 106.0529 Constraint 295 665 9.5418 11.9272 17.8908 106.0529 Constraint 494 673 8.6057 10.7571 16.1356 106.0528 Constraint 161 556 8.6222 10.7777 16.1665 105.9950 Constraint 161 551 8.1890 10.2362 15.3543 105.9950 Constraint 161 525 5.9777 7.4721 11.2082 105.9950 Constraint 161 431 8.4123 10.5153 15.7730 105.9950 Constraint 161 402 8.0789 10.0986 15.1480 105.9950 Constraint 161 295 10.1364 12.6706 19.0058 105.9950 Constraint 161 273 6.4896 8.1120 12.1681 105.9950 Constraint 161 262 4.4080 5.5100 8.2651 105.9950 Constraint 153 579 6.3358 7.9197 11.8796 105.9950 Constraint 153 572 8.7263 10.9079 16.3618 105.9950 Constraint 153 563 9.4208 11.7760 17.6640 105.9950 Constraint 153 556 5.6953 7.1192 10.6787 105.9950 Constraint 153 551 5.2072 6.5090 9.7635 105.9950 Constraint 153 542 9.0859 11.3574 17.0360 105.9950 Constraint 153 533 8.6666 10.8333 16.2499 105.9950 Constraint 153 525 5.5423 6.9279 10.3919 105.9950 Constraint 153 452 8.2970 10.3712 15.5569 105.9950 Constraint 153 447 10.7281 13.4101 20.1151 105.9950 Constraint 153 439 9.9617 12.4521 18.6781 105.9950 Constraint 153 431 5.5403 6.9254 10.3881 105.9950 Constraint 153 402 8.4775 10.5969 15.8953 105.9950 Constraint 153 393 10.3849 12.9812 19.4718 105.9950 Constraint 153 303 9.9467 12.4334 18.6501 105.9950 Constraint 153 295 8.5475 10.6844 16.0266 105.9950 Constraint 153 273 4.9097 6.1371 9.2057 105.9950 Constraint 153 262 5.3288 6.6609 9.9914 105.9950 Constraint 146 579 8.5812 10.7265 16.0898 105.8293 Constraint 146 556 7.9753 9.9692 14.9537 105.8293 Constraint 146 551 9.2642 11.5802 17.3703 105.8293 Constraint 146 525 8.7198 10.8997 16.3496 105.8293 Constraint 146 431 9.2333 11.5417 17.3125 105.8293 Constraint 146 402 7.4644 9.3305 13.9957 105.8293 Constraint 146 393 10.2100 12.7625 19.1438 105.8293 Constraint 146 310 10.0193 12.5241 18.7861 105.8293 Constraint 146 303 6.4174 8.0217 12.0326 105.8293 Constraint 146 295 6.3771 7.9714 11.9571 105.8293 Constraint 146 273 5.8474 7.3093 10.9639 105.8293 Constraint 138 579 7.1138 8.8922 13.3383 105.8293 Constraint 138 556 8.9679 11.2099 16.8149 105.8293 Constraint 138 452 9.3487 11.6859 17.5288 105.8293 Constraint 138 431 7.3430 9.1787 13.7681 105.8293 Constraint 138 402 7.1058 8.8823 13.3234 105.8293 Constraint 138 393 7.9100 9.8875 14.8312 105.8293 Constraint 138 336 3.8026 4.7532 7.1299 105.8293 Constraint 138 310 8.9634 11.2042 16.8063 105.8293 Constraint 138 303 5.5171 6.8964 10.3446 105.8293 Constraint 138 295 4.1735 5.2168 7.8252 105.8293 Constraint 138 273 4.4011 5.5013 8.2520 105.8293 Constraint 138 262 8.2504 10.3131 15.4696 105.8293 Constraint 459 608 5.0583 6.3229 9.4843 105.7499 Constraint 452 598 7.9167 9.8959 14.8439 105.7499 Constraint 331 628 8.3733 10.4666 15.6999 105.2568 Constraint 295 579 11.0950 13.8687 20.8031 105.2528 Constraint 556 635 10.2000 12.7501 19.1251 105.2527 Constraint 579 650 7.2053 9.0067 13.5100 105.2527 Constraint 572 650 8.4582 10.5728 15.8592 105.2527 Constraint 551 650 8.5584 10.6980 16.0470 105.2527 Constraint 459 650 6.4410 8.0513 12.0769 105.2527 Constraint 452 650 4.6202 5.7752 8.6628 105.2527 Constraint 447 650 5.6712 7.0890 10.6335 105.2527 Constraint 439 650 6.6223 8.2779 12.4168 105.2527 Constraint 431 650 4.7336 5.9170 8.8755 105.2527 Constraint 336 650 7.3601 9.2001 13.8002 105.2527 Constraint 295 650 9.9411 12.4263 18.6395 105.1527 Constraint 273 650 7.5556 9.4445 14.1667 105.1527 Constraint 336 608 10.6491 13.3114 19.9671 105.1293 Constraint 478 665 10.2895 12.8619 19.2928 105.0569 Constraint 471 665 11.1767 13.9709 20.9563 105.0569 Constraint 385 665 5.6395 7.0494 10.5741 105.0569 Constraint 336 665 8.4626 10.5783 15.8674 105.0528 Constraint 254 673 8.6036 10.7544 16.1317 105.0527 Constraint 273 635 10.4929 13.1162 19.6742 104.9951 Constraint 153 673 11.1049 13.8812 20.8218 104.9950 Constraint 146 262 7.7709 9.7137 14.5705 104.9950 Constraint 138 635 8.3563 10.4454 15.6681 104.8293 Constraint 254 525 5.2929 6.6162 9.9243 104.7978 Constraint 254 393 11.4116 14.2645 21.3967 104.7978 Constraint 331 608 9.5760 11.9700 17.9550 104.5883 Constraint 319 385 10.3824 12.9780 19.4670 104.2568 Constraint 343 414 10.0618 12.5772 18.8658 104.2528 Constraint 273 343 8.8581 11.0727 16.6090 104.2528 Constraint 254 422 5.5061 6.8827 10.3240 104.2528 Constraint 254 414 7.6814 9.6017 14.4026 104.2528 Constraint 289 422 11.5186 14.3983 21.5974 104.2528 Constraint 447 628 11.3541 14.1926 21.2889 104.1529 Constraint 563 635 10.4782 13.0978 19.6467 104.1527 Constraint 393 650 9.6335 12.0418 18.0627 104.1527 Constraint 262 650 9.8966 12.3707 18.5561 104.1527 Constraint 161 422 8.5150 10.6437 15.9656 103.9951 Constraint 161 414 9.1552 11.4440 17.1660 103.9951 Constraint 161 289 7.1558 8.9448 13.4172 103.9951 Constraint 161 280 3.6645 4.5806 6.8709 103.9951 Constraint 153 422 8.0021 10.0026 15.0040 103.9951 Constraint 153 414 7.9285 9.9106 14.8659 103.9951 Constraint 153 289 7.1903 8.9879 13.4818 103.9951 Constraint 153 280 5.2450 6.5562 9.8343 103.9951 Constraint 126 642 9.2652 11.5815 17.3723 103.9951 Constraint 126 635 5.2387 6.5484 9.8226 103.9951 Constraint 126 608 6.9209 8.6511 12.9766 103.9951 Constraint 126 579 5.4650 6.8313 10.2469 103.9951 Constraint 126 572 9.4135 11.7669 17.6504 103.9951 Constraint 126 556 8.9364 11.1706 16.7558 103.9951 Constraint 126 551 9.7280 12.1601 18.2401 103.9951 Constraint 126 459 9.6897 12.1121 18.1681 103.9951 Constraint 126 452 8.1674 10.2093 15.3139 103.9951 Constraint 126 431 8.8211 11.0263 16.5395 103.9951 Constraint 126 393 11.1127 13.8909 20.8364 103.9951 Constraint 126 336 4.5754 5.7192 8.5788 103.9951 Constraint 126 310 10.5744 13.2180 19.8269 103.9951 Constraint 126 303 7.0351 8.7939 13.1908 103.9951 Constraint 126 295 7.5130 9.3912 14.0868 103.9951 Constraint 126 273 8.1556 10.1945 15.2917 103.9951 Constraint 402 681 8.4413 10.5516 15.8274 103.9568 Constraint 146 414 9.5544 11.9430 17.9145 103.8294 Constraint 146 289 3.6659 4.5824 6.8735 103.8294 Constraint 146 280 4.1210 5.1512 7.7268 103.8294 Constraint 138 422 10.0741 12.5927 18.8890 103.8294 Constraint 138 414 7.3655 9.2069 13.8103 103.8294 Constraint 138 319 9.8133 12.2666 18.4000 103.8294 Constraint 138 289 5.4310 6.7887 10.1831 103.8294 Constraint 138 280 6.5324 8.1655 12.2483 103.8294 Constraint 471 608 7.7882 9.7353 14.6029 103.7540 Constraint 486 608 9.8882 12.3603 18.5404 103.7500 Constraint 431 608 9.9935 12.4918 18.7377 103.7500 Constraint 336 628 10.5232 13.1540 19.7310 103.6978 Constraint 254 471 9.3816 11.7271 17.5906 103.2568 Constraint 254 385 10.1445 12.6806 19.0209 103.2568 Constraint 280 551 10.0351 12.5439 18.8158 103.2534 Constraint 280 343 11.0283 13.7853 20.6780 103.2528 Constraint 254 486 4.3418 5.4273 8.1409 103.2528 Constraint 486 650 7.3355 9.1693 13.7540 103.2528 Constraint 254 563 9.6653 12.0816 18.1224 103.2528 Constraint 459 619 8.6410 10.8013 16.2019 103.2528 Constraint 452 619 10.5266 13.1582 19.7374 103.1528 Constraint 153 385 8.7032 10.8790 16.3185 102.9991 Constraint 153 635 10.1476 12.6846 19.0268 102.9951 Constraint 161 486 10.1782 12.7227 19.0841 102.9951 Constraint 153 486 7.5715 9.4643 14.1965 102.9951 Constraint 146 422 11.1581 13.9476 20.9213 102.9951 Constraint 126 414 10.3326 12.9157 19.3736 102.9951 Constraint 126 319 9.9933 12.4917 18.7375 102.9951 Constraint 126 289 9.3816 11.7269 17.5904 102.9951 Constraint 126 280 10.6083 13.2604 19.8906 102.9951 Constraint 161 533 9.8244 12.2805 18.4207 102.9950 Constraint 280 665 10.6287 13.2859 19.9289 102.9530 Constraint 146 385 8.8375 11.0468 16.5702 102.8333 Constraint 146 331 10.5177 13.1471 19.7206 102.8333 Constraint 138 385 5.0460 6.3076 9.4613 102.8333 Constraint 138 331 6.7926 8.4908 12.7362 102.8333 Constraint 138 665 8.5874 10.7342 16.1014 102.8294 Constraint 138 572 10.8105 13.5131 20.2696 102.8293 Constraint 138 551 9.1455 11.4319 17.1478 102.8293 Constraint 146 336 7.7228 9.6535 14.4803 102.8293 Constraint 422 525 10.2412 12.8015 19.2023 102.7979 Constraint 471 598 8.3767 10.4709 15.7064 102.7540 Constraint 478 579 10.9794 13.7242 20.5863 102.2573 Constraint 254 478 8.5857 10.7321 16.0981 102.2568 Constraint 478 650 9.4684 11.8355 17.7532 102.2567 Constraint 471 650 8.4271 10.5339 15.8009 102.2567 Constraint 385 650 6.1971 7.7464 11.6196 102.2567 Constraint 331 650 8.8905 11.1131 16.6697 102.2567 Constraint 551 658 10.3093 12.8866 19.3300 102.1528 Constraint 459 658 7.5670 9.4588 14.1882 102.1528 Constraint 452 658 6.3981 7.9976 11.9964 102.1528 Constraint 447 658 3.4504 4.3129 6.4694 102.1528 Constraint 439 658 3.8696 4.8370 7.2556 102.1528 Constraint 431 658 6.0124 7.5156 11.2733 102.1528 Constraint 422 650 8.3286 10.4107 15.6161 102.1528 Constraint 414 650 7.0222 8.7778 13.1667 102.1528 Constraint 254 665 7.9611 9.9514 14.9271 102.0528 Constraint 153 665 9.0428 11.3035 16.9553 101.9952 Constraint 126 598 9.9094 12.3868 18.5802 101.9951 Constraint 126 587 7.6799 9.5999 14.3998 101.9951 Constraint 153 336 8.6301 10.7877 16.1815 101.9951 Constraint 138 343 6.9213 8.6516 12.9774 101.8294 Constraint 325 579 10.6076 13.2594 19.8892 101.2569 Constraint 331 619 8.8866 11.1083 16.6625 101.2568 Constraint 414 551 10.4644 13.0805 19.6208 101.2534 Constraint 254 494 6.8412 8.5515 12.8272 101.2528 Constraint 262 494 9.7022 12.1278 18.1917 101.2528 Constraint 295 422 11.1559 13.9448 20.9173 101.2528 Constraint 579 665 10.4319 13.0399 19.5599 101.0530 Constraint 273 658 10.0461 12.5576 18.8364 101.0528 Constraint 262 658 10.9355 13.6693 20.5040 101.0528 Constraint 161 393 11.1709 13.9637 20.9455 100.9992 Constraint 161 385 11.1854 13.9817 20.9725 100.9992 Constraint 126 385 7.0399 8.7999 13.1999 100.9991 Constraint 126 331 4.3811 5.4763 8.2145 100.9991 Constraint 153 518 9.2197 11.5246 17.2869 100.9991 Constraint 126 665 10.1232 12.6540 18.9810 100.9952 Constraint 126 343 8.0720 10.0900 15.1349 100.9951 Constraint 146 325 8.4941 10.6176 15.9265 100.8334 Constraint 138 325 5.8486 7.3107 10.9660 100.8334 Constraint 138 486 10.8525 13.5656 20.3484 100.8294 Constraint 138 587 9.9615 12.4519 18.6779 100.8293 Constraint 303 579 11.0667 13.8334 20.7501 100.4977 Constraint 507 579 8.6420 10.8025 16.2038 100.4542 Constraint 447 507 8.0756 10.0945 15.1417 100.4542 Constraint 439 507 8.4722 10.5902 15.8853 100.4542 Constraint 431 507 7.6341 9.5427 14.3140 100.4542 Constraint 295 362 7.8147 9.7684 14.6526 100.2568 Constraint 486 587 10.7806 13.4757 20.2136 100.2534 Constraint 486 658 7.2127 9.0159 13.5238 100.1529 Constraint 572 658 10.3236 12.9045 19.3568 100.1529 Constraint 494 665 9.9836 12.4795 18.7192 100.0529 Constraint 422 658 7.7557 9.6947 14.5420 100.0529 Constraint 161 579 10.4981 13.1226 19.6839 99.9992 Constraint 126 325 5.6905 7.1131 10.6696 99.9992 Constraint 153 587 9.1261 11.4076 17.1114 99.9951 Constraint 126 628 8.5311 10.6638 15.9957 99.9951 Constraint 161 254 5.8755 7.3444 11.0165 99.9950 Constraint 153 254 4.2220 5.2775 7.9163 99.9950 Constraint 146 254 8.5707 10.7134 16.0701 99.8293 Constraint 138 254 8.5836 10.7295 16.0942 99.8293 Constraint 138 650 7.5271 9.4089 14.1133 99.8293 Constraint 459 542 10.2926 12.8658 19.2987 99.2527 Constraint 254 336 11.0329 13.7911 20.6867 99.2527 Constraint 556 650 10.7573 13.4466 20.1699 99.2527 Constraint 478 658 7.2271 9.0339 13.5509 99.1569 Constraint 471 658 8.1198 10.1497 15.2246 99.1569 Constraint 385 658 9.2732 11.5915 17.3873 99.1569 Constraint 579 658 10.6452 13.3065 19.9598 99.1529 Constraint 343 650 10.9970 13.7462 20.6194 99.1529 Constraint 414 658 8.0490 10.0613 15.0919 99.0529 Constraint 153 507 8.6415 10.8018 16.2027 98.9992 Constraint 153 650 8.5680 10.7100 16.0650 98.9950 Constraint 146 343 9.7499 12.1874 18.2811 98.8294 Constraint 138 608 10.1803 12.7254 19.0881 98.8294 Constraint 471 587 10.3508 12.9385 19.4077 98.5024 Constraint 262 579 10.7481 13.4352 20.1528 98.4542 Constraint 254 650 8.2599 10.3248 15.4873 98.2527 Constraint 452 518 10.7582 13.4477 20.1715 98.1991 Constraint 161 518 9.7690 12.2112 18.3169 97.9996 Constraint 126 402 11.2118 14.0147 21.0220 97.9951 Constraint 126 254 10.5541 13.1927 19.7890 97.9951 Constraint 126 619 8.7165 10.8956 16.3435 97.9951 Constraint 126 650 7.0507 8.8133 13.2200 97.9951 Constraint 244 551 8.8385 11.0481 16.5722 97.9568 Constraint 244 542 9.9783 12.4728 18.7092 97.9568 Constraint 244 439 9.2691 11.5863 17.3795 97.9568 Constraint 244 431 9.1553 11.4441 17.1662 97.9568 Constraint 486 598 10.5425 13.1781 19.7672 97.7505 Constraint 422 507 9.6900 12.1125 18.1688 97.4542 Constraint 273 362 9.6597 12.0746 18.1119 97.2569 Constraint 431 533 11.1295 13.9119 20.8678 97.2534 Constraint 336 422 11.3408 14.1760 21.2640 97.2528 Constraint 254 635 10.9495 13.6869 20.5304 97.1529 Constraint 280 579 10.9290 13.6613 20.4919 96.9992 Constraint 153 608 10.6031 13.2538 19.8807 96.9992 Constraint 244 486 7.9927 9.9909 14.9863 96.9568 Constraint 244 422 7.8099 9.7624 14.6436 96.9568 Constraint 254 681 11.0341 13.7927 20.6890 96.9568 Constraint 439 692 9.6357 12.0446 18.0669 96.9567 Constraint 244 525 7.8503 9.8129 14.7194 96.5018 Constraint 362 635 8.3388 10.4234 15.6352 96.2569 Constraint 362 665 8.8691 11.0864 16.6296 96.0570 Constraint 494 658 8.6828 10.8536 16.2803 96.0529 Constraint 494 650 10.6486 13.3108 19.9661 96.0528 Constraint 161 507 10.5036 13.1296 19.6943 95.9997 Constraint 74 642 6.2356 7.7944 11.6917 95.9992 Constraint 74 635 3.9027 4.8784 7.3176 95.9992 Constraint 74 608 7.4651 9.3314 13.9970 95.9992 Constraint 74 579 8.1167 10.1459 15.2188 95.9992 Constraint 74 452 8.1634 10.2042 15.3063 95.9992 Constraint 74 447 10.6300 13.2875 19.9313 95.9992 Constraint 74 431 9.3183 11.6478 17.4717 95.9992 Constraint 74 414 10.1480 12.6849 19.0274 95.9992 Constraint 74 385 6.3580 7.9474 11.9212 95.9992 Constraint 74 331 4.2027 5.2534 7.8800 95.9992 Constraint 74 325 7.4384 9.2980 13.9470 95.9992 Constraint 50 681 9.6823 12.1029 18.1543 95.9992 Constraint 50 642 5.3012 6.6265 9.9398 95.9992 Constraint 50 452 9.0311 11.2889 16.9333 95.9992 Constraint 50 447 7.1220 8.9025 13.3538 95.9992 Constraint 50 439 7.8682 9.8352 14.7528 95.9992 Constraint 50 431 9.2321 11.5401 17.3102 95.9992 Constraint 50 422 10.7963 13.4954 20.2431 95.9992 Constraint 50 385 9.2540 11.5675 17.3512 95.9992 Constraint 39 681 5.6968 7.1210 10.6815 95.9992 Constraint 39 452 11.0626 13.8282 20.7423 95.9992 Constraint 39 447 9.0904 11.3629 17.0444 95.9992 Constraint 39 439 7.8305 9.7882 14.6822 95.9992 Constraint 39 431 8.9322 11.1652 16.7479 95.9992 Constraint 39 422 8.7712 10.9640 16.4460 95.9992 Constraint 39 414 6.9767 8.7209 13.0814 95.9992 Constraint 39 385 7.6662 9.5828 14.3742 95.9992 Constraint 146 587 10.2327 12.7908 19.1863 95.8334 Constraint 146 650 11.0317 13.7896 20.6844 95.8333 Constraint 362 628 9.3082 11.6352 17.4528 95.2569 Constraint 362 642 9.0053 11.2566 16.8849 95.2569 Constraint 352 635 10.6303 13.2878 19.9318 95.2569 Constraint 362 650 7.7279 9.6598 14.4898 95.2568 Constraint 518 587 11.3096 14.1370 21.2055 95.1996 Constraint 431 518 10.3518 12.9397 19.4096 95.1992 Constraint 254 518 7.4261 9.2826 13.9239 95.1991 Constraint 402 650 11.2400 14.0500 21.0750 95.1951 Constraint 254 658 9.2855 11.6068 17.4103 95.0529 Constraint 153 325 10.8675 13.5844 20.3767 94.9992 Constraint 471 628 11.3609 14.2012 21.3017 94.9992 Constraint 50 635 8.9801 11.2251 16.8376 94.9992 Constraint 39 642 8.9163 11.1454 16.7180 94.9992 Constraint 82 642 8.2842 10.3553 15.5329 94.9992 Constraint 82 635 6.1843 7.7304 11.5955 94.9992 Constraint 82 385 10.3396 12.9245 19.3868 94.9992 Constraint 82 331 5.1770 6.4712 9.7069 94.9992 Constraint 82 325 8.9057 11.1322 16.6982 94.9992 Constraint 74 459 8.5021 10.6277 15.9415 94.9992 Constraint 74 336 5.1388 6.4235 9.6353 94.9992 Constraint 74 295 8.9321 11.1651 16.7476 94.9992 Constraint 74 273 9.4946 11.8683 17.8024 94.9992 Constraint 74 138 7.1168 8.8959 13.3439 94.9992 Constraint 65 642 4.0209 5.0261 7.5392 94.9992 Constraint 65 635 5.7143 7.1428 10.7142 94.9992 Constraint 65 608 9.1336 11.4169 17.1254 94.9992 Constraint 65 459 7.9514 9.9392 14.9088 94.9992 Constraint 65 452 8.9924 11.2405 16.8608 94.9992 Constraint 65 447 9.8096 12.2621 18.3931 94.9992 Constraint 65 431 10.7716 13.4644 20.1967 94.9992 Constraint 65 385 8.7451 10.9314 16.3972 94.9992 Constraint 65 336 8.9352 11.1690 16.7535 94.9992 Constraint 65 331 8.1606 10.2008 15.3012 94.9992 Constraint 58 681 8.8257 11.0321 16.5482 94.9992 Constraint 58 673 9.0764 11.3455 17.0182 94.9992 Constraint 58 642 5.8206 7.2758 10.9137 94.9992 Constraint 58 579 10.4440 13.0550 19.5826 94.9992 Constraint 58 459 9.3218 11.6523 17.4784 94.9992 Constraint 58 452 8.4229 10.5287 15.7930 94.9992 Constraint 58 447 8.5750 10.7188 16.0782 94.9992 Constraint 58 439 8.8551 11.0689 16.6034 94.9992 Constraint 58 431 7.7703 9.7129 14.5694 94.9992 Constraint 58 422 9.9529 12.4411 18.6616 94.9992 Constraint 58 414 7.2545 9.0681 13.6022 94.9992 Constraint 58 385 5.0544 6.3180 9.4770 94.9992 Constraint 58 336 6.8431 8.5539 12.8308 94.9992 Constraint 58 331 8.2493 10.3117 15.4675 94.9992 Constraint 58 126 8.3710 10.4637 15.6956 94.9992 Constraint 50 673 8.6595 10.8244 16.2366 94.9992 Constraint 50 471 11.1022 13.8778 20.8167 94.9992 Constraint 39 673 6.2629 7.8286 11.7429 94.9992 Constraint 39 393 8.2595 10.3244 15.4866 94.9992 Constraint 126 563 10.8655 13.5819 20.3728 94.9951 Constraint 422 692 6.0682 7.5852 11.3778 94.9568 Constraint 414 692 6.4097 8.0122 12.0182 94.9568 Constraint 431 692 9.9071 12.3839 18.5759 94.9568 Constraint 393 692 7.7615 9.7019 14.5529 94.9568 Constraint 273 692 8.9732 11.2165 16.8247 94.9568 Constraint 170 262 6.2834 7.8543 11.7815 94.6681 Constraint 393 658 11.2521 14.0651 21.0976 94.5979 Constraint 262 507 9.9648 12.4559 18.6839 94.4547 Constraint 507 587 10.7666 13.4582 20.1873 94.4547 Constraint 254 507 5.6842 7.1052 10.6578 94.4542 Constraint 439 542 10.9824 13.7279 20.5919 94.2534 Constraint 58 635 6.8804 8.6005 12.9008 93.9992 Constraint 82 459 10.3133 12.8916 19.3374 93.9992 Constraint 82 336 8.3829 10.4787 15.7180 93.9992 Constraint 58 393 8.2454 10.3068 15.4602 93.9992 Constraint 58 295 9.4705 11.8381 17.7572 93.9992 Constraint 58 273 8.5287 10.6608 15.9912 93.9992 Constraint 58 138 8.5772 10.7215 16.0822 93.9992 Constraint 50 459 8.9350 11.1688 16.7532 93.9992 Constraint 244 494 6.6708 8.3385 12.5078 93.9568 Constraint 402 692 8.6118 10.7647 16.1471 93.9568 Constraint 431 587 11.1378 13.9223 20.8834 93.9531 Constraint 138 362 8.3217 10.4022 15.6032 93.8334 Constraint 170 551 6.9863 8.7328 13.0993 93.6681 Constraint 170 525 4.9879 6.2348 9.3522 93.6681 Constraint 170 431 8.5188 10.6485 15.9727 93.6681 Constraint 254 459 11.0405 13.8007 20.7010 93.2527 Constraint 507 598 10.5653 13.2067 19.8100 92.9997 Constraint 50 414 9.5602 11.9503 17.9254 92.9993 Constraint 39 635 11.3251 14.1564 21.2347 92.9992 Constraint 82 608 8.5406 10.6757 16.0135 92.9992 Constraint 74 628 5.7684 7.2105 10.8157 92.9992 Constraint 74 343 8.2345 10.2931 15.4397 92.9992 Constraint 126 352 8.5286 10.6607 15.9911 92.9992 Constraint 414 635 11.0809 13.8511 20.7766 92.9951 Constraint 170 280 8.9586 11.1982 16.7974 92.6682 Constraint 262 692 7.7409 9.6762 14.5143 92.4540 Constraint 303 414 11.4912 14.3639 21.5459 92.2533 Constraint 262 518 10.9025 13.6281 20.4421 92.1997 Constraint 74 303 9.7247 12.1558 18.2338 91.9997 Constraint 74 665 8.8452 11.0564 16.5847 91.9993 Constraint 65 665 9.1176 11.3970 17.0955 91.9993 Constraint 58 665 5.0417 6.3022 9.4533 91.9993 Constraint 50 665 6.3260 7.9075 11.8612 91.9993 Constraint 39 665 4.5578 5.6973 8.5459 91.9993 Constraint 82 628 4.5455 5.6819 8.5228 91.9992 Constraint 58 343 9.3889 11.7362 17.6042 91.9992 Constraint 98 331 6.0580 7.5724 11.3587 91.9992 Constraint 161 244 8.5008 10.6260 15.9390 91.9991 Constraint 153 244 9.6801 12.1001 18.1501 91.9991 Constraint 153 658 11.2907 14.1133 21.1700 91.9952 Constraint 170 494 8.8026 11.0032 16.5048 91.6682 Constraint 244 507 7.5238 9.4048 14.1071 91.4542 Constraint 170 518 6.4356 8.0445 12.0668 90.9996 Constraint 50 478 11.0019 13.7523 20.6285 90.9993 Constraint 32 681 6.5048 8.1311 12.1966 90.9993 Constraint 32 422 7.7125 9.6407 14.4610 90.9993 Constraint 32 414 8.2753 10.3441 15.5161 90.9993 Constraint 39 336 10.6637 13.3296 19.9944 90.9992 Constraint 65 628 4.9326 6.1658 9.2487 90.9992 Constraint 74 393 10.6619 13.3274 19.9911 90.9992 Constraint 89 635 5.8287 7.2859 10.9288 90.9992 Constraint 89 331 5.2329 6.5411 9.8116 90.9992 Constraint 89 608 6.5660 8.2075 12.3113 90.9992 Constraint 244 518 7.7402 9.6753 14.5129 90.9992 Constraint 161 665 11.2492 14.0615 21.0922 90.9953 Constraint 153 494 10.7110 13.3888 20.0832 90.9951 Constraint 138 352 9.1607 11.4509 17.1764 90.8334 Constraint 138 525 10.3696 12.9619 19.4429 90.8299 Constraint 170 254 5.4769 6.8462 10.2692 90.6681 Constraint 507 650 10.6901 13.3627 20.0440 90.4542 Constraint 32 447 7.5462 9.4328 14.1491 89.9993 Constraint 32 439 5.5138 6.8922 10.3383 89.9993 Constraint 32 673 4.3964 5.4955 8.2432 89.9993 Constraint 32 665 5.7268 7.1585 10.7378 89.9993 Constraint 32 431 8.7993 10.9992 16.4988 89.9993 Constraint 39 273 9.8794 12.3493 18.5239 89.9993 Constraint 98 635 8.9490 11.1862 16.7794 89.9992 Constraint 98 608 9.6437 12.0546 18.0819 89.9992 Constraint 58 628 8.6499 10.8124 16.2186 89.9992 Constraint 50 628 9.7369 12.1711 18.2566 89.9992 Constraint 50 486 11.0878 13.8598 20.7897 89.9992 Constraint 74 619 7.7229 9.6536 14.4804 89.9992 Constraint 89 336 8.1971 10.2464 15.3696 89.9992 Constraint 126 362 7.6230 9.5287 14.2931 89.9992 Constraint 161 542 11.0054 13.7567 20.6351 89.9956 Constraint 146 665 11.4264 14.2830 21.4246 89.8301 Constraint 170 422 8.0290 10.0362 15.0543 89.6683 Constraint 170 507 7.1832 8.9789 13.4684 88.9997 Constraint 89 325 7.8456 9.8070 14.7105 88.9994 Constraint 32 452 10.9529 13.6911 20.5367 88.9993 Constraint 507 658 10.7687 13.4609 20.1914 88.9993 Constraint 58 608 10.4201 13.0251 19.5377 88.9993 Constraint 58 486 10.9584 13.6979 20.5469 88.9992 Constraint 82 619 5.4016 6.7521 10.1281 88.9992 Constraint 82 579 10.7580 13.4475 20.1712 88.9992 Constraint 74 650 5.4980 6.8725 10.3088 88.9992 Constraint 74 572 10.8851 13.6064 20.4096 88.9992 Constraint 74 362 4.9238 6.1547 9.2321 88.9992 Constraint 74 352 7.0721 8.8401 13.2602 88.9992 Constraint 65 650 6.1408 7.6760 11.5140 88.9992 Constraint 58 650 4.0182 5.0227 7.5341 88.9992 Constraint 50 650 5.9041 7.3802 11.0702 88.9992 Constraint 39 650 7.1555 8.9444 13.4166 88.9992 Constraint 106 331 8.2879 10.3598 15.5397 88.9992 Constraint 325 414 11.4369 14.2961 21.4442 88.9569 Constraint 244 673 10.1805 12.7256 19.0884 88.9568 Constraint 459 556 10.7733 13.4666 20.1999 88.8018 Constraint 170 486 7.9589 9.9486 14.9229 88.6682 Constraint 289 579 11.3242 14.1552 21.2328 88.4502 Constraint 385 486 11.4635 14.3293 21.4940 88.2569 Constraint 74 153 10.5944 13.2430 19.8645 87.9997 Constraint 32 642 10.0196 12.5246 18.7868 87.9994 Constraint 32 486 10.4472 13.0589 19.5884 87.9993 Constraint 32 478 10.0556 12.5694 18.8542 87.9993 Constraint 32 385 10.6980 13.3725 20.0587 87.9993 Constraint 82 650 9.4977 11.8721 17.8082 87.9992 Constraint 82 362 7.2682 9.0852 13.6278 87.9992 Constraint 82 352 7.7147 9.6433 14.4650 87.9992 Constraint 65 362 6.3888 7.9859 11.9789 87.9992 Constraint 58 362 5.0360 6.2950 9.4424 87.9992 Constraint 58 352 8.9081 11.1351 16.7027 87.9992 Constraint 98 628 8.4815 10.6019 15.9028 87.9992 Constraint 89 628 6.4355 8.0444 12.0666 87.9992 Constraint 89 587 8.6684 10.8355 16.2532 87.9992 Constraint 153 331 11.5044 14.3805 21.5708 87.9991 Constraint 447 681 11.2636 14.0795 21.1192 87.9568 Constraint 254 587 10.9048 13.6310 20.4465 87.9529 Constraint 170 273 9.5302 11.9127 17.8691 87.6681 Constraint 98 619 6.5449 8.1811 12.2716 86.9992 Constraint 50 362 8.9916 11.2394 16.8592 86.9992 Constraint 39 362 8.8053 11.0067 16.5100 86.9992 Constraint 343 635 11.3657 14.2071 21.3106 86.9956 Constraint 138 642 11.1705 13.9632 20.9447 86.8340 Constraint 244 533 10.6725 13.3406 20.0109 86.5019 Constraint 414 579 10.9551 13.6938 20.5408 86.4542 Constraint 325 650 10.7796 13.4745 20.2118 86.2574 Constraint 343 665 11.2284 14.0355 21.0532 86.0535 Constraint 65 138 10.9524 13.6904 20.5357 85.9997 Constraint 98 325 7.7102 9.6378 14.4567 85.9995 Constraint 74 658 9.5723 11.9654 17.9481 85.9993 Constraint 65 658 8.1665 10.2081 15.3121 85.9993 Constraint 58 658 6.1448 7.6811 11.5216 85.9993 Constraint 50 658 4.2244 5.2805 7.9207 85.9993 Constraint 39 658 5.8091 7.2614 10.8921 85.9993 Constraint 65 619 8.4903 10.6128 15.9193 85.9992 Constraint 65 579 10.8355 13.5444 20.3167 85.9992 Constraint 89 619 5.0666 6.3333 9.4999 85.9992 Constraint 65 439 11.5333 14.4166 21.6249 85.9992 Constraint 89 579 8.0604 10.0755 15.1133 85.9992 Constraint 385 692 10.2590 12.8237 19.2356 85.9568 Constraint 295 681 10.5460 13.1824 19.7737 85.9568 Constraint 244 478 9.5565 11.9456 17.9184 85.9568 Constraint 336 658 11.1497 13.9372 20.9057 85.6984 Constraint 331 452 11.0316 13.7895 20.6842 85.2573 Constraint 58 325 10.2692 12.8365 19.2548 84.9998 Constraint 58 402 11.0909 13.8636 20.7954 84.9994 Constraint 89 385 10.6099 13.2623 19.8935 84.9994 Constraint 65 352 9.3341 11.6676 17.5014 84.9992 Constraint 39 692 9.3379 11.6724 17.5086 84.9992 Constraint 170 244 5.6027 7.0034 10.5050 84.6682 Constraint 50 336 11.1307 13.9134 20.8701 83.9997 Constraint 89 303 9.8582 12.3227 18.4841 83.9997 Constraint 295 635 11.1634 13.9543 20.9314 83.9997 Constraint 89 343 10.4193 13.0241 19.5362 83.9994 Constraint 32 393 10.7943 13.4928 20.2392 83.9994 Constraint 32 494 9.7792 12.2240 18.3360 83.9993 Constraint 106 325 9.2122 11.5152 17.2728 83.9993 Constraint 507 608 11.0386 13.7982 20.6973 83.9992 Constraint 98 336 9.3342 11.6677 17.5015 83.9992 Constraint 113 325 7.4413 9.3016 13.9524 83.9992 Constraint 113 331 7.2255 9.0318 13.5477 83.9992 Constraint 82 452 11.2075 14.0093 21.0140 83.9992 Constraint 106 619 7.9033 9.8791 14.8186 83.9992 Constraint 138 658 11.3713 14.2141 21.3212 83.8301 Constraint 362 431 10.6754 13.3442 20.0164 83.2569 Constraint 352 650 10.9484 13.6855 20.5283 83.2568 Constraint 74 319 10.7821 13.4776 20.2164 82.9997 Constraint 170 439 10.1550 12.6937 19.0406 82.9996 Constraint 32 273 11.3471 14.1839 21.2759 82.9994 Constraint 32 658 4.8931 6.1163 9.1745 82.9993 Constraint 237 494 7.9561 9.9451 14.9177 82.9574 Constraint 331 665 11.2618 14.0772 21.1159 82.0574 Constraint 551 673 11.4268 14.2835 21.4253 82.0535 Constraint 89 642 9.4469 11.8086 17.7129 81.9992 Constraint 58 153 11.0774 13.8468 20.7701 81.9992 Constraint 126 658 11.3745 14.2181 21.3271 81.9957 Constraint 161 336 11.6188 14.5235 21.7853 81.9952 Constraint 237 422 8.5615 10.7019 16.0529 81.9574 Constraint 237 486 9.5786 11.9732 17.9598 81.9574 Constraint 170 533 7.8630 9.8288 14.7431 81.6681 Constraint 352 628 10.7513 13.4391 20.1587 81.2574 Constraint 32 650 8.4295 10.5369 15.8054 80.9994 Constraint 89 598 9.3920 11.7399 17.6099 80.9992 Constraint 237 507 9.0107 11.2634 16.8950 80.4547 Constraint 331 414 11.4543 14.3179 21.4768 80.4546 Constraint 82 343 9.9343 12.4179 18.6268 79.9997 Constraint 89 459 9.6863 12.1079 18.1619 79.9994 Constraint 32 692 8.9377 11.1721 16.7582 79.9993 Constraint 89 362 9.1650 11.4562 17.1844 79.9992 Constraint 89 352 9.1305 11.4131 17.1197 79.9992 Constraint 113 619 9.0667 11.3334 17.0001 79.9992 Constraint 273 352 11.5097 14.3872 21.5807 79.4541 Constraint 289 556 11.1201 13.9002 20.8503 79.2529 Constraint 74 587 10.5636 13.2045 19.8067 78.9997 Constraint 153 471 11.0813 13.8517 20.7775 78.9997 Constraint 74 146 10.9752 13.7190 20.5785 78.9997 Constraint 50 393 11.3055 14.1318 21.1978 78.9994 Constraint 113 579 9.6212 12.0265 18.0397 78.9992 Constraint 336 681 11.0552 13.8190 20.7284 78.9568 Constraint 478 563 11.2033 14.0042 21.0063 78.2574 Constraint 113 303 7.9807 9.9758 14.9638 77.9996 Constraint 89 452 9.9836 12.4795 18.7193 77.9994 Constraint 146 533 10.9008 13.6260 20.4389 77.9956 Constraint 146 452 11.4425 14.3031 21.4546 77.8339 Constraint 170 556 8.3809 10.4761 15.7141 77.6682 Constraint 551 642 11.0283 13.7854 20.6780 77.1533 Constraint 89 295 11.3179 14.1473 21.2210 76.9997 Constraint 65 325 11.2310 14.0387 21.0580 76.9997 Constraint 65 414 11.4009 14.2511 21.3767 76.9993 Constraint 113 336 9.3010 11.6263 17.4395 76.9993 Constraint 126 262 11.5093 14.3867 21.5800 76.9952 Constraint 362 658 10.4787 13.0983 19.6475 76.1575 Constraint 89 650 9.6042 12.0053 18.0080 75.9994 Constraint 113 587 8.5434 10.6792 16.0188 75.9992 Constraint 289 665 11.5184 14.3980 21.5971 75.9535 Constraint 385 551 11.2703 14.0879 21.1318 75.2574 Constraint 39 262 11.5339 14.4174 21.6261 74.9994 Constraint 289 525 11.1014 13.8767 20.8150 74.7984 Constraint 237 525 9.1965 11.4957 17.2435 74.6683 Constraint 385 628 11.3950 14.2437 21.3656 74.1996 Constraint 82 319 10.9410 13.6762 20.5143 73.9997 Constraint 98 303 9.5345 11.9182 17.8773 73.9997 Constraint 113 635 9.6934 12.1167 18.1751 73.9992 Constraint 280 681 11.2490 14.0613 21.0920 73.9570 Constraint 98 319 9.1640 11.4550 17.1825 72.9998 Constraint 74 598 11.4059 14.2574 21.3861 72.9998 Constraint 237 518 8.7523 10.9404 16.4106 72.9998 Constraint 32 262 11.5296 14.4120 21.6181 72.9993 Constraint 98 352 8.8732 11.0915 16.6373 72.9992 Constraint 58 254 11.2633 14.0791 21.1186 72.9992 Constraint 58 262 11.4808 14.3510 21.5266 72.9992 Constraint 126 486 10.9863 13.7328 20.5992 72.9958 Constraint 414 494 10.8494 13.5618 20.3427 72.9953 Constraint 182 262 9.2784 11.5980 17.3970 72.6683 Constraint 170 542 7.6583 9.5729 14.3593 72.6682 Constraint 65 343 10.9943 13.7429 20.6143 71.9997 Constraint 280 650 11.5969 14.4961 21.7441 71.9993 Constraint 98 362 10.0232 12.5289 18.7934 71.9993 Constraint 113 608 9.2295 11.5368 17.3053 71.9992 Constraint 138 439 11.5146 14.3933 21.5899 71.8299 Constraint 182 525 7.2297 9.0372 13.5557 71.6683 Constraint 182 254 8.1106 10.1382 15.2073 71.6683 Constraint 237 551 10.3001 12.8752 19.3128 71.6683 Constraint 89 572 10.6947 13.3684 20.0526 70.9994 Constraint 331 587 10.8894 13.6117 20.4176 70.7541 Constraint 331 431 11.3413 14.1766 21.2649 70.2573 Constraint 447 556 11.5436 14.4295 21.6442 70.2529 Constraint 89 319 10.5273 13.1592 19.7388 69.9998 Constraint 161 303 11.6486 14.5608 21.8412 69.9998 Constraint 106 628 10.2371 12.7964 19.1946 69.9994 Constraint 58 619 11.6871 14.6088 21.9132 69.9994 Constraint 106 635 10.2907 12.8634 19.2952 69.9993 Constraint 447 563 11.3409 14.1761 21.2642 69.9536 Constraint 170 414 10.3932 12.9915 19.4873 69.6683 Constraint 153 598 11.3850 14.2313 21.3469 68.9998 Constraint 447 598 11.3340 14.1675 21.2512 68.9959 Constraint 237 439 9.8365 12.2956 18.4434 68.9574 Constraint 572 665 11.2311 14.0389 21.0584 68.5507 Constraint 422 579 11.2141 14.0177 21.0265 68.4549 Constraint 23 681 5.6794 7.0993 10.6489 67.9998 Constraint 23 414 9.2075 11.5094 17.2641 67.9998 Constraint 98 579 10.8443 13.5553 20.3330 67.9992 Constraint 23 673 5.9850 7.4812 11.2218 66.9999 Constraint 23 665 7.8804 9.8506 14.7758 66.9999 Constraint 23 439 9.0829 11.3537 17.0305 66.9999 Constraint 161 237 9.5898 11.9872 17.9808 66.9998 Constraint 374 681 8.4712 10.5890 15.8835 66.9994 Constraint 295 374 8.2075 10.2593 15.3890 66.9994 Constraint 273 374 8.8161 11.0201 16.5301 66.9994 Constraint 74 374 6.5122 8.1403 12.2105 66.9994 Constraint 50 374 7.7031 9.6288 14.4433 66.9994 Constraint 39 374 6.1529 7.6911 11.5367 66.9994 Constraint 32 374 10.3068 12.8835 19.3252 66.9994 Constraint 280 692 10.2118 12.7647 19.1471 66.9993 Constraint 98 587 10.5981 13.2476 19.8714 66.9992 Constraint 237 431 10.2889 12.8611 19.2916 66.9574 Constraint 146 319 11.4705 14.3381 21.5071 66.8336 Constraint 336 551 11.0058 13.7572 20.6358 66.2533 Constraint 182 518 6.4924 8.1155 12.1733 65.9998 Constraint 374 642 9.3464 11.6830 17.5245 65.9994 Constraint 374 635 9.5510 11.9388 17.9082 65.9994 Constraint 374 665 6.8464 8.5579 12.8369 65.9994 Constraint 138 374 8.8312 11.0390 16.5585 65.9994 Constraint 126 374 9.4270 11.7837 17.6755 65.9994 Constraint 82 374 9.6178 12.0222 18.0333 65.9994 Constraint 65 374 7.0893 8.8616 13.2925 65.9994 Constraint 58 374 3.9221 4.9027 7.3540 65.9994 Constraint 439 525 11.2191 14.0239 21.0358 65.7979 Constraint 507 665 11.3875 14.2344 21.3516 65.4548 Constraint 362 452 11.0810 13.8513 20.7769 65.2574 Constraint 478 635 11.5219 14.4023 21.6035 65.1575 Constraint 23 422 9.2300 11.5376 17.3063 64.9998 Constraint 336 587 11.3085 14.1357 21.2035 64.7541 Constraint 273 572 11.4962 14.3703 21.5554 64.4506 Constraint 254 608 11.1409 13.9261 20.8892 63.9993 Constraint 146 635 11.2689 14.0861 21.1291 63.8340 Constraint 362 681 10.8292 13.5365 20.3047 63.4547 Constraint 336 619 11.2644 14.0806 21.1208 63.2535 Constraint 336 556 11.1709 13.9636 20.9454 63.2528 Constraint 50 273 11.5889 14.4861 21.7292 62.9999 Constraint 32 254 11.3703 14.2129 21.3194 62.9994 Constraint 374 673 10.4990 13.1238 19.6857 62.9994 Constraint 39 402 11.2671 14.0838 21.1258 62.9994 Constraint 254 692 10.3122 12.8903 19.3354 62.9993 Constraint 126 447 11.3548 14.1935 21.2902 62.9958 Constraint 542 650 11.1962 13.9952 20.9928 62.9534 Constraint 106 303 10.0484 12.5605 18.8408 61.9998 Constraint 113 319 8.2937 10.3671 15.5507 61.9997 Constraint 507 673 11.5351 14.4189 21.6284 61.4548 Constraint 273 494 11.5359 14.4198 21.6298 61.2576 Constraint 362 619 11.0684 13.8355 20.7532 61.2570 Constraint 362 579 11.0931 13.8664 20.7996 61.2569 Constraint 262 542 11.3341 14.1676 21.2514 61.2534 Constraint 170 478 10.5435 13.1794 19.7690 60.9998 Constraint 153 343 11.7150 14.6438 21.9656 60.9953 Constraint 182 422 10.0847 12.6058 18.9087 60.6684 Constraint 23 658 8.7058 10.8822 16.3233 59.9999 Constraint 182 507 7.7188 9.6485 14.4728 59.9999 Constraint 374 658 9.5164 11.8955 17.8432 59.9994 Constraint 374 650 7.1664 8.9580 13.4370 59.9994 Constraint 106 587 9.6425 12.0531 18.0796 59.9993 Constraint 106 608 9.3351 11.6689 17.5033 59.9993 Constraint 182 494 8.7826 10.9783 16.4675 59.6684 Constraint 182 551 8.7923 10.9903 16.4855 59.6683 Constraint 494 579 11.5216 14.4020 21.6030 59.2535 Constraint 113 310 9.9968 12.4960 18.7441 58.9998 Constraint 98 343 9.7124 12.1406 18.2108 58.9998 Constraint 65 471 11.7019 14.6274 21.9411 58.9993 Constraint 273 507 11.2667 14.0834 21.1250 58.4548 Constraint 17 681 5.8342 7.2928 10.9391 57.9999 Constraint 17 673 6.1026 7.6282 11.4423 57.9999 Constraint 74 439 11.7202 14.6503 21.9754 57.9998 Constraint 280 486 11.4754 14.3443 21.5164 57.2998 Constraint 325 628 11.4078 14.2597 21.3896 57.2574 Constraint 478 608 11.2010 14.0012 21.0019 56.9999 Constraint 525 598 11.7549 14.6936 22.0404 56.9997 Constraint 518 598 11.7910 14.7388 22.1081 56.9997 Constraint 23 393 10.1505 12.6882 19.0323 55.9999 Constraint 113 295 10.6470 13.3088 19.9631 55.9997 Constraint 374 628 10.8849 13.6062 20.4093 55.9994 Constraint 237 673 9.6619 12.0774 18.1161 55.9574 Constraint 17 439 9.5807 11.9758 17.9638 54.9999 Constraint 17 414 9.2176 11.5220 17.2830 54.9999 Constraint 23 692 7.5972 9.4966 14.2448 54.9998 Constraint 74 551 11.4451 14.3064 21.4596 54.9997 Constraint 138 681 11.0672 13.8340 20.7509 54.9997 Constraint 146 572 11.5979 14.4973 21.7460 54.8340 Constraint 414 707 9.9079 12.3849 18.5773 54.6341 Constraint 385 608 11.4893 14.3617 21.5425 53.9999 Constraint 17 422 8.5734 10.7168 16.0752 53.9999 Constraint 153 237 10.7569 13.4461 20.1692 53.9998 Constraint 39 486 11.6955 14.6194 21.9291 53.9994 Constraint 17 665 8.7955 10.9944 16.4916 52.9999 Constraint 39 138 11.4006 14.2507 21.3761 52.9999 Constraint 303 635 11.4687 14.3359 21.5038 52.9997 Constraint 74 486 11.5935 14.4919 21.7379 52.9997 Constraint 82 303 11.0142 13.7677 20.6516 52.9997 Constraint 106 336 10.7411 13.4263 20.1395 52.9995 Constraint 362 608 11.2053 14.0066 21.0099 52.7548 Constraint 182 533 8.2097 10.2621 15.3932 52.6684 Constraint 393 707 9.8088 12.2610 18.3915 52.6340 Constraint 170 579 9.6998 12.1247 18.1870 52.0000 Constraint 113 343 9.7030 12.1287 18.1931 51.9997 Constraint 182 486 8.8845 11.1056 16.6585 51.6684 Constraint 182 431 10.8627 13.5784 20.3675 51.6684 Constraint 303 374 11.0721 13.8401 20.7602 51.0000 Constraint 23 650 11.3370 14.1713 21.2569 50.9999 Constraint 153 459 11.1481 13.9351 20.9027 50.9998 Constraint 146 486 11.4358 14.2948 21.4422 50.9998 Constraint 146 563 11.3843 14.2303 21.3455 50.9998 Constraint 244 414 10.7645 13.4556 20.1834 50.9576 Constraint 289 352 11.7805 14.7256 22.0884 50.9571 Constraint 170 563 9.4719 11.8398 17.7597 50.6685 Constraint 182 542 8.1608 10.2010 15.3014 50.6684 Constraint 331 459 11.5427 14.4284 21.6426 50.2997 Constraint 563 650 11.4069 14.2587 21.3880 50.0535 Constraint 50 608 11.3858 14.2322 21.3484 49.9999 Constraint 106 319 9.2430 11.5538 17.3307 49.9998 Constraint 113 352 9.3413 11.6766 17.5149 49.9997 Constraint 161 692 10.4114 13.0142 19.5213 49.9993 Constraint 237 478 10.1549 12.6936 19.0404 49.9576 Constraint 244 447 10.2928 12.8660 19.2990 49.9568 Constraint 525 650 11.4441 14.3051 21.4577 49.6985 Constraint 325 619 11.1935 13.9919 20.9878 49.2576 Constraint 170 572 9.2263 11.5328 17.2993 49.0000 Constraint 17 658 10.2740 12.8425 19.2638 48.9999 Constraint 17 692 6.6027 8.2534 12.3800 48.9999 Constraint 74 289 11.6636 14.5795 21.8692 48.9998 Constraint 89 556 11.2351 14.0439 21.0659 48.9994 Constraint 182 556 10.2817 12.8522 19.2783 48.6684 Constraint 228 422 9.8725 12.3406 18.5109 48.4726 Constraint 254 642 11.8140 14.7675 22.1513 48.4502 Constraint 39 295 11.2448 14.0560 21.0840 47.9999 Constraint 153 681 11.5723 14.4653 21.6980 47.9998 Constraint 244 556 11.0297 13.7871 20.6806 47.9994 Constraint 422 707 9.8865 12.3582 18.5373 47.6341 Constraint 170 447 11.1784 13.9730 20.9596 46.9999 Constraint 170 452 10.1527 12.6908 19.0363 45.9999 Constraint 289 362 11.5188 14.3985 21.5978 45.4548 Constraint 422 518 11.4748 14.3435 21.5153 45.1999 Constraint 23 374 10.4910 13.1138 19.6707 44.9999 Constraint 98 310 10.2640 12.8300 19.2451 44.9998 Constraint 431 598 11.4884 14.3605 21.5407 44.9959 Constraint 422 572 11.5083 14.3854 21.5781 44.9959 Constraint 237 542 10.0422 12.5528 18.8292 44.6684 Constraint 228 494 9.5932 11.9915 17.9872 44.6384 Constraint 325 608 11.3510 14.1888 21.2832 44.5892 Constraint 50 126 11.6498 14.5622 21.8433 43.9999 Constraint 113 628 10.2165 12.7706 19.1559 43.9997 Constraint 58 471 11.6359 14.5448 21.8172 43.9994 Constraint 153 692 10.9574 13.6968 20.5452 43.9993 Constraint 352 619 11.3371 14.1714 21.2571 43.7548 Constraint 170 471 10.9292 13.6615 20.4923 43.0000 Constraint 17 393 10.1604 12.7005 19.0507 42.9999 Constraint 126 471 11.2819 14.1024 21.1536 42.9998 Constraint 82 295 11.4874 14.3592 21.5388 42.9997 Constraint 106 598 10.2540 12.8175 19.2262 42.9993 Constraint 161 494 11.1626 13.9532 20.9298 42.9952 Constraint 161 439 11.5043 14.3803 21.5705 42.9951 Constraint 542 635 11.2441 14.0551 21.0826 42.9536 Constraint 194 525 7.7221 9.6526 14.4790 42.8342 Constraint 138 628 11.1492 13.9365 20.9048 42.8341 Constraint 138 563 11.4436 14.3045 21.4568 42.8299 Constraint 23 447 11.1731 13.9664 20.9496 41.9999 Constraint 23 431 11.1937 13.9922 20.9883 41.9999 Constraint 170 673 9.6995 12.1244 18.1866 41.9996 Constraint 106 352 10.3419 12.9274 19.3910 41.9995 Constraint 374 452 11.1555 13.9444 20.9165 41.9994 Constraint 106 579 10.4059 13.0074 19.5111 41.9994 Constraint 138 459 11.0824 13.8531 20.7796 41.8340 Constraint 74 310 11.4757 14.3446 21.5169 40.9998 Constraint 74 556 11.5446 14.4307 21.6461 40.9997 Constraint 194 422 10.0939 12.6174 18.9261 40.8341 Constraint 289 551 11.4272 14.2840 21.4260 40.2534 Constraint 194 262 8.3327 10.4159 15.6238 39.8341 Constraint 170 402 10.2602 12.8252 19.2378 39.6682 Constraint 352 642 11.4725 14.3406 21.5110 39.2575 Constraint 23 385 11.1611 13.9514 20.9271 38.9999 Constraint 194 518 7.6266 9.5333 14.2999 38.9999 Constraint 194 507 8.9423 11.1779 16.7668 38.9999 Constraint 98 295 10.5209 13.1511 19.7267 38.9999 Constraint 507 635 11.6049 14.5062 21.7592 38.9998 Constraint 113 598 9.0350 11.2937 16.9406 38.9993 Constraint 161 673 11.6202 14.5253 21.7879 38.9952 Constraint 138 447 11.4758 14.3447 21.5171 38.8340 Constraint 325 587 11.3866 14.2332 21.3498 38.7544 Constraint 98 385 10.8877 13.6097 20.4145 37.9999 Constraint 194 494 9.5267 11.9083 17.8625 37.8342 Constraint 319 393 11.0269 13.7836 20.6755 37.7506 Constraint 237 533 10.4480 13.0601 19.5901 37.6684 Constraint 194 486 10.0562 12.5703 18.8554 36.9999 Constraint 182 439 10.9291 13.6613 20.4920 36.6684 Constraint 237 692 10.0374 12.5468 18.8202 36.2891 Constraint 170 587 11.3611 14.2014 21.3020 36.0000 Constraint 273 642 11.7021 14.6277 21.9415 35.9999 Constraint 194 551 9.4925 11.8657 17.7985 35.9999 Constraint 494 681 11.5150 14.3938 21.5906 35.9999 Constraint 113 362 10.4384 13.0480 19.5720 35.9998 Constraint 153 478 11.3244 14.1555 21.2332 35.9997 Constraint 244 692 9.9650 12.4563 18.6844 35.9994 Constraint 138 673 11.8134 14.7667 22.1501 35.9959 Constraint 262 572 11.7182 14.6478 21.9717 35.9958 Constraint 439 518 11.6576 14.5720 21.8580 35.1998 Constraint 106 343 11.1784 13.9730 20.9595 34.9999 Constraint 9 681 6.7716 8.4645 12.6968 34.9999 Constraint 182 478 10.0584 12.5730 18.8595 34.9998 Constraint 170 665 10.4715 13.0894 19.6340 34.9998 Constraint 362 459 11.4014 14.2517 21.3776 34.7547 Constraint 182 280 10.5568 13.1960 19.7940 34.6684 Constraint 303 556 11.2548 14.0685 21.1027 34.4984 Constraint 262 533 11.2309 14.0386 21.0579 34.2533 Constraint 9 673 8.1207 10.1509 15.2263 33.9999 Constraint 280 673 11.7271 14.6589 21.9884 33.9536 Constraint 422 542 11.0517 13.8146 20.7219 33.9535 Constraint 194 542 9.9528 12.4410 18.6616 33.8342 Constraint 113 289 10.8132 13.5166 20.2748 32.9999 Constraint 89 153 11.5655 14.4569 21.6853 32.9999 Constraint 161 452 11.4155 14.2694 21.4040 32.9998 Constraint 170 692 9.5110 11.8887 17.8331 32.9998 Constraint 89 374 10.1887 12.7358 19.1038 32.9996 Constraint 113 556 9.8381 12.2977 18.4465 32.9995 Constraint 414 525 11.3745 14.2181 21.3272 32.7984 Constraint 447 525 11.2660 14.0825 21.1237 32.7980 Constraint 447 518 11.6091 14.5114 21.7671 32.1994 Constraint 23 707 9.0565 11.3206 16.9809 31.9999 Constraint 295 692 10.7039 13.3799 20.0699 31.9999 Constraint 39 352 11.2061 14.0076 21.0114 31.9998 Constraint 182 563 10.9601 13.7001 20.5502 31.6684 Constraint 9 665 9.3045 11.6306 17.4459 31.0000 Constraint 374 692 10.8023 13.5028 20.2542 31.0000 Constraint 228 518 8.5845 10.7306 16.0959 30.9999 Constraint 17 262 10.8975 13.6219 20.4328 30.9999 Constraint 228 525 9.0186 11.2732 16.9098 30.9999 Constraint 82 587 11.4750 14.3438 21.5157 30.9998 Constraint 244 471 10.5956 13.2445 19.8668 30.1231 Constraint 50 331 11.5409 14.4261 21.6392 30.0000 Constraint 194 431 10.7556 13.4444 20.1667 30.0000 Constraint 9 422 10.5705 13.2132 19.8197 29.9999 Constraint 9 414 9.6725 12.0906 18.1359 29.9999 Constraint 161 228 9.6939 12.1174 18.1761 29.9999 Constraint 494 692 9.5715 11.9644 17.9466 29.9994 Constraint 161 650 11.6731 14.5914 21.8871 29.9994 Constraint 98 598 10.5391 13.1739 19.7609 29.9994 Constraint 194 280 9.3642 11.7052 17.5578 29.8342 Constraint 194 533 9.3138 11.6422 17.4633 29.8342 Constraint 228 507 9.2350 11.5438 17.3157 28.9999 Constraint 9 692 8.1849 10.2311 15.3467 28.9999 Constraint 220 422 9.1503 11.4379 17.1568 28.9876 Constraint 170 289 11.0516 13.8145 20.7217 28.6683 Constraint 244 452 10.6645 13.3307 19.9960 28.6683 Constraint 228 486 9.9379 12.4223 18.6335 28.6383 Constraint 402 707 10.2140 12.7675 19.1512 28.6382 Constraint 280 533 11.3926 14.2408 21.3612 28.2535 Constraint 17 707 8.4092 10.5115 15.7672 28.0000 Constraint 374 447 11.8278 14.7847 22.1771 27.9999 Constraint 439 608 11.3193 14.1492 21.2237 27.9999 Constraint 89 431 11.7244 14.6554 21.9832 27.9995 Constraint 237 414 10.5780 13.2225 19.8337 27.9577 Constraint 237 665 11.3386 14.1733 21.2599 27.9576 Constraint 244 665 10.3872 12.9840 19.4760 27.9575 Constraint 262 478 11.6192 14.5240 21.7859 27.7546 Constraint 303 650 11.6002 14.5003 21.7504 27.0958 Constraint 478 598 11.6468 14.5585 21.8377 26.9999 Constraint 58 572 11.6385 14.5481 21.8221 26.9999 Constraint 74 471 11.2125 14.0156 21.0234 26.9999 Constraint 303 587 11.5757 14.4696 21.7044 26.9999 Constraint 170 681 11.0026 13.7532 20.6298 26.9998 Constraint 74 254 11.6917 14.6146 21.9219 26.9998 Constraint 58 692 11.0518 13.8148 20.7222 26.9993 Constraint 422 716 10.0038 12.5048 18.7571 26.8313 Constraint 393 716 8.9446 11.1808 16.7711 26.3163 Constraint 385 459 11.5799 14.4748 21.7122 26.2998 Constraint 182 572 11.0847 13.8559 20.7838 26.0000 Constraint 58 303 11.5557 14.4447 21.6670 25.9999 Constraint 106 310 10.3918 12.9897 19.4846 25.9999 Constraint 89 563 11.3197 14.1496 21.2244 25.9995 Constraint 126 525 11.0972 13.8715 20.8073 25.9958 Constraint 422 556 11.4907 14.3634 21.5451 25.9536 Constraint 220 494 10.7217 13.4021 20.1031 25.6685 Constraint 447 692 11.4992 14.3740 21.5610 25.4544 Constraint 65 295 11.6179 14.5224 21.7835 24.9999 Constraint 65 273 11.7399 14.6749 22.0124 24.9999 Constraint 113 563 10.0359 12.5448 18.8172 24.9995 Constraint 113 385 11.2585 14.0731 21.1096 24.0000 Constraint 289 650 11.8827 14.8534 22.2801 24.0000 Constraint 228 551 10.4248 13.0310 19.5465 23.9999 Constraint 9 393 9.2069 11.5086 17.2629 23.9999 Constraint 65 572 11.6716 14.5895 21.8842 23.9999 Constraint 23 273 11.6332 14.5415 21.8122 23.9999 Constraint 39 343 11.4038 14.2548 21.3822 23.9999 Constraint 273 608 11.6928 14.6160 21.9240 23.9999 Constraint 486 692 10.9584 13.6980 20.5470 23.9994 Constraint 254 598 11.5433 14.4291 21.6437 23.9959 Constraint 262 707 10.6581 13.3226 19.9839 23.6342 Constraint 182 471 11.3343 14.1679 21.2518 22.9999 Constraint 98 642 11.1918 13.9897 20.9846 22.9996 Constraint 113 572 10.2396 12.7995 19.1992 22.9995 Constraint 39 254 11.7794 14.7243 22.0865 22.9995 Constraint 319 402 11.1496 13.9369 20.9054 22.7508 Constraint 220 525 8.7184 10.8980 16.3471 22.6685 Constraint 352 665 11.4076 14.2595 21.3892 22.5549 Constraint 414 507 11.5385 14.4231 21.6347 22.4549 Constraint 9 439 10.6639 13.3298 19.9948 22.0000 Constraint 58 551 11.5102 14.3878 21.5816 21.9999 Constraint 50 494 11.8157 14.7696 22.1544 21.9999 Constraint 50 352 11.2848 14.1060 21.1590 21.9998 Constraint 32 707 10.5812 13.2266 19.8398 21.9998 Constraint 343 681 11.5800 14.4750 21.7125 21.9997 Constraint 414 716 8.8277 11.0346 16.5519 21.3163 Constraint 336 459 11.4290 14.2862 21.4293 21.2998 Constraint 331 402 11.3590 14.1987 21.2981 21.2994 Constraint 153 374 11.5689 14.4611 21.6917 21.0000 Constraint 220 518 9.2125 11.5157 17.2735 21.0000 Constraint 98 650 11.3092 14.1364 21.2047 21.0000 Constraint 39 707 10.4335 13.0419 19.5629 20.9998 Constraint 310 374 10.7039 13.3798 20.0697 20.9995 Constraint 39 459 11.8116 14.7646 22.1468 20.9994 Constraint 194 273 10.7310 13.4137 20.1206 20.8342 Constraint 211 280 9.4749 11.8436 17.7655 20.8342 Constraint 362 673 11.5582 14.4477 21.6716 20.5548 Constraint 228 439 9.6182 12.0227 18.0341 20.4726 Constraint 211 525 8.6072 10.7590 16.1385 20.0000 Constraint 194 556 10.0215 12.5268 18.7903 20.0000 Constraint 32 471 11.4346 14.2932 21.4398 20.0000 Constraint 17 431 10.4967 13.1209 19.6813 20.0000 Constraint 89 310 10.8953 13.6191 20.4287 19.9999 Constraint 211 518 8.9045 11.1306 16.6959 19.9999 Constraint 289 692 10.6803 13.3504 20.0257 19.9999 Constraint 220 692 9.7502 12.1878 18.2817 19.9877 Constraint 237 447 10.8453 13.5566 20.3349 19.8342 Constraint 478 556 11.1870 13.9837 20.9756 19.8026 Constraint 303 431 11.5393 14.4241 21.6362 19.7986 Constraint 362 447 11.5009 14.3761 21.5641 19.7548 Constraint 9 374 8.7110 10.8887 16.3330 19.0000 Constraint 17 716 9.5712 11.9639 17.9459 19.0000 Constraint 113 452 10.7252 13.4065 20.1098 18.9999 Constraint 65 393 11.3125 14.1406 21.2108 18.9999 Constraint 471 619 10.9921 13.7401 20.6102 18.9998 Constraint 182 673 11.0292 13.7865 20.6797 18.6684 Constraint 385 556 11.7974 14.7467 22.1201 18.2998 Constraint 295 551 11.0246 13.7808 20.6712 18.2533 Constraint 244 658 9.5416 11.9270 17.8905 18.1233 Constraint 289 374 11.3404 14.1755 21.2632 18.0000 Constraint 9 658 9.9437 12.4296 18.6444 18.0000 Constraint 17 494 10.9524 13.6906 20.5358 18.0000 Constraint 374 579 11.4695 14.3368 21.5052 18.0000 Constraint 17 374 11.1996 13.9995 20.9992 18.0000 Constraint 32 362 11.4756 14.3445 21.5167 17.9999 Constraint 39 716 10.1755 12.7194 19.0791 17.9999 Constraint 228 542 10.1775 12.7219 19.0828 17.9999 Constraint 273 587 11.6538 14.5673 21.8509 17.9999 Constraint 138 692 11.2863 14.1079 21.1619 17.9999 Constraint 336 486 11.3152 14.1439 21.2159 17.7986 Constraint 273 707 10.5852 13.2315 19.8473 17.6342 Constraint 228 673 8.8154 11.0192 16.5289 17.4726 Constraint 486 681 11.5486 14.4358 21.6537 17.4549 Constraint 295 556 11.2200 14.0251 21.0376 17.2997 Constraint 336 439 11.4585 14.3232 21.4848 17.2958 Constraint 32 459 11.5478 14.4347 21.6520 17.0000 Constraint 146 244 11.2479 14.0598 21.0897 17.0000 Constraint 98 374 10.7856 13.4820 20.2229 17.0000 Constraint 153 220 10.1807 12.7259 19.0888 16.9999 Constraint 74 402 11.6761 14.5951 21.8927 16.9999 Constraint 153 642 11.7582 14.6977 22.0466 16.9998 Constraint 402 716 9.3592 11.6990 17.5484 16.9998 Constraint 146 518 11.4365 14.2956 21.4434 16.9997 Constraint 325 431 11.5757 14.4696 21.7044 16.9577 Constraint 336 572 11.0991 13.8738 20.8108 16.7984 Constraint 439 707 9.4184 11.7730 17.6596 16.6342 Constraint 228 431 10.1919 12.7399 19.1098 16.4726 Constraint 273 716 10.9300 13.6625 20.4937 16.3177 Constraint 494 563 10.0531 12.5664 18.8497 16.2536 Constraint 170 650 11.0481 13.8101 20.7151 16.0000 Constraint 74 681 11.6689 14.5862 21.8792 16.0000 Constraint 9 385 10.1927 12.7409 19.1113 16.0000 Constraint 211 422 8.3574 10.4468 15.6702 15.9999 Constraint 113 459 10.1780 12.7225 19.0838 15.9999 Constraint 170 393 11.4147 14.2684 21.4026 15.9999 Constraint 542 658 10.8053 13.5066 20.2600 15.9536 Constraint 146 608 11.2802 14.1003 21.1504 15.8341 Constraint 138 542 11.2545 14.0681 21.1022 15.8300 Constraint 138 533 11.2250 14.0312 21.0468 15.8300 Constraint 280 518 11.4101 14.2626 21.3939 15.1998 Constraint 211 507 10.0953 12.6192 18.9287 15.0000 Constraint 237 572 11.2771 14.0963 21.1445 15.0000 Constraint 89 273 11.8457 14.8072 22.2107 15.0000 Constraint 17 447 11.0188 13.7735 20.6603 15.0000 Constraint 23 716 8.9798 11.2248 16.8372 15.0000 Constraint 237 681 10.9055 13.6319 20.4478 14.9577 Constraint 202 280 8.4875 10.6094 15.9141 14.8342 Constraint 211 402 10.2970 12.8712 19.3068 14.8342 Constraint 343 431 11.2613 14.0767 21.1150 14.7987 Constraint 385 707 10.3868 12.9835 19.4752 14.6381 Constraint 525 665 11.2682 14.0852 21.1278 14.5986 Constraint 220 402 10.4803 13.1004 19.6506 14.5027 Constraint 58 146 11.7694 14.7118 22.0677 14.0000 Constraint 244 402 11.3346 14.1683 21.2524 14.0000 Constraint 220 507 9.6554 12.0693 18.1039 14.0000 Constraint 202 518 9.5593 11.9491 17.9237 13.9999 Constraint 431 628 11.7365 14.6706 22.0059 13.9999 Constraint 194 692 10.0463 12.5578 18.8367 13.9999 Constraint 262 716 10.6847 13.3559 20.0338 13.9998 Constraint 106 362 11.1726 13.9658 20.9486 13.9996 Constraint 244 650 10.4926 13.1157 19.6736 13.6684 Constraint 228 478 9.4928 11.8659 17.7989 13.6384 Constraint 289 681 11.4762 14.3453 21.5179 13.4549 Constraint 244 681 10.7306 13.4133 20.1200 13.2891 Constraint 50 138 11.8018 14.7522 22.1283 13.0000 Constraint 211 494 10.0686 12.5857 18.8786 13.0000 Constraint 65 681 11.3440 14.1801 21.2701 13.0000 Constraint 228 533 9.4436 11.8045 17.7068 13.0000 Constraint 220 551 9.6965 12.1207 18.1810 13.0000 Constraint 17 273 11.0839 13.8549 20.7823 13.0000 Constraint 17 237 10.0265 12.5331 18.7997 13.0000 Constraint 113 551 10.8161 13.5202 20.2803 12.9999 Constraint 153 362 11.6982 14.6227 21.9341 12.9998 Constraint 273 542 11.1933 13.9917 20.9875 12.9536 Constraint 431 707 10.4181 13.0227 19.5340 12.6342 Constraint 228 692 9.3077 11.6346 17.4519 12.4726 Constraint 146 374 11.6134 14.5167 21.7751 12.0000 Constraint 211 551 9.9215 12.4019 18.6028 12.0000 Constraint 211 533 9.4375 11.7969 17.6953 12.0000 Constraint 237 402 11.6874 14.6092 21.9139 12.0000 Constraint 194 439 10.1493 12.6867 19.0300 12.0000 Constraint 244 572 10.2017 12.7522 19.1283 11.9999 Constraint 17 402 11.3805 14.2256 21.3384 11.9999 Constraint 23 494 11.4306 14.2883 21.4324 11.9999 Constraint 23 262 11.4657 14.3322 21.4982 11.9999 Constraint 237 471 11.3302 14.1627 21.2440 11.9999 Constraint 98 459 10.2587 12.8233 19.2350 11.9999 Constraint 336 692 11.3912 14.2389 21.3584 11.9999 Constraint 138 507 11.5374 14.4218 21.6326 11.9999 Constraint 161 563 11.3708 14.2135 21.3203 11.9999 Constraint 161 572 11.5676 14.4596 21.6893 11.9998 Constraint 280 452 11.7057 14.6322 21.9483 11.9998 Constraint 161 681 11.5462 14.4328 21.6492 11.9994 Constraint 220 673 9.0494 11.3117 16.9676 11.9877 Constraint 146 362 11.0455 13.8069 20.7104 11.8343 Constraint 138 619 11.5949 14.4936 21.7405 11.8342 Constraint 202 422 8.3395 10.4244 15.6366 11.8342 Constraint 202 525 8.8186 11.0233 16.5350 11.8342 Constraint 228 447 10.9175 13.6469 20.4703 11.6384 Constraint 325 665 11.7830 14.7288 22.0932 11.6028 Constraint 220 431 10.4418 13.0523 19.5784 11.5027 Constraint 402 525 11.3710 14.2138 21.3207 11.4986 Constraint 439 556 11.3152 14.1440 21.2159 11.4509 Constraint 385 716 10.1832 12.7290 19.0934 11.3190 Constraint 336 447 11.2381 14.0477 21.0715 11.2999 Constraint 393 723 8.7277 10.9096 16.3644 11.0986 Constraint 211 431 10.3117 12.8896 19.3345 11.0000 Constraint 50 579 11.8111 14.7639 22.1459 11.0000 Constraint 211 486 10.4026 13.0033 19.5049 11.0000 Constraint 220 533 9.6926 12.1158 18.1736 11.0000 Constraint 237 556 9.9463 12.4328 18.6492 11.0000 Constraint 153 228 10.3648 12.9560 19.4340 11.0000 Constraint 113 650 10.7140 13.3924 20.0887 10.9999 Constraint 211 673 9.7381 12.1726 18.2589 10.9999 Constraint 211 692 7.6632 9.5790 14.3686 10.9999 Constraint 211 414 9.7961 12.2451 18.3677 10.9999 Constraint 220 414 9.6282 12.0353 18.0529 10.9877 Constraint 336 525 10.9421 13.6776 20.5164 10.7985 Constraint 295 525 11.2384 14.0480 21.0720 10.7985 Constraint 471 673 11.3802 14.2253 21.3379 10.5549 Constraint 414 556 11.7444 14.6805 22.0208 10.4549 Constraint 325 556 11.2985 14.1232 21.1847 10.2576 Constraint 331 658 11.6674 14.5843 21.8765 10.1000 Constraint 556 665 11.6932 14.6165 21.9247 10.0999 Constraint 422 723 9.5133 11.8917 17.8375 10.0986 Constraint 414 723 9.7233 12.1541 18.2312 10.0986 Constraint 211 556 10.8852 13.6064 20.4097 10.0000 Constraint 39 331 11.1745 13.9682 20.9522 10.0000 Constraint 9 402 11.6987 14.6234 21.9351 10.0000 Constraint 3 681 7.2299 9.0374 13.5561 10.0000 Constraint 3 673 9.4956 11.8696 17.8043 10.0000 Constraint 32 716 8.5975 10.7469 16.1203 10.0000 Constraint 32 244 9.7149 12.1436 18.2154 9.9999 Constraint 39 494 11.6462 14.5578 21.8367 9.9999 Constraint 106 459 11.1909 13.9887 20.9830 9.9999 Constraint 89 471 10.3383 12.9228 19.3842 9.9999 Constraint 126 439 11.6108 14.5135 21.7702 9.9959 Constraint 202 431 10.6201 13.2751 19.9126 9.8342 Constraint 331 572 11.1880 13.9849 20.9774 9.7548 Constraint 331 556 10.9147 13.6434 20.4651 9.7548 Constraint 220 486 9.9058 12.3823 18.5734 9.6685 Constraint 336 673 11.4470 14.3088 21.4632 9.6027 Constraint 343 579 11.7218 14.6523 21.9785 9.2959 Constraint 331 551 10.8053 13.5066 20.2599 9.2576 Constraint 146 211 10.7575 13.4468 20.1703 9.0000 Constraint 9 650 11.5356 14.4195 21.6293 9.0000 Constraint 211 542 10.0286 12.5357 18.8036 9.0000 Constraint 182 692 10.9591 13.6989 20.5483 9.0000 Constraint 9 707 7.7771 9.7214 14.5820 9.0000 Constraint 374 619 11.3633 14.2041 21.3062 9.0000 Constraint 374 459 10.8301 13.5376 20.3065 9.0000 Constraint 39 126 11.8903 14.8629 22.2944 9.0000 Constraint 194 478 9.4962 11.8702 17.8054 9.0000 Constraint 194 414 10.5735 13.2169 19.8254 9.0000 Constraint 447 587 11.9299 14.9124 22.3686 9.0000 Constraint 393 642 11.7648 14.7060 22.0590 9.0000 Constraint 17 385 11.0257 13.7821 20.6731 9.0000 Constraint 98 452 11.5114 14.3892 21.5838 9.0000 Constraint 161 587 11.5702 14.4628 21.6942 9.0000 Constraint 194 673 10.3537 12.9421 19.4131 8.9999 Constraint 50 692 11.2844 14.1055 21.1582 8.9999 Constraint 211 393 11.4173 14.2717 21.4075 8.9999 Constraint 194 402 9.1481 11.4351 17.1526 8.9999 Constraint 89 551 11.7908 14.7384 22.1077 8.9999 Constraint 146 542 11.0133 13.7666 20.6499 8.9998 Constraint 533 608 11.8314 14.7892 22.1838 8.9994 Constraint 220 439 10.0819 12.6024 18.9036 8.9877 Constraint 237 658 11.1936 13.9920 20.9881 8.8342 Constraint 138 471 11.1582 13.9477 20.9216 8.8341 Constraint 220 665 10.5613 13.2016 19.8024 8.5027 Constraint 447 533 11.7140 14.6425 21.9638 8.4986 Constraint 303 551 11.6201 14.5252 21.7877 8.4986 Constraint 228 665 9.4149 11.7686 17.6529 8.4727 Constraint 228 414 9.1720 11.4651 17.1976 8.4727 Constraint 439 716 8.2834 10.3542 15.5313 8.3165 Constraint 295 452 11.1664 13.9580 20.9369 8.2998 Constraint 228 556 11.1784 13.9730 20.9594 8.0000 Constraint 211 439 10.6123 13.2654 19.8980 8.0000 Constraint 50 572 11.4450 14.3062 21.4594 8.0000 Constraint 50 254 11.8012 14.7515 22.1272 8.0000 Constraint 220 556 10.6872 13.3590 20.0385 8.0000 Constraint 182 447 10.5419 13.1774 19.7661 8.0000 Constraint 202 507 10.4052 13.0066 19.5098 8.0000 Constraint 32 723 9.7818 12.2272 18.3408 8.0000 Constraint 106 556 11.0902 13.8627 20.7941 8.0000 Constraint 244 579 9.8644 12.3305 18.4957 8.0000 Constraint 244 563 11.5152 14.3940 21.5910 8.0000 Constraint 3 414 10.3207 12.9009 19.3514 8.0000 Constraint 3 393 9.4102 11.7627 17.6440 8.0000 Constraint 211 665 11.1447 13.9309 20.8963 7.9999 Constraint 202 692 6.8483 8.5604 12.8406 7.9999 Constraint 202 673 9.1503 11.4379 17.1569 7.9999 Constraint 262 723 10.9208 13.6510 20.4764 7.9986 Constraint 126 542 10.9714 13.7143 20.5715 7.9958 Constraint 220 681 9.3248 11.6559 17.4839 7.9877 Constraint 551 619 11.3119 14.1399 21.2099 7.9537 Constraint 202 273 8.2669 10.3336 15.5004 7.8342 Constraint 202 533 10.2467 12.8084 19.2126 7.8342 Constraint 182 273 10.5067 13.1334 19.7001 7.6685 Constraint 447 707 10.8088 13.5111 20.2666 7.6344 Constraint 228 681 8.4792 10.5990 15.8985 7.4727 Constraint 228 658 10.1773 12.7217 19.0825 7.4727 Constraint 362 439 11.6533 14.5666 21.8499 7.4548 Constraint 280 507 10.7941 13.4927 20.2390 7.4548 Constraint 542 665 10.7406 13.4258 20.1387 7.4508 Constraint 431 716 9.8377 12.2971 18.4456 7.3165 Constraint 273 533 11.3868 14.2335 21.3503 7.2537 Constraint 295 673 11.8131 14.7664 22.1495 7.0577 Constraint 194 563 11.2718 14.0898 21.1346 7.0000 Constraint 113 374 11.2653 14.0816 21.1224 7.0000 Constraint 17 723 8.8469 11.0587 16.5880 7.0000 Constraint 202 494 9.9904 12.4880 18.7320 7.0000 Constraint 23 723 8.6323 10.7904 16.1856 7.0000 Constraint 17 650 11.8160 14.7700 22.1550 7.0000 Constraint 17 486 11.3853 14.2317 21.3475 7.0000 Constraint 17 254 11.2139 14.0174 21.0261 7.0000 Constraint 220 542 9.2551 11.5689 17.3534 7.0000 Constraint 113 642 10.9813 13.7267 20.5900 7.0000 Constraint 9 362 11.5333 14.4167 21.6250 7.0000 Constraint 98 556 11.6664 14.5831 21.8746 7.0000 Constraint 402 723 8.5433 10.6791 16.0186 7.0000 Constraint 3 692 7.2377 9.0471 13.5707 7.0000 Constraint 82 598 11.2597 14.0747 21.1120 6.9999 Constraint 211 681 9.7702 12.2127 18.3191 6.9999 Constraint 202 681 9.2562 11.5702 17.3553 6.9999 Constraint 202 542 11.2424 14.0530 21.0795 6.9999 Constraint 374 707 11.7299 14.6624 21.9936 6.9998 Constraint 280 716 11.1538 13.9423 20.9134 6.9998 Constraint 325 551 11.2924 14.1155 21.1733 6.9576 Constraint 439 533 11.4614 14.3268 21.4902 6.9537 Constraint 422 533 11.1754 13.9693 20.9539 6.9537 Constraint 202 551 10.1360 12.6701 19.0051 6.8343 Constraint 202 289 10.0170 12.5213 18.7819 6.8343 Constraint 202 414 8.2867 10.3583 15.5375 6.8342 Constraint 202 402 7.4910 9.3638 14.0457 6.8342 Constraint 182 414 11.1880 13.9850 20.9775 6.6685 Constraint 295 707 10.7503 13.4379 20.1569 6.6383 Constraint 374 608 11.4493 14.3116 21.4674 6.0000 Constraint 194 289 9.7860 12.2325 18.3488 6.0000 Constraint 146 692 11.8548 14.8185 22.2278 6.0000 Constraint 138 202 11.6292 14.5365 21.8048 6.0000 Constraint 58 289 11.7610 14.7012 22.0518 6.0000 Constraint 182 452 9.9972 12.4964 18.7447 6.0000 Constraint 194 471 11.7893 14.7367 22.1050 6.0000 Constraint 237 579 11.4106 14.2632 21.3948 6.0000 Constraint 237 563 11.0251 13.7814 20.6721 6.0000 Constraint 3 665 9.9055 12.3819 18.5728 6.0000 Constraint 202 486 11.0546 13.8182 20.7273 6.0000 Constraint 507 692 11.8620 14.8275 22.2412 6.0000 Constraint 39 244 11.8079 14.7599 22.1399 6.0000 Constraint 325 452 11.2241 14.0301 21.0452 6.0000 Constraint 202 665 10.1503 12.6879 19.0318 6.0000 Constraint 202 439 11.2335 14.0418 21.0627 6.0000 Constraint 202 393 9.4790 11.8487 17.7731 6.0000 Constraint 244 716 11.1720 13.9650 20.9475 6.0000 Constraint 39 723 8.8413 11.0516 16.5774 6.0000 Constraint 459 533 11.5699 14.4624 21.6936 5.9999 Constraint 113 533 11.8086 14.7607 22.1411 5.9999 Constraint 58 478 10.9881 13.7352 20.6028 5.9999 Constraint 39 478 11.5802 14.4753 21.7129 5.9999 Constraint 273 471 11.1525 13.9406 20.9109 5.9999 Constraint 273 459 11.3314 14.1642 21.2464 5.9999 Constraint 262 471 11.3864 14.2330 21.3495 5.9999 Constraint 161 471 11.3929 14.2412 21.3618 5.9999 Constraint 113 471 11.3482 14.1852 21.2779 5.9999 Constraint 82 310 9.6473 12.0592 18.0888 5.9999 Constraint 343 692 11.7416 14.6770 22.0156 5.9999 Constraint 385 572 11.2547 14.0684 21.1026 5.9999 Constraint 146 507 11.0146 13.7683 20.6524 5.9999 Constraint 106 572 11.3886 14.2357 21.3536 5.9998 Constraint 422 642 11.9146 14.8933 22.3399 5.9995 Constraint 402 551 11.7557 14.6946 22.0420 5.9960 Constraint 126 422 11.2449 14.0561 21.0841 5.9959 Constraint 211 289 11.0028 13.7535 20.6302 5.8343 Constraint 237 707 10.1271 12.6589 18.9883 5.8341 Constraint 385 525 11.3199 14.1499 21.2248 5.8027 Constraint 220 393 10.9673 13.7091 20.5636 5.6685 Constraint 220 707 11.1481 13.9351 20.9026 5.6684 Constraint 525 673 11.3900 14.2375 21.3562 5.5987 Constraint 343 716 11.1317 13.9146 20.8720 5.4848 Constraint 447 619 11.9110 14.8887 22.3331 5.4549 Constraint 362 716 10.4512 13.0641 19.5961 5.3192 Constraint 273 518 11.6914 14.6142 21.9213 5.1999 Constraint 228 707 9.8795 12.3494 18.5241 5.1534 Constraint 439 723 8.0571 10.0714 15.1071 5.0987 Constraint 237 452 11.1537 13.9421 20.9131 5.0000 Constraint 228 471 11.6993 14.6242 21.9363 5.0000 Constraint 98 572 11.4701 14.3377 21.5065 5.0000 Constraint 194 447 10.9389 13.6736 20.5104 5.0000 Constraint 146 237 10.6941 13.3677 20.0515 5.0000 Constraint 106 642 11.6187 14.5233 21.7850 5.0000 Constraint 106 374 10.7068 13.3834 20.0752 5.0000 Constraint 194 393 10.6703 13.3378 20.0067 5.0000 Constraint 50 716 11.0953 13.8692 20.8038 5.0000 Constraint 106 650 11.2276 14.0345 21.0517 5.0000 Constraint 17 170 10.6527 13.3158 19.9737 4.9999 Constraint 170 707 9.2560 11.5700 17.3550 4.9999 Constraint 202 707 11.5510 14.4388 21.6582 4.9999 Constraint 126 533 10.9640 13.7050 20.5575 4.9959 Constraint 202 556 10.4701 13.0877 19.6315 4.8343 Constraint 254 707 11.0122 13.7653 20.6480 4.6384 Constraint 310 414 11.7094 14.6368 21.9552 4.4550 Constraint 319 414 11.3793 14.2241 21.3362 4.4549 Constraint 362 551 10.2594 12.8242 19.2364 4.4549 Constraint 352 579 11.3241 14.1551 21.2327 4.4549 Constraint 542 673 11.4414 14.3017 21.4526 4.4509 Constraint 486 716 10.8920 13.6150 20.4226 4.3192 Constraint 447 716 8.9483 11.1854 16.7780 4.3192 Constraint 254 716 11.4164 14.2705 21.4058 4.3192 Constraint 325 642 11.2565 14.0706 21.1059 4.1000 Constraint 431 723 10.3920 12.9900 19.4849 4.0987 Constraint 228 563 11.4974 14.3718 21.5577 4.0000 Constraint 202 385 10.7425 13.4281 20.1422 4.0000 Constraint 202 295 11.0466 13.8082 20.7123 4.0000 Constraint 194 295 11.6161 14.5201 21.7802 4.0000 Constraint 146 220 9.9116 12.3895 18.5842 4.0000 Constraint 32 237 10.6134 13.2667 19.9001 4.0000 Constraint 17 478 10.8643 13.5804 20.3706 4.0000 Constraint 3 422 11.4797 14.3496 21.5244 4.0000 Constraint 3 374 8.9390 11.1737 16.7606 4.0000 Constraint 170 658 9.4378 11.7972 17.6959 4.0000 Constraint 170 385 11.0217 13.7771 20.6657 4.0000 Constraint 32 170 11.4281 14.2851 21.4277 4.0000 Constraint 194 572 11.3851 14.2313 21.3470 4.0000 Constraint 113 273 11.3079 14.1348 21.2022 4.0000 Constraint 3 658 11.6395 14.5493 21.8240 4.0000 Constraint 106 452 11.4038 14.2548 21.3822 4.0000 Constraint 3 402 10.8100 13.5125 20.2687 4.0000 Constraint 82 431 11.1491 13.9364 20.9046 3.9999 Constraint 65 422 11.1522 13.9403 20.9105 3.9999 Constraint 494 723 8.6821 10.8526 16.2789 3.9987 Constraint 478 716 10.6691 13.3364 20.0046 3.8342 Constraint 220 289 10.3877 12.9847 19.4770 3.6685 Constraint 182 402 10.2484 12.8106 19.2158 3.6685 Constraint 182 289 10.9713 13.7141 20.5712 3.6685 Constraint 295 716 9.0151 11.2689 16.9034 3.4848 Constraint 336 716 10.4786 13.0982 19.6473 3.3192 Constraint 289 533 11.1684 13.9605 20.9408 3.3000 Constraint 459 525 10.3326 12.9158 19.3737 3.2999 Constraint 343 628 7.0965 8.8706 13.3059 3.2000 Constraint 273 723 9.4126 11.7657 17.6486 3.0987 Constraint 374 716 9.8348 12.2935 18.4402 3.0000 Constraint 211 563 10.4774 13.0967 19.6451 3.0000 Constraint 182 665 11.9644 14.9555 22.4333 3.0000 Constraint 58 716 11.5461 14.4327 21.6490 3.0000 Constraint 58 170 11.8214 14.7768 22.1652 3.0000 Constraint 39 628 11.6583 14.5729 21.8593 3.0000 Constraint 39 153 11.9512 14.9389 22.4084 3.0000 Constraint 32 635 11.9481 14.9352 22.4027 3.0000 Constraint 32 507 11.6737 14.5921 21.8882 3.0000 Constraint 9 716 8.3531 10.4414 15.6621 3.0000 Constraint 9 273 11.9620 14.9525 22.4287 3.0000 Constraint 9 723 9.8646 12.3307 18.4960 3.0000 Constraint 9 447 10.5637 13.2046 19.8069 3.0000 Constraint 507 642 11.4050 14.2562 21.3843 3.0000 Constraint 494 716 8.9273 11.1591 16.7387 3.0000 Constraint 244 723 9.2845 11.6056 17.4085 3.0000 Constraint 182 579 11.6580 14.5725 21.8588 3.0000 Constraint 58 280 11.6960 14.6201 21.9301 3.0000 Constraint 23 642 10.7304 13.4130 20.1195 3.0000 Constraint 98 563 11.6693 14.5867 21.8800 3.0000 Constraint 303 608 11.5795 14.4743 21.7115 3.0000 Constraint 194 658 11.7814 14.7268 22.0902 3.0000 Constraint 402 729 11.4184 14.2730 21.4095 3.0000 Constraint 211 478 10.7173 13.3966 20.0950 3.0000 Constraint 23 362 11.9319 14.9149 22.3723 3.0000 Constraint 551 692 11.5325 14.4156 21.6235 3.0000 Constraint 23 244 10.4744 13.0930 19.6395 3.0000 Constraint 478 587 11.8300 14.7876 22.1813 3.0000 Constraint 393 635 11.5514 14.4392 21.6589 3.0000 Constraint 393 486 11.6306 14.5382 21.8073 3.0000 Constraint 343 642 10.7017 13.3772 20.0657 3.0000 Constraint 343 619 9.7667 12.2084 18.3126 3.0000 Constraint 343 459 11.2807 14.1009 21.1514 3.0000 Constraint 325 459 10.0004 12.5005 18.7507 3.0000 Constraint 319 635 10.9398 13.6748 20.5121 3.0000 Constraint 289 587 10.6449 13.3062 19.9593 3.0000 Constraint 146 598 11.2905 14.1131 21.1697 3.0000 Constraint 146 471 9.6647 12.0808 18.1213 3.0000 Constraint 146 459 11.5695 14.4618 21.6927 3.0000 Constraint 106 385 9.6525 12.0656 18.0985 3.0000 Constraint 106 295 8.7168 10.8960 16.3440 3.0000 Constraint 106 289 9.7938 12.2423 18.3634 3.0000 Constraint 106 273 11.2165 14.0206 21.0309 3.0000 Constraint 89 447 11.4607 14.3259 21.4889 3.0000 Constraint 50 343 11.8691 14.8364 22.2546 3.0000 Constraint 194 665 11.5662 14.4578 21.6867 3.0000 Constraint 551 681 11.9173 14.8966 22.3449 2.9999 Constraint 414 608 11.9902 14.9877 22.4816 2.9999 Constraint 414 572 11.5638 14.4547 21.6821 2.9999 Constraint 385 587 11.8063 14.7579 22.1369 2.9999 Constraint 343 452 11.9779 14.9724 22.4586 2.9999 Constraint 343 422 10.7359 13.4199 20.1298 2.9999 Constraint 303 452 11.1279 13.9099 20.8648 2.9999 Constraint 295 587 11.9538 14.9422 22.4133 2.9999 Constraint 280 439 11.4082 14.2602 21.3903 2.9999 Constraint 262 374 11.7993 14.7491 22.1236 2.9999 Constraint 161 447 11.5471 14.4338 21.6508 2.9999 Constraint 153 310 11.1975 13.9968 20.9953 2.9999 Constraint 146 439 11.5966 14.4958 21.7437 2.9999 Constraint 74 422 10.5121 13.1401 19.7102 2.9999 Constraint 58 494 11.6433 14.5542 21.8312 2.9999 Constraint 563 642 11.5438 14.4298 21.6447 2.9999 Constraint 542 642 10.7048 13.3810 20.0714 2.9999 Constraint 533 650 11.9998 14.9997 22.4996 2.9999 Constraint 533 635 11.3492 14.1865 21.2798 2.9999 Constraint 525 635 10.9115 13.6393 20.4590 2.9999 Constraint 422 635 11.9919 14.9899 22.4848 2.9999 Constraint 362 572 10.8137 13.5171 20.2756 2.9999 Constraint 228 650 11.5080 14.3850 21.5774 2.9999 Constraint 362 692 11.3916 14.2395 21.3593 2.9999 Constraint 280 542 11.5043 14.3804 21.5706 2.9999 Constraint 138 598 11.6632 14.5790 21.8684 2.9999 Constraint 289 716 10.0688 12.5860 18.8790 2.9998 Constraint 161 716 11.5274 14.4093 21.6139 2.9998 Constraint 138 716 11.7168 14.6460 21.9690 2.9998 Constraint 106 563 10.5288 13.1610 19.7414 2.9998 Constraint 280 707 10.1767 12.7208 19.0813 2.9997 Constraint 161 707 10.7867 13.4834 20.2250 2.9997 Constraint 439 563 11.5880 14.4850 21.7274 2.9960 Constraint 414 542 11.7275 14.6593 21.9890 2.9960 Constraint 228 402 10.6723 13.3403 20.0105 2.8342 Constraint 303 525 11.3548 14.1935 21.2902 2.7028 Constraint 486 707 11.2526 14.0658 21.0987 2.6385 Constraint 452 707 11.5605 14.4506 21.6760 2.6385 Constraint 362 707 9.0057 11.2571 16.8856 2.6385 Constraint 336 707 10.2019 12.7524 19.1285 2.6385 Constraint 385 723 9.9635 12.4544 18.6816 2.5850 Constraint 336 723 11.3077 14.1347 21.2020 2.5850 Constraint 343 723 11.1252 13.9065 20.8598 2.4850 Constraint 280 362 11.8134 14.7668 22.1501 2.4550 Constraint 642 716 7.7776 9.7220 14.5830 2.3192 Constraint 459 716 10.0890 12.6113 18.9169 2.3192 Constraint 452 716 9.4651 11.8313 17.7470 2.3192 Constraint 447 723 8.7444 10.9305 16.3958 2.0987 Constraint 525 692 11.4769 14.3461 21.5192 2.0000 Constraint 374 723 11.6567 14.5709 21.8564 2.0000 Constraint 352 681 10.8034 13.5043 20.2564 2.0000 Constraint 303 723 11.8341 14.7927 22.1890 2.0000 Constraint 295 723 8.3213 10.4016 15.6024 2.0000 Constraint 289 723 8.1552 10.1939 15.2909 2.0000 Constraint 280 723 8.2851 10.3564 15.5346 2.0000 Constraint 237 650 11.4616 14.3270 21.4905 2.0000 Constraint 228 572 11.9665 14.9581 22.4371 2.0000 Constraint 220 563 11.1552 13.9440 20.9160 2.0000 Constraint 220 385 11.5684 14.4605 21.6908 2.0000 Constraint 220 295 11.5899 14.4874 21.7311 2.0000 Constraint 194 579 11.3058 14.1323 21.1985 2.0000 Constraint 182 707 11.4273 14.2841 21.4261 2.0000 Constraint 161 723 10.9452 13.6815 20.5222 2.0000 Constraint 146 723 11.3659 14.2074 21.3111 2.0000 Constraint 138 723 10.7537 13.4422 20.1632 2.0000 Constraint 138 220 10.7423 13.4278 20.1418 2.0000 Constraint 138 211 11.6712 14.5889 21.8834 2.0000 Constraint 17 211 8.7896 10.9870 16.4805 2.0000 Constraint 17 202 9.5694 11.9618 17.9426 2.0000 Constraint 9 478 11.2700 14.0875 21.1313 2.0000 Constraint 3 716 11.9380 14.9226 22.3838 2.0000 Constraint 3 707 8.3755 10.4694 15.7041 2.0000 Constraint 3 385 9.7651 12.2064 18.3096 2.0000 Constraint 237 723 11.0111 13.7638 20.6457 2.0000 Constraint 182 681 11.7485 14.6856 22.0284 2.0000 Constraint 182 393 11.7855 14.7319 22.0979 2.0000 Constraint 244 393 11.3355 14.1694 21.2541 2.0000 Constraint 244 385 11.1215 13.9019 20.8529 2.0000 Constraint 138 244 9.7566 12.1957 18.2936 2.0000 Constraint 138 237 11.4865 14.3581 21.5371 2.0000 Constraint 393 729 9.5345 11.9181 17.8772 2.0000 Constraint 23 729 9.6061 12.0077 18.0115 2.0000 Constraint 414 729 11.2095 14.0119 21.0178 2.0000 Constraint 202 478 11.6037 14.5047 21.7570 2.0000 Constraint 113 280 11.7783 14.7229 22.0844 2.0000 Constraint 82 665 9.0750 11.3437 17.0156 2.0000 Constraint 82 658 9.2454 11.5567 17.3350 2.0000 Constraint 65 673 8.7447 10.9309 16.3963 2.0000 Constraint 194 707 11.3403 14.1754 21.2631 2.0000 Constraint 237 716 10.6990 13.3737 20.0606 2.0000 Constraint 310 635 11.4488 14.3111 21.4666 2.0000 Constraint 23 402 10.3300 12.9125 19.3687 2.0000 Constraint 556 628 11.9444 14.9305 22.3957 1.9999 Constraint 551 628 10.7829 13.4787 20.2180 1.9999 Constraint 211 707 11.2614 14.0768 21.1152 1.9999 Constraint 244 707 11.7338 14.6672 22.0008 1.9999 Constraint 138 518 11.2561 14.0701 21.1052 1.9999 Constraint 486 723 9.7646 12.2057 18.3086 1.9987 Constraint 254 723 10.9642 13.7053 20.5579 1.9987 Constraint 220 658 11.4632 14.3291 21.4936 1.8343 Constraint 228 716 9.6915 12.1143 18.1715 1.8342 Constraint 310 587 11.3080 14.1350 21.2026 1.7550 Constraint 310 579 10.7011 13.3764 20.0646 1.7550 Constraint 310 556 10.7735 13.4669 20.2004 1.7550 Constraint 170 303 11.6481 14.5602 21.8403 1.6685 Constraint 170 295 11.0852 13.8565 20.7847 1.6685 Constraint 362 723 9.9236 12.4045 18.6067 1.5850 Constraint 650 723 9.0915 11.3644 17.0466 1.5836 Constraint 642 723 9.3985 11.7481 17.6221 1.5836 Constraint 310 716 11.1382 13.9227 20.8840 1.4848 Constraint 452 723 11.3607 14.2009 21.3014 1.4836 Constraint 402 507 11.9924 14.9905 22.4857 1.4550 Constraint 385 507 11.3604 14.2005 21.3008 1.4550 Constraint 362 486 11.2875 14.1094 21.1641 1.4550 Constraint 352 431 11.6181 14.5227 21.7840 1.4550 Constraint 336 507 11.7733 14.7166 22.0748 1.4550 Constraint 310 551 11.6388 14.5485 21.8228 1.4550 Constraint 295 507 11.5836 14.4795 21.7192 1.4550 Constraint 289 507 9.6374 12.0468 18.0701 1.4550 Constraint 254 362 11.1360 13.9200 20.8800 1.4550 Constraint 635 716 7.7341 9.6677 14.5015 1.3192 Constraint 628 716 9.1448 11.4310 17.1465 1.3192 Constraint 551 716 10.7231 13.4038 20.1058 1.3192 Constraint 310 650 11.4044 14.2555 21.3833 1.2000 Constraint 579 673 10.8373 13.5466 20.3199 1.1000 Constraint 459 673 8.3514 10.4392 15.6588 1.1000 Constraint 228 579 11.9505 14.9382 22.4073 1.0000 Constraint 220 650 11.4199 14.2749 21.4124 1.0000 Constraint 220 579 9.8348 12.2936 18.4403 1.0000 Constraint 220 572 9.4524 11.8155 17.7232 1.0000 Constraint 220 478 7.3451 9.1814 13.7720 1.0000 Constraint 220 471 9.2687 11.5858 17.3788 1.0000 Constraint 220 452 9.2198 11.5247 17.2871 1.0000 Constraint 220 447 9.4035 11.7544 17.6315 1.0000 Constraint 211 572 10.6214 13.2767 19.9151 1.0000 Constraint 211 471 11.5146 14.3932 21.5898 1.0000 Constraint 211 447 11.7797 14.7246 22.0869 1.0000 Constraint 202 579 11.2586 14.0732 21.1098 1.0000 Constraint 202 563 11.1416 13.9270 20.8905 1.0000 Constraint 146 228 9.1381 11.4227 17.1340 1.0000 Constraint 138 228 11.1480 13.9350 20.9025 1.0000 Constraint 82 572 10.2846 12.8557 19.2835 1.0000 Constraint 82 556 11.6016 14.5020 21.7530 1.0000 Constraint 82 551 11.2974 14.1217 21.1826 1.0000 Constraint 82 486 11.8742 14.8428 22.2641 1.0000 Constraint 82 471 11.9115 14.8894 22.3341 1.0000 Constraint 82 447 10.9185 13.6481 20.4722 1.0000 Constraint 82 414 10.0740 12.5925 18.8888 1.0000 Constraint 82 393 11.8239 14.7799 22.1699 1.0000 Constraint 82 289 11.7523 14.6903 22.0355 1.0000 Constraint 82 273 9.5202 11.9002 17.8503 1.0000 Constraint 82 153 10.3713 12.9641 19.4461 1.0000 Constraint 82 146 10.1649 12.7061 19.0591 1.0000 Constraint 65 716 11.7826 14.7282 22.0923 1.0000 Constraint 65 551 11.5940 14.4926 21.7388 1.0000 Constraint 65 486 10.1688 12.7110 19.0664 1.0000 Constraint 65 402 11.7161 14.6451 21.9677 1.0000 Constraint 65 262 11.5837 14.4796 21.7194 1.0000 Constraint 65 254 11.0944 13.8680 20.8020 1.0000 Constraint 65 153 11.4048 14.2560 21.3841 1.0000 Constraint 32 194 11.9978 14.9972 22.4958 1.0000 Constraint 23 211 11.9958 14.9947 22.4921 1.0000 Constraint 23 202 11.6913 14.6142 21.9213 1.0000 Constraint 9 211 11.2777 14.0971 21.1457 1.0000 Constraint 9 202 11.3558 14.1947 21.2921 1.0000 Constraint 3 362 11.0539 13.8174 20.7261 1.0000 Constraint 3 295 11.7355 14.6693 22.0040 1.0000 Constraint 3 273 11.4274 14.2843 21.4265 1.0000 Constraint 658 729 10.2063 12.7578 19.1367 1.0000 Constraint 507 729 10.5249 13.1561 19.7341 1.0000 Constraint 507 723 10.6643 13.3304 19.9956 1.0000 Constraint 494 729 4.8434 6.0542 9.0813 1.0000 Constraint 486 729 9.3963 11.7454 17.6181 1.0000 Constraint 478 729 7.8775 9.8468 14.7702 1.0000 Constraint 478 723 7.7099 9.6373 14.4560 1.0000 Constraint 447 729 9.7609 12.2011 18.3017 1.0000 Constraint 439 729 6.3445 7.9306 11.8959 1.0000 Constraint 431 729 9.7038 12.1298 18.1947 1.0000 Constraint 422 729 7.3248 9.1559 13.7339 1.0000 Constraint 262 729 11.0947 13.8683 20.8025 1.0000 Constraint 254 729 10.2080 12.7600 19.1401 1.0000 Constraint 244 729 7.3836 9.2295 13.8443 1.0000 Constraint 194 729 10.2499 12.8124 19.2187 1.0000 Constraint 194 723 11.1243 13.9053 20.8580 1.0000 Constraint 32 729 9.3609 11.7011 17.5517 1.0000 Constraint 331 598 10.9935 13.7418 20.6128 1.0000 Constraint 106 551 11.8408 14.8009 22.2014 1.0000 Constraint 106 542 11.9851 14.9814 22.4721 1.0000 Constraint 106 533 10.7528 13.4410 20.1615 1.0000 Constraint 362 729 11.7458 14.6822 22.0233 1.0000 Constraint 39 729 10.1607 12.7008 19.0513 1.0000 Constraint 17 729 11.1063 13.8829 20.8243 1.0000 Constraint 478 692 8.0713 10.0891 15.1336 1.0000 Constraint 478 681 10.4192 13.0241 19.5361 1.0000 Constraint 471 692 11.0728 13.8411 20.7616 1.0000 Constraint 471 681 11.9160 14.8950 22.3425 1.0000 Constraint 459 681 11.5554 14.4443 21.6664 1.0000 Constraint 452 692 9.0245 11.2806 16.9209 1.0000 Constraint 452 681 8.3665 10.4582 15.6873 1.0000 Constraint 310 619 11.8530 14.8162 22.2243 1.0000 Constraint 126 681 11.2262 14.0327 21.0491 1.0000 Constraint 126 673 11.0396 13.7995 20.6993 1.0000 Constraint 113 665 11.6607 14.5759 21.8638 1.0000 Constraint 113 525 11.3800 14.2250 21.3375 1.0000 Constraint 98 289 11.5344 14.4180 21.6270 1.0000 Constraint 98 273 11.8472 14.8090 22.2134 1.0000 Constraint 89 665 9.3571 11.6964 17.5446 1.0000 Constraint 89 658 9.1834 11.4793 17.2189 1.0000 Constraint 74 673 8.9852 11.2315 16.8472 1.0000 Constraint 58 723 11.3717 14.2146 21.3219 1.0000 Constraint 50 723 8.3787 10.4734 15.7101 1.0000 Constraint 23 237 10.5223 13.1529 19.7293 1.0000 Constraint 23 228 11.3557 14.1947 21.2920 1.0000 Constraint 23 170 11.6306 14.5382 21.8073 1.0000 Constraint 17 362 9.9374 12.4218 18.6327 1.0000 Constraint 17 336 10.8162 13.5203 20.2805 1.0000 Constraint 17 244 11.1317 13.9146 20.8719 1.0000 Constraint 17 228 9.1956 11.4945 17.2417 1.0000 Constraint 17 194 9.8439 12.3048 18.4572 1.0000 Constraint 17 161 11.7624 14.7030 22.0545 1.0000 Constraint 9 494 11.8405 14.8006 22.2009 1.0000 Constraint 9 262 11.1984 13.9980 20.9970 1.0000 Constraint 9 194 10.8889 13.6112 20.4167 1.0000 Constraint 9 170 11.6915 14.6144 21.9216 1.0000 Constraint 431 619 11.9507 14.9383 22.4075 1.0000 Constraint 385 619 10.7889 13.4861 20.2292 1.0000 Constraint 228 393 10.2253 12.7816 19.1724 1.0000 Constraint 228 385 11.5517 14.4396 21.6595 1.0000 Constraint 220 716 11.7733 14.7166 22.0749 1.0000 Constraint 194 681 8.6833 10.8542 16.2813 1.0000 Constraint 289 707 11.1780 13.9725 20.9587 0.9998 Constraint 146 716 10.9627 13.7034 20.5551 0.9998 Constraint 352 707 11.1777 13.9722 20.9583 0.9700 Constraint 343 707 11.6632 14.5790 21.8685 0.9700 Constraint 331 707 11.4158 14.2698 21.4046 0.9700 Constraint 471 716 10.6701 13.3376 20.0064 0.8343 Constraint 352 608 11.6476 14.5595 21.8392 0.8343 Constraint 146 642 11.9121 14.8902 22.3352 0.8343 Constraint 146 628 11.0119 13.7649 20.6474 0.8343 Constraint 146 619 10.0536 12.5670 18.8505 0.8343 Constraint 146 352 6.7275 8.4094 12.6141 0.8343 Constraint 635 723 7.9820 9.9775 14.9662 0.5850 Constraint 628 723 4.5282 5.6603 8.4904 0.4850 Constraint 619 723 5.8902 7.3628 11.0442 0.4850 Constraint 619 716 5.8170 7.2712 10.9068 0.4850 Constraint 608 723 9.0294 11.2867 16.9300 0.4850 Constraint 608 716 7.7107 9.6384 14.4576 0.4850 Constraint 598 716 11.5478 14.4348 21.6522 0.4850 Constraint 587 716 9.8865 12.3581 18.5372 0.4850 Constraint 579 723 9.8257 12.2822 18.4232 0.4850 Constraint 579 716 6.4632 8.0790 12.1185 0.4850 Constraint 572 716 9.5863 11.9828 17.9742 0.4850 Constraint 556 716 11.3776 14.2220 21.3331 0.4850 Constraint 459 723 11.3564 14.1955 21.2932 0.4850 Constraint 352 723 6.0055 7.5068 11.2603 0.4850 Constraint 352 716 6.0113 7.5141 11.2711 0.4850 Constraint 331 723 4.9710 6.2138 9.3207 0.4850 Constraint 331 716 3.6720 4.5900 6.8850 0.4850 Constraint 325 723 8.4289 10.5362 15.8043 0.4850 Constraint 325 716 7.3233 9.1541 13.7311 0.4850 Constraint 319 723 10.5877 13.2347 19.8520 0.4850 Constraint 319 716 10.2344 12.7930 19.1895 0.4850 Constraint 310 723 11.9375 14.9219 22.3828 0.4850 Constraint 310 525 11.2232 14.0291 21.0436 0.3000 Constraint 310 431 11.9910 14.9887 22.4831 0.3000 Constraint 295 486 10.4112 13.0140 19.5211 0.3000 Constraint 295 439 11.3781 14.2227 21.3340 0.3000 Constraint 587 665 11.9748 14.9685 22.4528 0.1000 Constraint 572 673 11.1000 13.8750 20.8125 0.1000 Constraint 525 658 11.9309 14.9136 22.3704 0.1000 Constraint 310 665 11.7525 14.6906 22.0359 0.1000 Constraint 295 658 11.0454 13.8068 20.7101 0.1000 Constraint 723 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 729 0.8000 1.0000 1.5000 0.0000 Constraint 716 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 729 0.8000 1.0000 1.5000 0.0000 Constraint 707 723 0.8000 1.0000 1.5000 0.0000 Constraint 707 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 729 0.8000 1.0000 1.5000 0.0000 Constraint 692 723 0.8000 1.0000 1.5000 0.0000 Constraint 692 716 0.8000 1.0000 1.5000 0.0000 Constraint 692 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 729 0.8000 1.0000 1.5000 0.0000 Constraint 681 723 0.8000 1.0000 1.5000 0.0000 Constraint 681 716 0.8000 1.0000 1.5000 0.0000 Constraint 681 707 0.8000 1.0000 1.5000 0.0000 Constraint 681 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 729 0.8000 1.0000 1.5000 0.0000 Constraint 673 723 0.8000 1.0000 1.5000 0.0000 Constraint 673 716 0.8000 1.0000 1.5000 0.0000 Constraint 673 707 0.8000 1.0000 1.5000 0.0000 Constraint 673 692 0.8000 1.0000 1.5000 0.0000 Constraint 673 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 729 0.8000 1.0000 1.5000 0.0000 Constraint 665 723 0.8000 1.0000 1.5000 0.0000 Constraint 665 716 0.8000 1.0000 1.5000 0.0000 Constraint 665 707 0.8000 1.0000 1.5000 0.0000 Constraint 665 692 0.8000 1.0000 1.5000 0.0000 Constraint 665 681 0.8000 1.0000 1.5000 0.0000 Constraint 665 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 723 0.8000 1.0000 1.5000 0.0000 Constraint 658 716 0.8000 1.0000 1.5000 0.0000 Constraint 658 707 0.8000 1.0000 1.5000 0.0000 Constraint 658 692 0.8000 1.0000 1.5000 0.0000 Constraint 658 681 0.8000 1.0000 1.5000 0.0000 Constraint 658 673 0.8000 1.0000 1.5000 0.0000 Constraint 658 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 729 0.8000 1.0000 1.5000 0.0000 Constraint 650 716 0.8000 1.0000 1.5000 0.0000 Constraint 650 707 0.8000 1.0000 1.5000 0.0000 Constraint 650 692 0.8000 1.0000 1.5000 0.0000 Constraint 650 681 0.8000 1.0000 1.5000 0.0000 Constraint 650 673 0.8000 1.0000 1.5000 0.0000 Constraint 650 665 0.8000 1.0000 1.5000 0.0000 Constraint 650 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 729 0.8000 1.0000 1.5000 0.0000 Constraint 642 707 0.8000 1.0000 1.5000 0.0000 Constraint 642 692 0.8000 1.0000 1.5000 0.0000 Constraint 642 681 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 665 0.8000 1.0000 1.5000 0.0000 Constraint 642 658 0.8000 1.0000 1.5000 0.0000 Constraint 642 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 729 0.8000 1.0000 1.5000 0.0000 Constraint 635 707 0.8000 1.0000 1.5000 0.0000 Constraint 635 692 0.8000 1.0000 1.5000 0.0000 Constraint 635 681 0.8000 1.0000 1.5000 0.0000 Constraint 635 673 0.8000 1.0000 1.5000 0.0000 Constraint 635 665 0.8000 1.0000 1.5000 0.0000 Constraint 635 658 0.8000 1.0000 1.5000 0.0000 Constraint 635 650 0.8000 1.0000 1.5000 0.0000 Constraint 635 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 729 0.8000 1.0000 1.5000 0.0000 Constraint 628 707 0.8000 1.0000 1.5000 0.0000 Constraint 628 692 0.8000 1.0000 1.5000 0.0000 Constraint 628 681 0.8000 1.0000 1.5000 0.0000 Constraint 628 673 0.8000 1.0000 1.5000 0.0000 Constraint 628 665 0.8000 1.0000 1.5000 0.0000 Constraint 628 658 0.8000 1.0000 1.5000 0.0000 Constraint 628 650 0.8000 1.0000 1.5000 0.0000 Constraint 628 642 0.8000 1.0000 1.5000 0.0000 Constraint 628 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 729 0.8000 1.0000 1.5000 0.0000 Constraint 619 707 0.8000 1.0000 1.5000 0.0000 Constraint 619 692 0.8000 1.0000 1.5000 0.0000 Constraint 619 681 0.8000 1.0000 1.5000 0.0000 Constraint 619 673 0.8000 1.0000 1.5000 0.0000 Constraint 619 665 0.8000 1.0000 1.5000 0.0000 Constraint 619 658 0.8000 1.0000 1.5000 0.0000 Constraint 619 650 0.8000 1.0000 1.5000 0.0000 Constraint 619 642 0.8000 1.0000 1.5000 0.0000 Constraint 619 635 0.8000 1.0000 1.5000 0.0000 Constraint 619 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 729 0.8000 1.0000 1.5000 0.0000 Constraint 608 707 0.8000 1.0000 1.5000 0.0000 Constraint 608 692 0.8000 1.0000 1.5000 0.0000 Constraint 608 681 0.8000 1.0000 1.5000 0.0000 Constraint 608 673 0.8000 1.0000 1.5000 0.0000 Constraint 608 665 0.8000 1.0000 1.5000 0.0000 Constraint 608 658 0.8000 1.0000 1.5000 0.0000 Constraint 608 650 0.8000 1.0000 1.5000 0.0000 Constraint 608 642 0.8000 1.0000 1.5000 0.0000 Constraint 608 635 0.8000 1.0000 1.5000 0.0000 Constraint 608 628 0.8000 1.0000 1.5000 0.0000 Constraint 608 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 729 0.8000 1.0000 1.5000 0.0000 Constraint 598 723 0.8000 1.0000 1.5000 0.0000 Constraint 598 707 0.8000 1.0000 1.5000 0.0000 Constraint 598 692 0.8000 1.0000 1.5000 0.0000 Constraint 598 681 0.8000 1.0000 1.5000 0.0000 Constraint 598 673 0.8000 1.0000 1.5000 0.0000 Constraint 598 665 0.8000 1.0000 1.5000 0.0000 Constraint 598 658 0.8000 1.0000 1.5000 0.0000 Constraint 598 650 0.8000 1.0000 1.5000 0.0000 Constraint 598 642 0.8000 1.0000 1.5000 0.0000 Constraint 598 635 0.8000 1.0000 1.5000 0.0000 Constraint 598 628 0.8000 1.0000 1.5000 0.0000 Constraint 598 619 0.8000 1.0000 1.5000 0.0000 Constraint 598 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 729 0.8000 1.0000 1.5000 0.0000 Constraint 587 723 0.8000 1.0000 1.5000 0.0000 Constraint 587 707 0.8000 1.0000 1.5000 0.0000 Constraint 587 692 0.8000 1.0000 1.5000 0.0000 Constraint 587 681 0.8000 1.0000 1.5000 0.0000 Constraint 587 673 0.8000 1.0000 1.5000 0.0000 Constraint 587 658 0.8000 1.0000 1.5000 0.0000 Constraint 587 650 0.8000 1.0000 1.5000 0.0000 Constraint 587 642 0.8000 1.0000 1.5000 0.0000 Constraint 587 635 0.8000 1.0000 1.5000 0.0000 Constraint 587 628 0.8000 1.0000 1.5000 0.0000 Constraint 587 619 0.8000 1.0000 1.5000 0.0000 Constraint 587 608 0.8000 1.0000 1.5000 0.0000 Constraint 587 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 729 0.8000 1.0000 1.5000 0.0000 Constraint 579 707 0.8000 1.0000 1.5000 0.0000 Constraint 579 692 0.8000 1.0000 1.5000 0.0000 Constraint 579 681 0.8000 1.0000 1.5000 0.0000 Constraint 579 642 0.8000 1.0000 1.5000 0.0000 Constraint 579 635 0.8000 1.0000 1.5000 0.0000 Constraint 579 628 0.8000 1.0000 1.5000 0.0000 Constraint 579 619 0.8000 1.0000 1.5000 0.0000 Constraint 579 608 0.8000 1.0000 1.5000 0.0000 Constraint 579 598 0.8000 1.0000 1.5000 0.0000 Constraint 579 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 729 0.8000 1.0000 1.5000 0.0000 Constraint 572 723 0.8000 1.0000 1.5000 0.0000 Constraint 572 707 0.8000 1.0000 1.5000 0.0000 Constraint 572 692 0.8000 1.0000 1.5000 0.0000 Constraint 572 681 0.8000 1.0000 1.5000 0.0000 Constraint 572 635 0.8000 1.0000 1.5000 0.0000 Constraint 572 628 0.8000 1.0000 1.5000 0.0000 Constraint 572 619 0.8000 1.0000 1.5000 0.0000 Constraint 572 608 0.8000 1.0000 1.5000 0.0000 Constraint 572 598 0.8000 1.0000 1.5000 0.0000 Constraint 572 587 0.8000 1.0000 1.5000 0.0000 Constraint 572 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 729 0.8000 1.0000 1.5000 0.0000 Constraint 563 723 0.8000 1.0000 1.5000 0.0000 Constraint 563 716 0.8000 1.0000 1.5000 0.0000 Constraint 563 707 0.8000 1.0000 1.5000 0.0000 Constraint 563 692 0.8000 1.0000 1.5000 0.0000 Constraint 563 681 0.8000 1.0000 1.5000 0.0000 Constraint 563 673 0.8000 1.0000 1.5000 0.0000 Constraint 563 665 0.8000 1.0000 1.5000 0.0000 Constraint 563 658 0.8000 1.0000 1.5000 0.0000 Constraint 563 628 0.8000 1.0000 1.5000 0.0000 Constraint 563 619 0.8000 1.0000 1.5000 0.0000 Constraint 563 608 0.8000 1.0000 1.5000 0.0000 Constraint 563 598 0.8000 1.0000 1.5000 0.0000 Constraint 563 587 0.8000 1.0000 1.5000 0.0000 Constraint 563 579 0.8000 1.0000 1.5000 0.0000 Constraint 563 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 729 0.8000 1.0000 1.5000 0.0000 Constraint 556 723 0.8000 1.0000 1.5000 0.0000 Constraint 556 707 0.8000 1.0000 1.5000 0.0000 Constraint 556 692 0.8000 1.0000 1.5000 0.0000 Constraint 556 681 0.8000 1.0000 1.5000 0.0000 Constraint 556 673 0.8000 1.0000 1.5000 0.0000 Constraint 556 658 0.8000 1.0000 1.5000 0.0000 Constraint 556 642 0.8000 1.0000 1.5000 0.0000 Constraint 556 619 0.8000 1.0000 1.5000 0.0000 Constraint 556 608 0.8000 1.0000 1.5000 0.0000 Constraint 556 598 0.8000 1.0000 1.5000 0.0000 Constraint 556 587 0.8000 1.0000 1.5000 0.0000 Constraint 556 579 0.8000 1.0000 1.5000 0.0000 Constraint 556 572 0.8000 1.0000 1.5000 0.0000 Constraint 556 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 729 0.8000 1.0000 1.5000 0.0000 Constraint 551 723 0.8000 1.0000 1.5000 0.0000 Constraint 551 707 0.8000 1.0000 1.5000 0.0000 Constraint 551 608 0.8000 1.0000 1.5000 0.0000 Constraint 551 598 0.8000 1.0000 1.5000 0.0000 Constraint 551 587 0.8000 1.0000 1.5000 0.0000 Constraint 551 579 0.8000 1.0000 1.5000 0.0000 Constraint 551 572 0.8000 1.0000 1.5000 0.0000 Constraint 551 563 0.8000 1.0000 1.5000 0.0000 Constraint 551 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 729 0.8000 1.0000 1.5000 0.0000 Constraint 542 723 0.8000 1.0000 1.5000 0.0000 Constraint 542 716 0.8000 1.0000 1.5000 0.0000 Constraint 542 707 0.8000 1.0000 1.5000 0.0000 Constraint 542 692 0.8000 1.0000 1.5000 0.0000 Constraint 542 681 0.8000 1.0000 1.5000 0.0000 Constraint 542 628 0.8000 1.0000 1.5000 0.0000 Constraint 542 619 0.8000 1.0000 1.5000 0.0000 Constraint 542 608 0.8000 1.0000 1.5000 0.0000 Constraint 542 598 0.8000 1.0000 1.5000 0.0000 Constraint 542 587 0.8000 1.0000 1.5000 0.0000 Constraint 542 579 0.8000 1.0000 1.5000 0.0000 Constraint 542 572 0.8000 1.0000 1.5000 0.0000 Constraint 542 563 0.8000 1.0000 1.5000 0.0000 Constraint 542 556 0.8000 1.0000 1.5000 0.0000 Constraint 542 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 729 0.8000 1.0000 1.5000 0.0000 Constraint 533 723 0.8000 1.0000 1.5000 0.0000 Constraint 533 716 0.8000 1.0000 1.5000 0.0000 Constraint 533 707 0.8000 1.0000 1.5000 0.0000 Constraint 533 692 0.8000 1.0000 1.5000 0.0000 Constraint 533 681 0.8000 1.0000 1.5000 0.0000 Constraint 533 673 0.8000 1.0000 1.5000 0.0000 Constraint 533 665 0.8000 1.0000 1.5000 0.0000 Constraint 533 658 0.8000 1.0000 1.5000 0.0000 Constraint 533 642 0.8000 1.0000 1.5000 0.0000 Constraint 533 628 0.8000 1.0000 1.5000 0.0000 Constraint 533 619 0.8000 1.0000 1.5000 0.0000 Constraint 533 598 0.8000 1.0000 1.5000 0.0000 Constraint 533 587 0.8000 1.0000 1.5000 0.0000 Constraint 533 579 0.8000 1.0000 1.5000 0.0000 Constraint 533 572 0.8000 1.0000 1.5000 0.0000 Constraint 533 563 0.8000 1.0000 1.5000 0.0000 Constraint 533 556 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 729 0.8000 1.0000 1.5000 0.0000 Constraint 525 723 0.8000 1.0000 1.5000 0.0000 Constraint 525 716 0.8000 1.0000 1.5000 0.0000 Constraint 525 707 0.8000 1.0000 1.5000 0.0000 Constraint 525 681 0.8000 1.0000 1.5000 0.0000 Constraint 525 642 0.8000 1.0000 1.5000 0.0000 Constraint 525 628 0.8000 1.0000 1.5000 0.0000 Constraint 525 619 0.8000 1.0000 1.5000 0.0000 Constraint 525 608 0.8000 1.0000 1.5000 0.0000 Constraint 525 587 0.8000 1.0000 1.5000 0.0000 Constraint 525 579 0.8000 1.0000 1.5000 0.0000 Constraint 525 572 0.8000 1.0000 1.5000 0.0000 Constraint 525 563 0.8000 1.0000 1.5000 0.0000 Constraint 525 556 0.8000 1.0000 1.5000 0.0000 Constraint 525 551 0.8000 1.0000 1.5000 0.0000 Constraint 525 542 0.8000 1.0000 1.5000 0.0000 Constraint 525 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 729 0.8000 1.0000 1.5000 0.0000 Constraint 518 723 0.8000 1.0000 1.5000 0.0000 Constraint 518 716 0.8000 1.0000 1.5000 0.0000 Constraint 518 707 0.8000 1.0000 1.5000 0.0000 Constraint 518 692 0.8000 1.0000 1.5000 0.0000 Constraint 518 681 0.8000 1.0000 1.5000 0.0000 Constraint 518 673 0.8000 1.0000 1.5000 0.0000 Constraint 518 665 0.8000 1.0000 1.5000 0.0000 Constraint 518 658 0.8000 1.0000 1.5000 0.0000 Constraint 518 650 0.8000 1.0000 1.5000 0.0000 Constraint 518 642 0.8000 1.0000 1.5000 0.0000 Constraint 518 635 0.8000 1.0000 1.5000 0.0000 Constraint 518 628 0.8000 1.0000 1.5000 0.0000 Constraint 518 619 0.8000 1.0000 1.5000 0.0000 Constraint 518 608 0.8000 1.0000 1.5000 0.0000 Constraint 518 579 0.8000 1.0000 1.5000 0.0000 Constraint 518 572 0.8000 1.0000 1.5000 0.0000 Constraint 518 563 0.8000 1.0000 1.5000 0.0000 Constraint 518 556 0.8000 1.0000 1.5000 0.0000 Constraint 518 551 0.8000 1.0000 1.5000 0.0000 Constraint 518 542 0.8000 1.0000 1.5000 0.0000 Constraint 518 533 0.8000 1.0000 1.5000 0.0000 Constraint 518 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 716 0.8000 1.0000 1.5000 0.0000 Constraint 507 707 0.8000 1.0000 1.5000 0.0000 Constraint 507 681 0.8000 1.0000 1.5000 0.0000 Constraint 507 628 0.8000 1.0000 1.5000 0.0000 Constraint 507 619 0.8000 1.0000 1.5000 0.0000 Constraint 507 572 0.8000 1.0000 1.5000 0.0000 Constraint 507 563 0.8000 1.0000 1.5000 0.0000 Constraint 507 556 0.8000 1.0000 1.5000 0.0000 Constraint 507 551 0.8000 1.0000 1.5000 0.0000 Constraint 507 542 0.8000 1.0000 1.5000 0.0000 Constraint 507 533 0.8000 1.0000 1.5000 0.0000 Constraint 507 525 0.8000 1.0000 1.5000 0.0000 Constraint 507 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 707 0.8000 1.0000 1.5000 0.0000 Constraint 494 642 0.8000 1.0000 1.5000 0.0000 Constraint 494 635 0.8000 1.0000 1.5000 0.0000 Constraint 494 628 0.8000 1.0000 1.5000 0.0000 Constraint 494 619 0.8000 1.0000 1.5000 0.0000 Constraint 494 608 0.8000 1.0000 1.5000 0.0000 Constraint 494 598 0.8000 1.0000 1.5000 0.0000 Constraint 494 587 0.8000 1.0000 1.5000 0.0000 Constraint 494 556 0.8000 1.0000 1.5000 0.0000 Constraint 494 551 0.8000 1.0000 1.5000 0.0000 Constraint 494 542 0.8000 1.0000 1.5000 0.0000 Constraint 494 533 0.8000 1.0000 1.5000 0.0000 Constraint 494 525 0.8000 1.0000 1.5000 0.0000 Constraint 494 518 0.8000 1.0000 1.5000 0.0000 Constraint 494 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 628 0.8000 1.0000 1.5000 0.0000 Constraint 486 619 0.8000 1.0000 1.5000 0.0000 Constraint 486 551 0.8000 1.0000 1.5000 0.0000 Constraint 486 542 0.8000 1.0000 1.5000 0.0000 Constraint 486 533 0.8000 1.0000 1.5000 0.0000 Constraint 486 525 0.8000 1.0000 1.5000 0.0000 Constraint 486 518 0.8000 1.0000 1.5000 0.0000 Constraint 486 507 0.8000 1.0000 1.5000 0.0000 Constraint 486 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 707 0.8000 1.0000 1.5000 0.0000 Constraint 478 628 0.8000 1.0000 1.5000 0.0000 Constraint 478 619 0.8000 1.0000 1.5000 0.0000 Constraint 478 542 0.8000 1.0000 1.5000 0.0000 Constraint 478 533 0.8000 1.0000 1.5000 0.0000 Constraint 478 525 0.8000 1.0000 1.5000 0.0000 Constraint 478 518 0.8000 1.0000 1.5000 0.0000 Constraint 478 507 0.8000 1.0000 1.5000 0.0000 Constraint 478 494 0.8000 1.0000 1.5000 0.0000 Constraint 478 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 729 0.8000 1.0000 1.5000 0.0000 Constraint 471 723 0.8000 1.0000 1.5000 0.0000 Constraint 471 707 0.8000 1.0000 1.5000 0.0000 Constraint 471 533 0.8000 1.0000 1.5000 0.0000 Constraint 471 525 0.8000 1.0000 1.5000 0.0000 Constraint 471 518 0.8000 1.0000 1.5000 0.0000 Constraint 471 507 0.8000 1.0000 1.5000 0.0000 Constraint 471 494 0.8000 1.0000 1.5000 0.0000 Constraint 471 486 0.8000 1.0000 1.5000 0.0000 Constraint 471 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 729 0.8000 1.0000 1.5000 0.0000 Constraint 459 707 0.8000 1.0000 1.5000 0.0000 Constraint 459 692 0.8000 1.0000 1.5000 0.0000 Constraint 459 518 0.8000 1.0000 1.5000 0.0000 Constraint 459 507 0.8000 1.0000 1.5000 0.0000 Constraint 459 494 0.8000 1.0000 1.5000 0.0000 Constraint 459 486 0.8000 1.0000 1.5000 0.0000 Constraint 459 478 0.8000 1.0000 1.5000 0.0000 Constraint 459 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 729 0.8000 1.0000 1.5000 0.0000 Constraint 452 507 0.8000 1.0000 1.5000 0.0000 Constraint 452 494 0.8000 1.0000 1.5000 0.0000 Constraint 452 486 0.8000 1.0000 1.5000 0.0000 Constraint 452 478 0.8000 1.0000 1.5000 0.0000 Constraint 452 471 0.8000 1.0000 1.5000 0.0000 Constraint 452 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 494 0.8000 1.0000 1.5000 0.0000 Constraint 447 486 0.8000 1.0000 1.5000 0.0000 Constraint 447 478 0.8000 1.0000 1.5000 0.0000 Constraint 447 471 0.8000 1.0000 1.5000 0.0000 Constraint 447 459 0.8000 1.0000 1.5000 0.0000 Constraint 447 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 628 0.8000 1.0000 1.5000 0.0000 Constraint 439 619 0.8000 1.0000 1.5000 0.0000 Constraint 439 598 0.8000 1.0000 1.5000 0.0000 Constraint 439 587 0.8000 1.0000 1.5000 0.0000 Constraint 439 494 0.8000 1.0000 1.5000 0.0000 Constraint 439 486 0.8000 1.0000 1.5000 0.0000 Constraint 439 478 0.8000 1.0000 1.5000 0.0000 Constraint 439 471 0.8000 1.0000 1.5000 0.0000 Constraint 439 459 0.8000 1.0000 1.5000 0.0000 Constraint 439 452 0.8000 1.0000 1.5000 0.0000 Constraint 439 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 486 0.8000 1.0000 1.5000 0.0000 Constraint 431 478 0.8000 1.0000 1.5000 0.0000 Constraint 431 471 0.8000 1.0000 1.5000 0.0000 Constraint 431 459 0.8000 1.0000 1.5000 0.0000 Constraint 431 452 0.8000 1.0000 1.5000 0.0000 Constraint 431 447 0.8000 1.0000 1.5000 0.0000 Constraint 431 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 628 0.8000 1.0000 1.5000 0.0000 Constraint 422 619 0.8000 1.0000 1.5000 0.0000 Constraint 422 608 0.8000 1.0000 1.5000 0.0000 Constraint 422 598 0.8000 1.0000 1.5000 0.0000 Constraint 422 587 0.8000 1.0000 1.5000 0.0000 Constraint 422 563 0.8000 1.0000 1.5000 0.0000 Constraint 422 478 0.8000 1.0000 1.5000 0.0000 Constraint 422 471 0.8000 1.0000 1.5000 0.0000 Constraint 422 459 0.8000 1.0000 1.5000 0.0000 Constraint 422 452 0.8000 1.0000 1.5000 0.0000 Constraint 422 447 0.8000 1.0000 1.5000 0.0000 Constraint 422 439 0.8000 1.0000 1.5000 0.0000 Constraint 422 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 628 0.8000 1.0000 1.5000 0.0000 Constraint 414 619 0.8000 1.0000 1.5000 0.0000 Constraint 414 598 0.8000 1.0000 1.5000 0.0000 Constraint 414 587 0.8000 1.0000 1.5000 0.0000 Constraint 414 563 0.8000 1.0000 1.5000 0.0000 Constraint 414 533 0.8000 1.0000 1.5000 0.0000 Constraint 414 518 0.8000 1.0000 1.5000 0.0000 Constraint 414 478 0.8000 1.0000 1.5000 0.0000 Constraint 414 471 0.8000 1.0000 1.5000 0.0000 Constraint 414 459 0.8000 1.0000 1.5000 0.0000 Constraint 414 452 0.8000 1.0000 1.5000 0.0000 Constraint 414 447 0.8000 1.0000 1.5000 0.0000 Constraint 414 439 0.8000 1.0000 1.5000 0.0000 Constraint 414 431 0.8000 1.0000 1.5000 0.0000 Constraint 414 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 658 0.8000 1.0000 1.5000 0.0000 Constraint 402 642 0.8000 1.0000 1.5000 0.0000 Constraint 402 635 0.8000 1.0000 1.5000 0.0000 Constraint 402 628 0.8000 1.0000 1.5000 0.0000 Constraint 402 619 0.8000 1.0000 1.5000 0.0000 Constraint 402 608 0.8000 1.0000 1.5000 0.0000 Constraint 402 598 0.8000 1.0000 1.5000 0.0000 Constraint 402 587 0.8000 1.0000 1.5000 0.0000 Constraint 402 579 0.8000 1.0000 1.5000 0.0000 Constraint 402 572 0.8000 1.0000 1.5000 0.0000 Constraint 402 563 0.8000 1.0000 1.5000 0.0000 Constraint 402 556 0.8000 1.0000 1.5000 0.0000 Constraint 402 542 0.8000 1.0000 1.5000 0.0000 Constraint 402 533 0.8000 1.0000 1.5000 0.0000 Constraint 402 518 0.8000 1.0000 1.5000 0.0000 Constraint 402 494 0.8000 1.0000 1.5000 0.0000 Constraint 402 486 0.8000 1.0000 1.5000 0.0000 Constraint 402 478 0.8000 1.0000 1.5000 0.0000 Constraint 402 471 0.8000 1.0000 1.5000 0.0000 Constraint 402 459 0.8000 1.0000 1.5000 0.0000 Constraint 402 452 0.8000 1.0000 1.5000 0.0000 Constraint 402 447 0.8000 1.0000 1.5000 0.0000 Constraint 402 439 0.8000 1.0000 1.5000 0.0000 Constraint 402 431 0.8000 1.0000 1.5000 0.0000 Constraint 402 422 0.8000 1.0000 1.5000 0.0000 Constraint 402 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 628 0.8000 1.0000 1.5000 0.0000 Constraint 393 619 0.8000 1.0000 1.5000 0.0000 Constraint 393 608 0.8000 1.0000 1.5000 0.0000 Constraint 393 598 0.8000 1.0000 1.5000 0.0000 Constraint 393 587 0.8000 1.0000 1.5000 0.0000 Constraint 393 579 0.8000 1.0000 1.5000 0.0000 Constraint 393 572 0.8000 1.0000 1.5000 0.0000 Constraint 393 563 0.8000 1.0000 1.5000 0.0000 Constraint 393 556 0.8000 1.0000 1.5000 0.0000 Constraint 393 551 0.8000 1.0000 1.5000 0.0000 Constraint 393 542 0.8000 1.0000 1.5000 0.0000 Constraint 393 533 0.8000 1.0000 1.5000 0.0000 Constraint 393 525 0.8000 1.0000 1.5000 0.0000 Constraint 393 518 0.8000 1.0000 1.5000 0.0000 Constraint 393 507 0.8000 1.0000 1.5000 0.0000 Constraint 393 494 0.8000 1.0000 1.5000 0.0000 Constraint 393 478 0.8000 1.0000 1.5000 0.0000 Constraint 393 471 0.8000 1.0000 1.5000 0.0000 Constraint 393 459 0.8000 1.0000 1.5000 0.0000 Constraint 393 452 0.8000 1.0000 1.5000 0.0000 Constraint 393 447 0.8000 1.0000 1.5000 0.0000 Constraint 393 439 0.8000 1.0000 1.5000 0.0000 Constraint 393 431 0.8000 1.0000 1.5000 0.0000 Constraint 393 422 0.8000 1.0000 1.5000 0.0000 Constraint 393 414 0.8000 1.0000 1.5000 0.0000 Constraint 393 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 729 0.8000 1.0000 1.5000 0.0000 Constraint 385 598 0.8000 1.0000 1.5000 0.0000 Constraint 385 563 0.8000 1.0000 1.5000 0.0000 Constraint 385 542 0.8000 1.0000 1.5000 0.0000 Constraint 385 533 0.8000 1.0000 1.5000 0.0000 Constraint 385 518 0.8000 1.0000 1.5000 0.0000 Constraint 385 494 0.8000 1.0000 1.5000 0.0000 Constraint 385 478 0.8000 1.0000 1.5000 0.0000 Constraint 385 471 0.8000 1.0000 1.5000 0.0000 Constraint 385 447 0.8000 1.0000 1.5000 0.0000 Constraint 385 439 0.8000 1.0000 1.5000 0.0000 Constraint 385 431 0.8000 1.0000 1.5000 0.0000 Constraint 385 422 0.8000 1.0000 1.5000 0.0000 Constraint 385 414 0.8000 1.0000 1.5000 0.0000 Constraint 385 402 0.8000 1.0000 1.5000 0.0000 Constraint 385 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 729 0.8000 1.0000 1.5000 0.0000 Constraint 374 598 0.8000 1.0000 1.5000 0.0000 Constraint 374 587 0.8000 1.0000 1.5000 0.0000 Constraint 374 572 0.8000 1.0000 1.5000 0.0000 Constraint 374 563 0.8000 1.0000 1.5000 0.0000 Constraint 374 556 0.8000 1.0000 1.5000 0.0000 Constraint 374 551 0.8000 1.0000 1.5000 0.0000 Constraint 374 542 0.8000 1.0000 1.5000 0.0000 Constraint 374 533 0.8000 1.0000 1.5000 0.0000 Constraint 374 525 0.8000 1.0000 1.5000 0.0000 Constraint 374 518 0.8000 1.0000 1.5000 0.0000 Constraint 374 507 0.8000 1.0000 1.5000 0.0000 Constraint 374 494 0.8000 1.0000 1.5000 0.0000 Constraint 374 486 0.8000 1.0000 1.5000 0.0000 Constraint 374 478 0.8000 1.0000 1.5000 0.0000 Constraint 374 471 0.8000 1.0000 1.5000 0.0000 Constraint 374 439 0.8000 1.0000 1.5000 0.0000 Constraint 374 431 0.8000 1.0000 1.5000 0.0000 Constraint 374 422 0.8000 1.0000 1.5000 0.0000 Constraint 374 414 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 598 0.8000 1.0000 1.5000 0.0000 Constraint 362 587 0.8000 1.0000 1.5000 0.0000 Constraint 362 563 0.8000 1.0000 1.5000 0.0000 Constraint 362 556 0.8000 1.0000 1.5000 0.0000 Constraint 362 542 0.8000 1.0000 1.5000 0.0000 Constraint 362 533 0.8000 1.0000 1.5000 0.0000 Constraint 362 525 0.8000 1.0000 1.5000 0.0000 Constraint 362 518 0.8000 1.0000 1.5000 0.0000 Constraint 362 507 0.8000 1.0000 1.5000 0.0000 Constraint 362 494 0.8000 1.0000 1.5000 0.0000 Constraint 362 478 0.8000 1.0000 1.5000 0.0000 Constraint 362 471 0.8000 1.0000 1.5000 0.0000 Constraint 362 422 0.8000 1.0000 1.5000 0.0000 Constraint 362 414 0.8000 1.0000 1.5000 0.0000 Constraint 362 402 0.8000 1.0000 1.5000 0.0000 Constraint 362 393 0.8000 1.0000 1.5000 0.0000 Constraint 362 385 0.8000 1.0000 1.5000 0.0000 Constraint 362 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 729 0.8000 1.0000 1.5000 0.0000 Constraint 352 692 0.8000 1.0000 1.5000 0.0000 Constraint 352 673 0.8000 1.0000 1.5000 0.0000 Constraint 352 658 0.8000 1.0000 1.5000 0.0000 Constraint 352 598 0.8000 1.0000 1.5000 0.0000 Constraint 352 587 0.8000 1.0000 1.5000 0.0000 Constraint 352 572 0.8000 1.0000 1.5000 0.0000 Constraint 352 563 0.8000 1.0000 1.5000 0.0000 Constraint 352 556 0.8000 1.0000 1.5000 0.0000 Constraint 352 551 0.8000 1.0000 1.5000 0.0000 Constraint 352 542 0.8000 1.0000 1.5000 0.0000 Constraint 352 533 0.8000 1.0000 1.5000 0.0000 Constraint 352 525 0.8000 1.0000 1.5000 0.0000 Constraint 352 518 0.8000 1.0000 1.5000 0.0000 Constraint 352 507 0.8000 1.0000 1.5000 0.0000 Constraint 352 494 0.8000 1.0000 1.5000 0.0000 Constraint 352 486 0.8000 1.0000 1.5000 0.0000 Constraint 352 478 0.8000 1.0000 1.5000 0.0000 Constraint 352 471 0.8000 1.0000 1.5000 0.0000 Constraint 352 459 0.8000 1.0000 1.5000 0.0000 Constraint 352 452 0.8000 1.0000 1.5000 0.0000 Constraint 352 447 0.8000 1.0000 1.5000 0.0000 Constraint 352 439 0.8000 1.0000 1.5000 0.0000 Constraint 352 422 0.8000 1.0000 1.5000 0.0000 Constraint 352 414 0.8000 1.0000 1.5000 0.0000 Constraint 352 402 0.8000 1.0000 1.5000 0.0000 Constraint 352 393 0.8000 1.0000 1.5000 0.0000 Constraint 352 385 0.8000 1.0000 1.5000 0.0000 Constraint 352 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 729 0.8000 1.0000 1.5000 0.0000 Constraint 343 673 0.8000 1.0000 1.5000 0.0000 Constraint 343 658 0.8000 1.0000 1.5000 0.0000 Constraint 343 608 0.8000 1.0000 1.5000 0.0000 Constraint 343 598 0.8000 1.0000 1.5000 0.0000 Constraint 343 587 0.8000 1.0000 1.5000 0.0000 Constraint 343 572 0.8000 1.0000 1.5000 0.0000 Constraint 343 563 0.8000 1.0000 1.5000 0.0000 Constraint 343 556 0.8000 1.0000 1.5000 0.0000 Constraint 343 551 0.8000 1.0000 1.5000 0.0000 Constraint 343 542 0.8000 1.0000 1.5000 0.0000 Constraint 343 533 0.8000 1.0000 1.5000 0.0000 Constraint 343 525 0.8000 1.0000 1.5000 0.0000 Constraint 343 518 0.8000 1.0000 1.5000 0.0000 Constraint 343 507 0.8000 1.0000 1.5000 0.0000 Constraint 343 494 0.8000 1.0000 1.5000 0.0000 Constraint 343 486 0.8000 1.0000 1.5000 0.0000 Constraint 343 478 0.8000 1.0000 1.5000 0.0000 Constraint 343 471 0.8000 1.0000 1.5000 0.0000 Constraint 343 447 0.8000 1.0000 1.5000 0.0000 Constraint 343 439 0.8000 1.0000 1.5000 0.0000 Constraint 343 402 0.8000 1.0000 1.5000 0.0000 Constraint 343 393 0.8000 1.0000 1.5000 0.0000 Constraint 343 385 0.8000 1.0000 1.5000 0.0000 Constraint 343 374 0.8000 1.0000 1.5000 0.0000 Constraint 343 362 0.8000 1.0000 1.5000 0.0000 Constraint 343 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 729 0.8000 1.0000 1.5000 0.0000 Constraint 336 598 0.8000 1.0000 1.5000 0.0000 Constraint 336 563 0.8000 1.0000 1.5000 0.0000 Constraint 336 542 0.8000 1.0000 1.5000 0.0000 Constraint 336 533 0.8000 1.0000 1.5000 0.0000 Constraint 336 518 0.8000 1.0000 1.5000 0.0000 Constraint 336 494 0.8000 1.0000 1.5000 0.0000 Constraint 336 478 0.8000 1.0000 1.5000 0.0000 Constraint 336 471 0.8000 1.0000 1.5000 0.0000 Constraint 336 402 0.8000 1.0000 1.5000 0.0000 Constraint 336 393 0.8000 1.0000 1.5000 0.0000 Constraint 336 385 0.8000 1.0000 1.5000 0.0000 Constraint 336 374 0.8000 1.0000 1.5000 0.0000 Constraint 336 362 0.8000 1.0000 1.5000 0.0000 Constraint 336 352 0.8000 1.0000 1.5000 0.0000 Constraint 336 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 729 0.8000 1.0000 1.5000 0.0000 Constraint 331 692 0.8000 1.0000 1.5000 0.0000 Constraint 331 681 0.8000 1.0000 1.5000 0.0000 Constraint 331 673 0.8000 1.0000 1.5000 0.0000 Constraint 331 563 0.8000 1.0000 1.5000 0.0000 Constraint 331 542 0.8000 1.0000 1.5000 0.0000 Constraint 331 533 0.8000 1.0000 1.5000 0.0000 Constraint 331 525 0.8000 1.0000 1.5000 0.0000 Constraint 331 518 0.8000 1.0000 1.5000 0.0000 Constraint 331 507 0.8000 1.0000 1.5000 0.0000 Constraint 331 494 0.8000 1.0000 1.5000 0.0000 Constraint 331 486 0.8000 1.0000 1.5000 0.0000 Constraint 331 478 0.8000 1.0000 1.5000 0.0000 Constraint 331 471 0.8000 1.0000 1.5000 0.0000 Constraint 331 447 0.8000 1.0000 1.5000 0.0000 Constraint 331 439 0.8000 1.0000 1.5000 0.0000 Constraint 331 422 0.8000 1.0000 1.5000 0.0000 Constraint 331 393 0.8000 1.0000 1.5000 0.0000 Constraint 331 385 0.8000 1.0000 1.5000 0.0000 Constraint 331 374 0.8000 1.0000 1.5000 0.0000 Constraint 331 362 0.8000 1.0000 1.5000 0.0000 Constraint 331 352 0.8000 1.0000 1.5000 0.0000 Constraint 331 343 0.8000 1.0000 1.5000 0.0000 Constraint 331 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 729 0.8000 1.0000 1.5000 0.0000 Constraint 325 707 0.8000 1.0000 1.5000 0.0000 Constraint 325 692 0.8000 1.0000 1.5000 0.0000 Constraint 325 681 0.8000 1.0000 1.5000 0.0000 Constraint 325 673 0.8000 1.0000 1.5000 0.0000 Constraint 325 658 0.8000 1.0000 1.5000 0.0000 Constraint 325 598 0.8000 1.0000 1.5000 0.0000 Constraint 325 572 0.8000 1.0000 1.5000 0.0000 Constraint 325 563 0.8000 1.0000 1.5000 0.0000 Constraint 325 542 0.8000 1.0000 1.5000 0.0000 Constraint 325 533 0.8000 1.0000 1.5000 0.0000 Constraint 325 525 0.8000 1.0000 1.5000 0.0000 Constraint 325 518 0.8000 1.0000 1.5000 0.0000 Constraint 325 507 0.8000 1.0000 1.5000 0.0000 Constraint 325 494 0.8000 1.0000 1.5000 0.0000 Constraint 325 486 0.8000 1.0000 1.5000 0.0000 Constraint 325 478 0.8000 1.0000 1.5000 0.0000 Constraint 325 471 0.8000 1.0000 1.5000 0.0000 Constraint 325 447 0.8000 1.0000 1.5000 0.0000 Constraint 325 439 0.8000 1.0000 1.5000 0.0000 Constraint 325 422 0.8000 1.0000 1.5000 0.0000 Constraint 325 385 0.8000 1.0000 1.5000 0.0000 Constraint 325 374 0.8000 1.0000 1.5000 0.0000 Constraint 325 362 0.8000 1.0000 1.5000 0.0000 Constraint 325 352 0.8000 1.0000 1.5000 0.0000 Constraint 325 343 0.8000 1.0000 1.5000 0.0000 Constraint 325 336 0.8000 1.0000 1.5000 0.0000 Constraint 325 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 729 0.8000 1.0000 1.5000 0.0000 Constraint 319 707 0.8000 1.0000 1.5000 0.0000 Constraint 319 692 0.8000 1.0000 1.5000 0.0000 Constraint 319 681 0.8000 1.0000 1.5000 0.0000 Constraint 319 673 0.8000 1.0000 1.5000 0.0000 Constraint 319 665 0.8000 1.0000 1.5000 0.0000 Constraint 319 658 0.8000 1.0000 1.5000 0.0000 Constraint 319 650 0.8000 1.0000 1.5000 0.0000 Constraint 319 642 0.8000 1.0000 1.5000 0.0000 Constraint 319 628 0.8000 1.0000 1.5000 0.0000 Constraint 319 619 0.8000 1.0000 1.5000 0.0000 Constraint 319 608 0.8000 1.0000 1.5000 0.0000 Constraint 319 598 0.8000 1.0000 1.5000 0.0000 Constraint 319 587 0.8000 1.0000 1.5000 0.0000 Constraint 319 579 0.8000 1.0000 1.5000 0.0000 Constraint 319 572 0.8000 1.0000 1.5000 0.0000 Constraint 319 563 0.8000 1.0000 1.5000 0.0000 Constraint 319 556 0.8000 1.0000 1.5000 0.0000 Constraint 319 551 0.8000 1.0000 1.5000 0.0000 Constraint 319 542 0.8000 1.0000 1.5000 0.0000 Constraint 319 533 0.8000 1.0000 1.5000 0.0000 Constraint 319 525 0.8000 1.0000 1.5000 0.0000 Constraint 319 518 0.8000 1.0000 1.5000 0.0000 Constraint 319 507 0.8000 1.0000 1.5000 0.0000 Constraint 319 494 0.8000 1.0000 1.5000 0.0000 Constraint 319 486 0.8000 1.0000 1.5000 0.0000 Constraint 319 478 0.8000 1.0000 1.5000 0.0000 Constraint 319 471 0.8000 1.0000 1.5000 0.0000 Constraint 319 459 0.8000 1.0000 1.5000 0.0000 Constraint 319 452 0.8000 1.0000 1.5000 0.0000 Constraint 319 447 0.8000 1.0000 1.5000 0.0000 Constraint 319 439 0.8000 1.0000 1.5000 0.0000 Constraint 319 431 0.8000 1.0000 1.5000 0.0000 Constraint 319 422 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 362 0.8000 1.0000 1.5000 0.0000 Constraint 319 352 0.8000 1.0000 1.5000 0.0000 Constraint 319 343 0.8000 1.0000 1.5000 0.0000 Constraint 319 336 0.8000 1.0000 1.5000 0.0000 Constraint 319 331 0.8000 1.0000 1.5000 0.0000 Constraint 319 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 729 0.8000 1.0000 1.5000 0.0000 Constraint 310 707 0.8000 1.0000 1.5000 0.0000 Constraint 310 692 0.8000 1.0000 1.5000 0.0000 Constraint 310 681 0.8000 1.0000 1.5000 0.0000 Constraint 310 673 0.8000 1.0000 1.5000 0.0000 Constraint 310 658 0.8000 1.0000 1.5000 0.0000 Constraint 310 642 0.8000 1.0000 1.5000 0.0000 Constraint 310 628 0.8000 1.0000 1.5000 0.0000 Constraint 310 608 0.8000 1.0000 1.5000 0.0000 Constraint 310 598 0.8000 1.0000 1.5000 0.0000 Constraint 310 572 0.8000 1.0000 1.5000 0.0000 Constraint 310 563 0.8000 1.0000 1.5000 0.0000 Constraint 310 542 0.8000 1.0000 1.5000 0.0000 Constraint 310 533 0.8000 1.0000 1.5000 0.0000 Constraint 310 518 0.8000 1.0000 1.5000 0.0000 Constraint 310 507 0.8000 1.0000 1.5000 0.0000 Constraint 310 494 0.8000 1.0000 1.5000 0.0000 Constraint 310 486 0.8000 1.0000 1.5000 0.0000 Constraint 310 478 0.8000 1.0000 1.5000 0.0000 Constraint 310 471 0.8000 1.0000 1.5000 0.0000 Constraint 310 459 0.8000 1.0000 1.5000 0.0000 Constraint 310 452 0.8000 1.0000 1.5000 0.0000 Constraint 310 447 0.8000 1.0000 1.5000 0.0000 Constraint 310 439 0.8000 1.0000 1.5000 0.0000 Constraint 310 422 0.8000 1.0000 1.5000 0.0000 Constraint 310 362 0.8000 1.0000 1.5000 0.0000 Constraint 310 352 0.8000 1.0000 1.5000 0.0000 Constraint 310 343 0.8000 1.0000 1.5000 0.0000 Constraint 310 336 0.8000 1.0000 1.5000 0.0000 Constraint 310 331 0.8000 1.0000 1.5000 0.0000 Constraint 310 325 0.8000 1.0000 1.5000 0.0000 Constraint 310 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 729 0.8000 1.0000 1.5000 0.0000 Constraint 303 716 0.8000 1.0000 1.5000 0.0000 Constraint 303 707 0.8000 1.0000 1.5000 0.0000 Constraint 303 692 0.8000 1.0000 1.5000 0.0000 Constraint 303 681 0.8000 1.0000 1.5000 0.0000 Constraint 303 673 0.8000 1.0000 1.5000 0.0000 Constraint 303 665 0.8000 1.0000 1.5000 0.0000 Constraint 303 658 0.8000 1.0000 1.5000 0.0000 Constraint 303 642 0.8000 1.0000 1.5000 0.0000 Constraint 303 628 0.8000 1.0000 1.5000 0.0000 Constraint 303 619 0.8000 1.0000 1.5000 0.0000 Constraint 303 598 0.8000 1.0000 1.5000 0.0000 Constraint 303 572 0.8000 1.0000 1.5000 0.0000 Constraint 303 563 0.8000 1.0000 1.5000 0.0000 Constraint 303 542 0.8000 1.0000 1.5000 0.0000 Constraint 303 533 0.8000 1.0000 1.5000 0.0000 Constraint 303 518 0.8000 1.0000 1.5000 0.0000 Constraint 303 507 0.8000 1.0000 1.5000 0.0000 Constraint 303 494 0.8000 1.0000 1.5000 0.0000 Constraint 303 486 0.8000 1.0000 1.5000 0.0000 Constraint 303 478 0.8000 1.0000 1.5000 0.0000 Constraint 303 471 0.8000 1.0000 1.5000 0.0000 Constraint 303 459 0.8000 1.0000 1.5000 0.0000 Constraint 303 447 0.8000 1.0000 1.5000 0.0000 Constraint 303 439 0.8000 1.0000 1.5000 0.0000 Constraint 303 422 0.8000 1.0000 1.5000 0.0000 Constraint 303 362 0.8000 1.0000 1.5000 0.0000 Constraint 303 352 0.8000 1.0000 1.5000 0.0000 Constraint 303 343 0.8000 1.0000 1.5000 0.0000 Constraint 303 336 0.8000 1.0000 1.5000 0.0000 Constraint 303 331 0.8000 1.0000 1.5000 0.0000 Constraint 303 325 0.8000 1.0000 1.5000 0.0000 Constraint 303 319 0.8000 1.0000 1.5000 0.0000 Constraint 303 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 729 0.8000 1.0000 1.5000 0.0000 Constraint 295 642 0.8000 1.0000 1.5000 0.0000 Constraint 295 628 0.8000 1.0000 1.5000 0.0000 Constraint 295 619 0.8000 1.0000 1.5000 0.0000 Constraint 295 608 0.8000 1.0000 1.5000 0.0000 Constraint 295 598 0.8000 1.0000 1.5000 0.0000 Constraint 295 572 0.8000 1.0000 1.5000 0.0000 Constraint 295 563 0.8000 1.0000 1.5000 0.0000 Constraint 295 542 0.8000 1.0000 1.5000 0.0000 Constraint 295 533 0.8000 1.0000 1.5000 0.0000 Constraint 295 518 0.8000 1.0000 1.5000 0.0000 Constraint 295 494 0.8000 1.0000 1.5000 0.0000 Constraint 295 478 0.8000 1.0000 1.5000 0.0000 Constraint 295 471 0.8000 1.0000 1.5000 0.0000 Constraint 295 459 0.8000 1.0000 1.5000 0.0000 Constraint 295 447 0.8000 1.0000 1.5000 0.0000 Constraint 295 352 0.8000 1.0000 1.5000 0.0000 Constraint 295 343 0.8000 1.0000 1.5000 0.0000 Constraint 295 336 0.8000 1.0000 1.5000 0.0000 Constraint 295 331 0.8000 1.0000 1.5000 0.0000 Constraint 295 325 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 310 0.8000 1.0000 1.5000 0.0000 Constraint 295 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 729 0.8000 1.0000 1.5000 0.0000 Constraint 289 673 0.8000 1.0000 1.5000 0.0000 Constraint 289 658 0.8000 1.0000 1.5000 0.0000 Constraint 289 642 0.8000 1.0000 1.5000 0.0000 Constraint 289 635 0.8000 1.0000 1.5000 0.0000 Constraint 289 628 0.8000 1.0000 1.5000 0.0000 Constraint 289 619 0.8000 1.0000 1.5000 0.0000 Constraint 289 608 0.8000 1.0000 1.5000 0.0000 Constraint 289 598 0.8000 1.0000 1.5000 0.0000 Constraint 289 572 0.8000 1.0000 1.5000 0.0000 Constraint 289 563 0.8000 1.0000 1.5000 0.0000 Constraint 289 542 0.8000 1.0000 1.5000 0.0000 Constraint 289 518 0.8000 1.0000 1.5000 0.0000 Constraint 289 494 0.8000 1.0000 1.5000 0.0000 Constraint 289 486 0.8000 1.0000 1.5000 0.0000 Constraint 289 478 0.8000 1.0000 1.5000 0.0000 Constraint 289 471 0.8000 1.0000 1.5000 0.0000 Constraint 289 459 0.8000 1.0000 1.5000 0.0000 Constraint 289 452 0.8000 1.0000 1.5000 0.0000 Constraint 289 447 0.8000 1.0000 1.5000 0.0000 Constraint 289 439 0.8000 1.0000 1.5000 0.0000 Constraint 289 343 0.8000 1.0000 1.5000 0.0000 Constraint 289 336 0.8000 1.0000 1.5000 0.0000 Constraint 289 331 0.8000 1.0000 1.5000 0.0000 Constraint 289 325 0.8000 1.0000 1.5000 0.0000 Constraint 289 319 0.8000 1.0000 1.5000 0.0000 Constraint 289 310 0.8000 1.0000 1.5000 0.0000 Constraint 289 303 0.8000 1.0000 1.5000 0.0000 Constraint 289 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 729 0.8000 1.0000 1.5000 0.0000 Constraint 280 658 0.8000 1.0000 1.5000 0.0000 Constraint 280 642 0.8000 1.0000 1.5000 0.0000 Constraint 280 635 0.8000 1.0000 1.5000 0.0000 Constraint 280 628 0.8000 1.0000 1.5000 0.0000 Constraint 280 619 0.8000 1.0000 1.5000 0.0000 Constraint 280 608 0.8000 1.0000 1.5000 0.0000 Constraint 280 598 0.8000 1.0000 1.5000 0.0000 Constraint 280 587 0.8000 1.0000 1.5000 0.0000 Constraint 280 572 0.8000 1.0000 1.5000 0.0000 Constraint 280 563 0.8000 1.0000 1.5000 0.0000 Constraint 280 494 0.8000 1.0000 1.5000 0.0000 Constraint 280 478 0.8000 1.0000 1.5000 0.0000 Constraint 280 471 0.8000 1.0000 1.5000 0.0000 Constraint 280 459 0.8000 1.0000 1.5000 0.0000 Constraint 280 447 0.8000 1.0000 1.5000 0.0000 Constraint 280 374 0.8000 1.0000 1.5000 0.0000 Constraint 280 352 0.8000 1.0000 1.5000 0.0000 Constraint 280 336 0.8000 1.0000 1.5000 0.0000 Constraint 280 331 0.8000 1.0000 1.5000 0.0000 Constraint 280 325 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 310 0.8000 1.0000 1.5000 0.0000 Constraint 280 303 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 729 0.8000 1.0000 1.5000 0.0000 Constraint 273 628 0.8000 1.0000 1.5000 0.0000 Constraint 273 619 0.8000 1.0000 1.5000 0.0000 Constraint 273 598 0.8000 1.0000 1.5000 0.0000 Constraint 273 563 0.8000 1.0000 1.5000 0.0000 Constraint 273 478 0.8000 1.0000 1.5000 0.0000 Constraint 273 331 0.8000 1.0000 1.5000 0.0000 Constraint 273 325 0.8000 1.0000 1.5000 0.0000 Constraint 273 319 0.8000 1.0000 1.5000 0.0000 Constraint 273 310 0.8000 1.0000 1.5000 0.0000 Constraint 273 303 0.8000 1.0000 1.5000 0.0000 Constraint 273 295 0.8000 1.0000 1.5000 0.0000 Constraint 273 289 0.8000 1.0000 1.5000 0.0000 Constraint 273 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 642 0.8000 1.0000 1.5000 0.0000 Constraint 262 635 0.8000 1.0000 1.5000 0.0000 Constraint 262 628 0.8000 1.0000 1.5000 0.0000 Constraint 262 619 0.8000 1.0000 1.5000 0.0000 Constraint 262 608 0.8000 1.0000 1.5000 0.0000 Constraint 262 598 0.8000 1.0000 1.5000 0.0000 Constraint 262 587 0.8000 1.0000 1.5000 0.0000 Constraint 262 563 0.8000 1.0000 1.5000 0.0000 Constraint 262 459 0.8000 1.0000 1.5000 0.0000 Constraint 262 362 0.8000 1.0000 1.5000 0.0000 Constraint 262 352 0.8000 1.0000 1.5000 0.0000 Constraint 262 343 0.8000 1.0000 1.5000 0.0000 Constraint 262 331 0.8000 1.0000 1.5000 0.0000 Constraint 262 325 0.8000 1.0000 1.5000 0.0000 Constraint 262 319 0.8000 1.0000 1.5000 0.0000 Constraint 262 310 0.8000 1.0000 1.5000 0.0000 Constraint 262 303 0.8000 1.0000 1.5000 0.0000 Constraint 262 295 0.8000 1.0000 1.5000 0.0000 Constraint 262 289 0.8000 1.0000 1.5000 0.0000 Constraint 262 280 0.8000 1.0000 1.5000 0.0000 Constraint 262 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 628 0.8000 1.0000 1.5000 0.0000 Constraint 254 619 0.8000 1.0000 1.5000 0.0000 Constraint 254 374 0.8000 1.0000 1.5000 0.0000 Constraint 254 352 0.8000 1.0000 1.5000 0.0000 Constraint 254 343 0.8000 1.0000 1.5000 0.0000 Constraint 254 331 0.8000 1.0000 1.5000 0.0000 Constraint 254 325 0.8000 1.0000 1.5000 0.0000 Constraint 254 319 0.8000 1.0000 1.5000 0.0000 Constraint 254 310 0.8000 1.0000 1.5000 0.0000 Constraint 254 303 0.8000 1.0000 1.5000 0.0000 Constraint 254 295 0.8000 1.0000 1.5000 0.0000 Constraint 254 289 0.8000 1.0000 1.5000 0.0000 Constraint 254 280 0.8000 1.0000 1.5000 0.0000 Constraint 254 273 0.8000 1.0000 1.5000 0.0000 Constraint 254 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 642 0.8000 1.0000 1.5000 0.0000 Constraint 244 635 0.8000 1.0000 1.5000 0.0000 Constraint 244 628 0.8000 1.0000 1.5000 0.0000 Constraint 244 619 0.8000 1.0000 1.5000 0.0000 Constraint 244 608 0.8000 1.0000 1.5000 0.0000 Constraint 244 598 0.8000 1.0000 1.5000 0.0000 Constraint 244 587 0.8000 1.0000 1.5000 0.0000 Constraint 244 459 0.8000 1.0000 1.5000 0.0000 Constraint 244 374 0.8000 1.0000 1.5000 0.0000 Constraint 244 362 0.8000 1.0000 1.5000 0.0000 Constraint 244 352 0.8000 1.0000 1.5000 0.0000 Constraint 244 343 0.8000 1.0000 1.5000 0.0000 Constraint 244 336 0.8000 1.0000 1.5000 0.0000 Constraint 244 331 0.8000 1.0000 1.5000 0.0000 Constraint 244 325 0.8000 1.0000 1.5000 0.0000 Constraint 244 319 0.8000 1.0000 1.5000 0.0000 Constraint 244 310 0.8000 1.0000 1.5000 0.0000 Constraint 244 303 0.8000 1.0000 1.5000 0.0000 Constraint 244 295 0.8000 1.0000 1.5000 0.0000 Constraint 244 289 0.8000 1.0000 1.5000 0.0000 Constraint 244 280 0.8000 1.0000 1.5000 0.0000 Constraint 244 273 0.8000 1.0000 1.5000 0.0000 Constraint 244 262 0.8000 1.0000 1.5000 0.0000 Constraint 244 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 729 0.8000 1.0000 1.5000 0.0000 Constraint 237 642 0.8000 1.0000 1.5000 0.0000 Constraint 237 635 0.8000 1.0000 1.5000 0.0000 Constraint 237 628 0.8000 1.0000 1.5000 0.0000 Constraint 237 619 0.8000 1.0000 1.5000 0.0000 Constraint 237 608 0.8000 1.0000 1.5000 0.0000 Constraint 237 598 0.8000 1.0000 1.5000 0.0000 Constraint 237 587 0.8000 1.0000 1.5000 0.0000 Constraint 237 459 0.8000 1.0000 1.5000 0.0000 Constraint 237 393 0.8000 1.0000 1.5000 0.0000 Constraint 237 385 0.8000 1.0000 1.5000 0.0000 Constraint 237 374 0.8000 1.0000 1.5000 0.0000 Constraint 237 362 0.8000 1.0000 1.5000 0.0000 Constraint 237 352 0.8000 1.0000 1.5000 0.0000 Constraint 237 343 0.8000 1.0000 1.5000 0.0000 Constraint 237 336 0.8000 1.0000 1.5000 0.0000 Constraint 237 331 0.8000 1.0000 1.5000 0.0000 Constraint 237 325 0.8000 1.0000 1.5000 0.0000 Constraint 237 319 0.8000 1.0000 1.5000 0.0000 Constraint 237 310 0.8000 1.0000 1.5000 0.0000 Constraint 237 303 0.8000 1.0000 1.5000 0.0000 Constraint 237 295 0.8000 1.0000 1.5000 0.0000 Constraint 237 289 0.8000 1.0000 1.5000 0.0000 Constraint 237 280 0.8000 1.0000 1.5000 0.0000 Constraint 237 273 0.8000 1.0000 1.5000 0.0000 Constraint 237 262 0.8000 1.0000 1.5000 0.0000 Constraint 237 254 0.8000 1.0000 1.5000 0.0000 Constraint 237 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 729 0.8000 1.0000 1.5000 0.0000 Constraint 228 723 0.8000 1.0000 1.5000 0.0000 Constraint 228 642 0.8000 1.0000 1.5000 0.0000 Constraint 228 635 0.8000 1.0000 1.5000 0.0000 Constraint 228 628 0.8000 1.0000 1.5000 0.0000 Constraint 228 619 0.8000 1.0000 1.5000 0.0000 Constraint 228 608 0.8000 1.0000 1.5000 0.0000 Constraint 228 598 0.8000 1.0000 1.5000 0.0000 Constraint 228 587 0.8000 1.0000 1.5000 0.0000 Constraint 228 459 0.8000 1.0000 1.5000 0.0000 Constraint 228 452 0.8000 1.0000 1.5000 0.0000 Constraint 228 374 0.8000 1.0000 1.5000 0.0000 Constraint 228 362 0.8000 1.0000 1.5000 0.0000 Constraint 228 352 0.8000 1.0000 1.5000 0.0000 Constraint 228 343 0.8000 1.0000 1.5000 0.0000 Constraint 228 336 0.8000 1.0000 1.5000 0.0000 Constraint 228 331 0.8000 1.0000 1.5000 0.0000 Constraint 228 325 0.8000 1.0000 1.5000 0.0000 Constraint 228 319 0.8000 1.0000 1.5000 0.0000 Constraint 228 310 0.8000 1.0000 1.5000 0.0000 Constraint 228 303 0.8000 1.0000 1.5000 0.0000 Constraint 228 295 0.8000 1.0000 1.5000 0.0000 Constraint 228 289 0.8000 1.0000 1.5000 0.0000 Constraint 228 280 0.8000 1.0000 1.5000 0.0000 Constraint 228 273 0.8000 1.0000 1.5000 0.0000 Constraint 228 262 0.8000 1.0000 1.5000 0.0000 Constraint 228 254 0.8000 1.0000 1.5000 0.0000 Constraint 228 244 0.8000 1.0000 1.5000 0.0000 Constraint 228 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 729 0.8000 1.0000 1.5000 0.0000 Constraint 220 723 0.8000 1.0000 1.5000 0.0000 Constraint 220 642 0.8000 1.0000 1.5000 0.0000 Constraint 220 635 0.8000 1.0000 1.5000 0.0000 Constraint 220 628 0.8000 1.0000 1.5000 0.0000 Constraint 220 619 0.8000 1.0000 1.5000 0.0000 Constraint 220 608 0.8000 1.0000 1.5000 0.0000 Constraint 220 598 0.8000 1.0000 1.5000 0.0000 Constraint 220 587 0.8000 1.0000 1.5000 0.0000 Constraint 220 459 0.8000 1.0000 1.5000 0.0000 Constraint 220 374 0.8000 1.0000 1.5000 0.0000 Constraint 220 362 0.8000 1.0000 1.5000 0.0000 Constraint 220 352 0.8000 1.0000 1.5000 0.0000 Constraint 220 343 0.8000 1.0000 1.5000 0.0000 Constraint 220 336 0.8000 1.0000 1.5000 0.0000 Constraint 220 331 0.8000 1.0000 1.5000 0.0000 Constraint 220 325 0.8000 1.0000 1.5000 0.0000 Constraint 220 319 0.8000 1.0000 1.5000 0.0000 Constraint 220 310 0.8000 1.0000 1.5000 0.0000 Constraint 220 303 0.8000 1.0000 1.5000 0.0000 Constraint 220 280 0.8000 1.0000 1.5000 0.0000 Constraint 220 273 0.8000 1.0000 1.5000 0.0000 Constraint 220 262 0.8000 1.0000 1.5000 0.0000 Constraint 220 254 0.8000 1.0000 1.5000 0.0000 Constraint 220 244 0.8000 1.0000 1.5000 0.0000 Constraint 220 237 0.8000 1.0000 1.5000 0.0000 Constraint 220 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 729 0.8000 1.0000 1.5000 0.0000 Constraint 211 723 0.8000 1.0000 1.5000 0.0000 Constraint 211 716 0.8000 1.0000 1.5000 0.0000 Constraint 211 658 0.8000 1.0000 1.5000 0.0000 Constraint 211 650 0.8000 1.0000 1.5000 0.0000 Constraint 211 642 0.8000 1.0000 1.5000 0.0000 Constraint 211 635 0.8000 1.0000 1.5000 0.0000 Constraint 211 628 0.8000 1.0000 1.5000 0.0000 Constraint 211 619 0.8000 1.0000 1.5000 0.0000 Constraint 211 608 0.8000 1.0000 1.5000 0.0000 Constraint 211 598 0.8000 1.0000 1.5000 0.0000 Constraint 211 587 0.8000 1.0000 1.5000 0.0000 Constraint 211 579 0.8000 1.0000 1.5000 0.0000 Constraint 211 459 0.8000 1.0000 1.5000 0.0000 Constraint 211 452 0.8000 1.0000 1.5000 0.0000 Constraint 211 385 0.8000 1.0000 1.5000 0.0000 Constraint 211 374 0.8000 1.0000 1.5000 0.0000 Constraint 211 362 0.8000 1.0000 1.5000 0.0000 Constraint 211 352 0.8000 1.0000 1.5000 0.0000 Constraint 211 343 0.8000 1.0000 1.5000 0.0000 Constraint 211 336 0.8000 1.0000 1.5000 0.0000 Constraint 211 331 0.8000 1.0000 1.5000 0.0000 Constraint 211 325 0.8000 1.0000 1.5000 0.0000 Constraint 211 319 0.8000 1.0000 1.5000 0.0000 Constraint 211 310 0.8000 1.0000 1.5000 0.0000 Constraint 211 303 0.8000 1.0000 1.5000 0.0000 Constraint 211 295 0.8000 1.0000 1.5000 0.0000 Constraint 211 273 0.8000 1.0000 1.5000 0.0000 Constraint 211 262 0.8000 1.0000 1.5000 0.0000 Constraint 211 254 0.8000 1.0000 1.5000 0.0000 Constraint 211 244 0.8000 1.0000 1.5000 0.0000 Constraint 211 237 0.8000 1.0000 1.5000 0.0000 Constraint 211 228 0.8000 1.0000 1.5000 0.0000 Constraint 211 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 729 0.8000 1.0000 1.5000 0.0000 Constraint 202 723 0.8000 1.0000 1.5000 0.0000 Constraint 202 716 0.8000 1.0000 1.5000 0.0000 Constraint 202 658 0.8000 1.0000 1.5000 0.0000 Constraint 202 650 0.8000 1.0000 1.5000 0.0000 Constraint 202 642 0.8000 1.0000 1.5000 0.0000 Constraint 202 635 0.8000 1.0000 1.5000 0.0000 Constraint 202 628 0.8000 1.0000 1.5000 0.0000 Constraint 202 619 0.8000 1.0000 1.5000 0.0000 Constraint 202 608 0.8000 1.0000 1.5000 0.0000 Constraint 202 598 0.8000 1.0000 1.5000 0.0000 Constraint 202 587 0.8000 1.0000 1.5000 0.0000 Constraint 202 572 0.8000 1.0000 1.5000 0.0000 Constraint 202 471 0.8000 1.0000 1.5000 0.0000 Constraint 202 459 0.8000 1.0000 1.5000 0.0000 Constraint 202 452 0.8000 1.0000 1.5000 0.0000 Constraint 202 447 0.8000 1.0000 1.5000 0.0000 Constraint 202 374 0.8000 1.0000 1.5000 0.0000 Constraint 202 362 0.8000 1.0000 1.5000 0.0000 Constraint 202 352 0.8000 1.0000 1.5000 0.0000 Constraint 202 343 0.8000 1.0000 1.5000 0.0000 Constraint 202 336 0.8000 1.0000 1.5000 0.0000 Constraint 202 331 0.8000 1.0000 1.5000 0.0000 Constraint 202 325 0.8000 1.0000 1.5000 0.0000 Constraint 202 319 0.8000 1.0000 1.5000 0.0000 Constraint 202 310 0.8000 1.0000 1.5000 0.0000 Constraint 202 303 0.8000 1.0000 1.5000 0.0000 Constraint 202 262 0.8000 1.0000 1.5000 0.0000 Constraint 202 254 0.8000 1.0000 1.5000 0.0000 Constraint 202 244 0.8000 1.0000 1.5000 0.0000 Constraint 202 237 0.8000 1.0000 1.5000 0.0000 Constraint 202 228 0.8000 1.0000 1.5000 0.0000 Constraint 202 220 0.8000 1.0000 1.5000 0.0000 Constraint 202 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 716 0.8000 1.0000 1.5000 0.0000 Constraint 194 650 0.8000 1.0000 1.5000 0.0000 Constraint 194 642 0.8000 1.0000 1.5000 0.0000 Constraint 194 635 0.8000 1.0000 1.5000 0.0000 Constraint 194 628 0.8000 1.0000 1.5000 0.0000 Constraint 194 619 0.8000 1.0000 1.5000 0.0000 Constraint 194 608 0.8000 1.0000 1.5000 0.0000 Constraint 194 598 0.8000 1.0000 1.5000 0.0000 Constraint 194 587 0.8000 1.0000 1.5000 0.0000 Constraint 194 459 0.8000 1.0000 1.5000 0.0000 Constraint 194 452 0.8000 1.0000 1.5000 0.0000 Constraint 194 385 0.8000 1.0000 1.5000 0.0000 Constraint 194 374 0.8000 1.0000 1.5000 0.0000 Constraint 194 362 0.8000 1.0000 1.5000 0.0000 Constraint 194 352 0.8000 1.0000 1.5000 0.0000 Constraint 194 343 0.8000 1.0000 1.5000 0.0000 Constraint 194 336 0.8000 1.0000 1.5000 0.0000 Constraint 194 331 0.8000 1.0000 1.5000 0.0000 Constraint 194 325 0.8000 1.0000 1.5000 0.0000 Constraint 194 319 0.8000 1.0000 1.5000 0.0000 Constraint 194 310 0.8000 1.0000 1.5000 0.0000 Constraint 194 303 0.8000 1.0000 1.5000 0.0000 Constraint 194 254 0.8000 1.0000 1.5000 0.0000 Constraint 194 244 0.8000 1.0000 1.5000 0.0000 Constraint 194 237 0.8000 1.0000 1.5000 0.0000 Constraint 194 228 0.8000 1.0000 1.5000 0.0000 Constraint 194 220 0.8000 1.0000 1.5000 0.0000 Constraint 194 211 0.8000 1.0000 1.5000 0.0000 Constraint 194 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 729 0.8000 1.0000 1.5000 0.0000 Constraint 182 723 0.8000 1.0000 1.5000 0.0000 Constraint 182 716 0.8000 1.0000 1.5000 0.0000 Constraint 182 658 0.8000 1.0000 1.5000 0.0000 Constraint 182 650 0.8000 1.0000 1.5000 0.0000 Constraint 182 642 0.8000 1.0000 1.5000 0.0000 Constraint 182 635 0.8000 1.0000 1.5000 0.0000 Constraint 182 628 0.8000 1.0000 1.5000 0.0000 Constraint 182 619 0.8000 1.0000 1.5000 0.0000 Constraint 182 608 0.8000 1.0000 1.5000 0.0000 Constraint 182 598 0.8000 1.0000 1.5000 0.0000 Constraint 182 587 0.8000 1.0000 1.5000 0.0000 Constraint 182 459 0.8000 1.0000 1.5000 0.0000 Constraint 182 385 0.8000 1.0000 1.5000 0.0000 Constraint 182 374 0.8000 1.0000 1.5000 0.0000 Constraint 182 362 0.8000 1.0000 1.5000 0.0000 Constraint 182 352 0.8000 1.0000 1.5000 0.0000 Constraint 182 343 0.8000 1.0000 1.5000 0.0000 Constraint 182 336 0.8000 1.0000 1.5000 0.0000 Constraint 182 331 0.8000 1.0000 1.5000 0.0000 Constraint 182 325 0.8000 1.0000 1.5000 0.0000 Constraint 182 319 0.8000 1.0000 1.5000 0.0000 Constraint 182 310 0.8000 1.0000 1.5000 0.0000 Constraint 182 303 0.8000 1.0000 1.5000 0.0000 Constraint 182 295 0.8000 1.0000 1.5000 0.0000 Constraint 182 244 0.8000 1.0000 1.5000 0.0000 Constraint 182 237 0.8000 1.0000 1.5000 0.0000 Constraint 182 228 0.8000 1.0000 1.5000 0.0000 Constraint 182 220 0.8000 1.0000 1.5000 0.0000 Constraint 182 211 0.8000 1.0000 1.5000 0.0000 Constraint 182 202 0.8000 1.0000 1.5000 0.0000 Constraint 182 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 729 0.8000 1.0000 1.5000 0.0000 Constraint 170 723 0.8000 1.0000 1.5000 0.0000 Constraint 170 716 0.8000 1.0000 1.5000 0.0000 Constraint 170 642 0.8000 1.0000 1.5000 0.0000 Constraint 170 635 0.8000 1.0000 1.5000 0.0000 Constraint 170 628 0.8000 1.0000 1.5000 0.0000 Constraint 170 619 0.8000 1.0000 1.5000 0.0000 Constraint 170 608 0.8000 1.0000 1.5000 0.0000 Constraint 170 598 0.8000 1.0000 1.5000 0.0000 Constraint 170 459 0.8000 1.0000 1.5000 0.0000 Constraint 170 374 0.8000 1.0000 1.5000 0.0000 Constraint 170 362 0.8000 1.0000 1.5000 0.0000 Constraint 170 352 0.8000 1.0000 1.5000 0.0000 Constraint 170 343 0.8000 1.0000 1.5000 0.0000 Constraint 170 336 0.8000 1.0000 1.5000 0.0000 Constraint 170 331 0.8000 1.0000 1.5000 0.0000 Constraint 170 325 0.8000 1.0000 1.5000 0.0000 Constraint 170 319 0.8000 1.0000 1.5000 0.0000 Constraint 170 310 0.8000 1.0000 1.5000 0.0000 Constraint 170 237 0.8000 1.0000 1.5000 0.0000 Constraint 170 228 0.8000 1.0000 1.5000 0.0000 Constraint 170 220 0.8000 1.0000 1.5000 0.0000 Constraint 170 211 0.8000 1.0000 1.5000 0.0000 Constraint 170 202 0.8000 1.0000 1.5000 0.0000 Constraint 170 194 0.8000 1.0000 1.5000 0.0000 Constraint 170 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 729 0.8000 1.0000 1.5000 0.0000 Constraint 161 658 0.8000 1.0000 1.5000 0.0000 Constraint 161 642 0.8000 1.0000 1.5000 0.0000 Constraint 161 635 0.8000 1.0000 1.5000 0.0000 Constraint 161 628 0.8000 1.0000 1.5000 0.0000 Constraint 161 619 0.8000 1.0000 1.5000 0.0000 Constraint 161 608 0.8000 1.0000 1.5000 0.0000 Constraint 161 598 0.8000 1.0000 1.5000 0.0000 Constraint 161 478 0.8000 1.0000 1.5000 0.0000 Constraint 161 459 0.8000 1.0000 1.5000 0.0000 Constraint 161 374 0.8000 1.0000 1.5000 0.0000 Constraint 161 362 0.8000 1.0000 1.5000 0.0000 Constraint 161 352 0.8000 1.0000 1.5000 0.0000 Constraint 161 343 0.8000 1.0000 1.5000 0.0000 Constraint 161 331 0.8000 1.0000 1.5000 0.0000 Constraint 161 325 0.8000 1.0000 1.5000 0.0000 Constraint 161 319 0.8000 1.0000 1.5000 0.0000 Constraint 161 310 0.8000 1.0000 1.5000 0.0000 Constraint 161 220 0.8000 1.0000 1.5000 0.0000 Constraint 161 211 0.8000 1.0000 1.5000 0.0000 Constraint 161 202 0.8000 1.0000 1.5000 0.0000 Constraint 161 194 0.8000 1.0000 1.5000 0.0000 Constraint 161 182 0.8000 1.0000 1.5000 0.0000 Constraint 161 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 729 0.8000 1.0000 1.5000 0.0000 Constraint 153 723 0.8000 1.0000 1.5000 0.0000 Constraint 153 716 0.8000 1.0000 1.5000 0.0000 Constraint 153 707 0.8000 1.0000 1.5000 0.0000 Constraint 153 628 0.8000 1.0000 1.5000 0.0000 Constraint 153 619 0.8000 1.0000 1.5000 0.0000 Constraint 153 352 0.8000 1.0000 1.5000 0.0000 Constraint 153 319 0.8000 1.0000 1.5000 0.0000 Constraint 153 211 0.8000 1.0000 1.5000 0.0000 Constraint 153 202 0.8000 1.0000 1.5000 0.0000 Constraint 153 194 0.8000 1.0000 1.5000 0.0000 Constraint 153 182 0.8000 1.0000 1.5000 0.0000 Constraint 153 170 0.8000 1.0000 1.5000 0.0000 Constraint 153 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 729 0.8000 1.0000 1.5000 0.0000 Constraint 146 707 0.8000 1.0000 1.5000 0.0000 Constraint 146 681 0.8000 1.0000 1.5000 0.0000 Constraint 146 673 0.8000 1.0000 1.5000 0.0000 Constraint 146 658 0.8000 1.0000 1.5000 0.0000 Constraint 146 494 0.8000 1.0000 1.5000 0.0000 Constraint 146 478 0.8000 1.0000 1.5000 0.0000 Constraint 146 447 0.8000 1.0000 1.5000 0.0000 Constraint 146 202 0.8000 1.0000 1.5000 0.0000 Constraint 146 194 0.8000 1.0000 1.5000 0.0000 Constraint 146 182 0.8000 1.0000 1.5000 0.0000 Constraint 146 170 0.8000 1.0000 1.5000 0.0000 Constraint 146 161 0.8000 1.0000 1.5000 0.0000 Constraint 146 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 729 0.8000 1.0000 1.5000 0.0000 Constraint 138 707 0.8000 1.0000 1.5000 0.0000 Constraint 138 494 0.8000 1.0000 1.5000 0.0000 Constraint 138 478 0.8000 1.0000 1.5000 0.0000 Constraint 138 194 0.8000 1.0000 1.5000 0.0000 Constraint 138 182 0.8000 1.0000 1.5000 0.0000 Constraint 138 170 0.8000 1.0000 1.5000 0.0000 Constraint 138 161 0.8000 1.0000 1.5000 0.0000 Constraint 138 153 0.8000 1.0000 1.5000 0.0000 Constraint 138 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 729 0.8000 1.0000 1.5000 0.0000 Constraint 126 723 0.8000 1.0000 1.5000 0.0000 Constraint 126 716 0.8000 1.0000 1.5000 0.0000 Constraint 126 707 0.8000 1.0000 1.5000 0.0000 Constraint 126 692 0.8000 1.0000 1.5000 0.0000 Constraint 126 518 0.8000 1.0000 1.5000 0.0000 Constraint 126 507 0.8000 1.0000 1.5000 0.0000 Constraint 126 494 0.8000 1.0000 1.5000 0.0000 Constraint 126 478 0.8000 1.0000 1.5000 0.0000 Constraint 126 244 0.8000 1.0000 1.5000 0.0000 Constraint 126 237 0.8000 1.0000 1.5000 0.0000 Constraint 126 228 0.8000 1.0000 1.5000 0.0000 Constraint 126 220 0.8000 1.0000 1.5000 0.0000 Constraint 126 211 0.8000 1.0000 1.5000 0.0000 Constraint 126 202 0.8000 1.0000 1.5000 0.0000 Constraint 126 194 0.8000 1.0000 1.5000 0.0000 Constraint 126 182 0.8000 1.0000 1.5000 0.0000 Constraint 126 170 0.8000 1.0000 1.5000 0.0000 Constraint 126 161 0.8000 1.0000 1.5000 0.0000 Constraint 126 153 0.8000 1.0000 1.5000 0.0000 Constraint 126 146 0.8000 1.0000 1.5000 0.0000 Constraint 126 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 729 0.8000 1.0000 1.5000 0.0000 Constraint 113 723 0.8000 1.0000 1.5000 0.0000 Constraint 113 716 0.8000 1.0000 1.5000 0.0000 Constraint 113 707 0.8000 1.0000 1.5000 0.0000 Constraint 113 692 0.8000 1.0000 1.5000 0.0000 Constraint 113 681 0.8000 1.0000 1.5000 0.0000 Constraint 113 673 0.8000 1.0000 1.5000 0.0000 Constraint 113 658 0.8000 1.0000 1.5000 0.0000 Constraint 113 542 0.8000 1.0000 1.5000 0.0000 Constraint 113 518 0.8000 1.0000 1.5000 0.0000 Constraint 113 507 0.8000 1.0000 1.5000 0.0000 Constraint 113 494 0.8000 1.0000 1.5000 0.0000 Constraint 113 486 0.8000 1.0000 1.5000 0.0000 Constraint 113 478 0.8000 1.0000 1.5000 0.0000 Constraint 113 447 0.8000 1.0000 1.5000 0.0000 Constraint 113 439 0.8000 1.0000 1.5000 0.0000 Constraint 113 431 0.8000 1.0000 1.5000 0.0000 Constraint 113 422 0.8000 1.0000 1.5000 0.0000 Constraint 113 414 0.8000 1.0000 1.5000 0.0000 Constraint 113 402 0.8000 1.0000 1.5000 0.0000 Constraint 113 393 0.8000 1.0000 1.5000 0.0000 Constraint 113 262 0.8000 1.0000 1.5000 0.0000 Constraint 113 254 0.8000 1.0000 1.5000 0.0000 Constraint 113 244 0.8000 1.0000 1.5000 0.0000 Constraint 113 237 0.8000 1.0000 1.5000 0.0000 Constraint 113 228 0.8000 1.0000 1.5000 0.0000 Constraint 113 220 0.8000 1.0000 1.5000 0.0000 Constraint 113 211 0.8000 1.0000 1.5000 0.0000 Constraint 113 202 0.8000 1.0000 1.5000 0.0000 Constraint 113 194 0.8000 1.0000 1.5000 0.0000 Constraint 113 182 0.8000 1.0000 1.5000 0.0000 Constraint 113 170 0.8000 1.0000 1.5000 0.0000 Constraint 113 161 0.8000 1.0000 1.5000 0.0000 Constraint 113 153 0.8000 1.0000 1.5000 0.0000 Constraint 113 146 0.8000 1.0000 1.5000 0.0000 Constraint 113 138 0.8000 1.0000 1.5000 0.0000 Constraint 113 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 729 0.8000 1.0000 1.5000 0.0000 Constraint 106 723 0.8000 1.0000 1.5000 0.0000 Constraint 106 716 0.8000 1.0000 1.5000 0.0000 Constraint 106 707 0.8000 1.0000 1.5000 0.0000 Constraint 106 692 0.8000 1.0000 1.5000 0.0000 Constraint 106 681 0.8000 1.0000 1.5000 0.0000 Constraint 106 673 0.8000 1.0000 1.5000 0.0000 Constraint 106 665 0.8000 1.0000 1.5000 0.0000 Constraint 106 658 0.8000 1.0000 1.5000 0.0000 Constraint 106 525 0.8000 1.0000 1.5000 0.0000 Constraint 106 518 0.8000 1.0000 1.5000 0.0000 Constraint 106 507 0.8000 1.0000 1.5000 0.0000 Constraint 106 494 0.8000 1.0000 1.5000 0.0000 Constraint 106 486 0.8000 1.0000 1.5000 0.0000 Constraint 106 478 0.8000 1.0000 1.5000 0.0000 Constraint 106 471 0.8000 1.0000 1.5000 0.0000 Constraint 106 447 0.8000 1.0000 1.5000 0.0000 Constraint 106 439 0.8000 1.0000 1.5000 0.0000 Constraint 106 431 0.8000 1.0000 1.5000 0.0000 Constraint 106 422 0.8000 1.0000 1.5000 0.0000 Constraint 106 414 0.8000 1.0000 1.5000 0.0000 Constraint 106 402 0.8000 1.0000 1.5000 0.0000 Constraint 106 393 0.8000 1.0000 1.5000 0.0000 Constraint 106 280 0.8000 1.0000 1.5000 0.0000 Constraint 106 262 0.8000 1.0000 1.5000 0.0000 Constraint 106 254 0.8000 1.0000 1.5000 0.0000 Constraint 106 244 0.8000 1.0000 1.5000 0.0000 Constraint 106 237 0.8000 1.0000 1.5000 0.0000 Constraint 106 228 0.8000 1.0000 1.5000 0.0000 Constraint 106 220 0.8000 1.0000 1.5000 0.0000 Constraint 106 211 0.8000 1.0000 1.5000 0.0000 Constraint 106 202 0.8000 1.0000 1.5000 0.0000 Constraint 106 194 0.8000 1.0000 1.5000 0.0000 Constraint 106 182 0.8000 1.0000 1.5000 0.0000 Constraint 106 170 0.8000 1.0000 1.5000 0.0000 Constraint 106 161 0.8000 1.0000 1.5000 0.0000 Constraint 106 153 0.8000 1.0000 1.5000 0.0000 Constraint 106 146 0.8000 1.0000 1.5000 0.0000 Constraint 106 138 0.8000 1.0000 1.5000 0.0000 Constraint 106 126 0.8000 1.0000 1.5000 0.0000 Constraint 106 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 729 0.8000 1.0000 1.5000 0.0000 Constraint 98 723 0.8000 1.0000 1.5000 0.0000 Constraint 98 716 0.8000 1.0000 1.5000 0.0000 Constraint 98 707 0.8000 1.0000 1.5000 0.0000 Constraint 98 692 0.8000 1.0000 1.5000 0.0000 Constraint 98 681 0.8000 1.0000 1.5000 0.0000 Constraint 98 673 0.8000 1.0000 1.5000 0.0000 Constraint 98 665 0.8000 1.0000 1.5000 0.0000 Constraint 98 658 0.8000 1.0000 1.5000 0.0000 Constraint 98 551 0.8000 1.0000 1.5000 0.0000 Constraint 98 542 0.8000 1.0000 1.5000 0.0000 Constraint 98 533 0.8000 1.0000 1.5000 0.0000 Constraint 98 525 0.8000 1.0000 1.5000 0.0000 Constraint 98 518 0.8000 1.0000 1.5000 0.0000 Constraint 98 507 0.8000 1.0000 1.5000 0.0000 Constraint 98 494 0.8000 1.0000 1.5000 0.0000 Constraint 98 486 0.8000 1.0000 1.5000 0.0000 Constraint 98 478 0.8000 1.0000 1.5000 0.0000 Constraint 98 471 0.8000 1.0000 1.5000 0.0000 Constraint 98 447 0.8000 1.0000 1.5000 0.0000 Constraint 98 439 0.8000 1.0000 1.5000 0.0000 Constraint 98 431 0.8000 1.0000 1.5000 0.0000 Constraint 98 422 0.8000 1.0000 1.5000 0.0000 Constraint 98 414 0.8000 1.0000 1.5000 0.0000 Constraint 98 402 0.8000 1.0000 1.5000 0.0000 Constraint 98 393 0.8000 1.0000 1.5000 0.0000 Constraint 98 280 0.8000 1.0000 1.5000 0.0000 Constraint 98 262 0.8000 1.0000 1.5000 0.0000 Constraint 98 254 0.8000 1.0000 1.5000 0.0000 Constraint 98 244 0.8000 1.0000 1.5000 0.0000 Constraint 98 237 0.8000 1.0000 1.5000 0.0000 Constraint 98 228 0.8000 1.0000 1.5000 0.0000 Constraint 98 220 0.8000 1.0000 1.5000 0.0000 Constraint 98 211 0.8000 1.0000 1.5000 0.0000 Constraint 98 202 0.8000 1.0000 1.5000 0.0000 Constraint 98 194 0.8000 1.0000 1.5000 0.0000 Constraint 98 182 0.8000 1.0000 1.5000 0.0000 Constraint 98 170 0.8000 1.0000 1.5000 0.0000 Constraint 98 161 0.8000 1.0000 1.5000 0.0000 Constraint 98 153 0.8000 1.0000 1.5000 0.0000 Constraint 98 146 0.8000 1.0000 1.5000 0.0000 Constraint 98 138 0.8000 1.0000 1.5000 0.0000 Constraint 98 126 0.8000 1.0000 1.5000 0.0000 Constraint 98 113 0.8000 1.0000 1.5000 0.0000 Constraint 98 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 729 0.8000 1.0000 1.5000 0.0000 Constraint 89 723 0.8000 1.0000 1.5000 0.0000 Constraint 89 716 0.8000 1.0000 1.5000 0.0000 Constraint 89 707 0.8000 1.0000 1.5000 0.0000 Constraint 89 692 0.8000 1.0000 1.5000 0.0000 Constraint 89 681 0.8000 1.0000 1.5000 0.0000 Constraint 89 673 0.8000 1.0000 1.5000 0.0000 Constraint 89 542 0.8000 1.0000 1.5000 0.0000 Constraint 89 533 0.8000 1.0000 1.5000 0.0000 Constraint 89 525 0.8000 1.0000 1.5000 0.0000 Constraint 89 518 0.8000 1.0000 1.5000 0.0000 Constraint 89 507 0.8000 1.0000 1.5000 0.0000 Constraint 89 494 0.8000 1.0000 1.5000 0.0000 Constraint 89 486 0.8000 1.0000 1.5000 0.0000 Constraint 89 478 0.8000 1.0000 1.5000 0.0000 Constraint 89 439 0.8000 1.0000 1.5000 0.0000 Constraint 89 422 0.8000 1.0000 1.5000 0.0000 Constraint 89 414 0.8000 1.0000 1.5000 0.0000 Constraint 89 402 0.8000 1.0000 1.5000 0.0000 Constraint 89 393 0.8000 1.0000 1.5000 0.0000 Constraint 89 289 0.8000 1.0000 1.5000 0.0000 Constraint 89 280 0.8000 1.0000 1.5000 0.0000 Constraint 89 262 0.8000 1.0000 1.5000 0.0000 Constraint 89 254 0.8000 1.0000 1.5000 0.0000 Constraint 89 244 0.8000 1.0000 1.5000 0.0000 Constraint 89 237 0.8000 1.0000 1.5000 0.0000 Constraint 89 228 0.8000 1.0000 1.5000 0.0000 Constraint 89 220 0.8000 1.0000 1.5000 0.0000 Constraint 89 211 0.8000 1.0000 1.5000 0.0000 Constraint 89 202 0.8000 1.0000 1.5000 0.0000 Constraint 89 194 0.8000 1.0000 1.5000 0.0000 Constraint 89 182 0.8000 1.0000 1.5000 0.0000 Constraint 89 170 0.8000 1.0000 1.5000 0.0000 Constraint 89 161 0.8000 1.0000 1.5000 0.0000 Constraint 89 146 0.8000 1.0000 1.5000 0.0000 Constraint 89 138 0.8000 1.0000 1.5000 0.0000 Constraint 89 126 0.8000 1.0000 1.5000 0.0000 Constraint 89 113 0.8000 1.0000 1.5000 0.0000 Constraint 89 106 0.8000 1.0000 1.5000 0.0000 Constraint 89 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 729 0.8000 1.0000 1.5000 0.0000 Constraint 82 723 0.8000 1.0000 1.5000 0.0000 Constraint 82 716 0.8000 1.0000 1.5000 0.0000 Constraint 82 707 0.8000 1.0000 1.5000 0.0000 Constraint 82 692 0.8000 1.0000 1.5000 0.0000 Constraint 82 681 0.8000 1.0000 1.5000 0.0000 Constraint 82 673 0.8000 1.0000 1.5000 0.0000 Constraint 82 563 0.8000 1.0000 1.5000 0.0000 Constraint 82 542 0.8000 1.0000 1.5000 0.0000 Constraint 82 533 0.8000 1.0000 1.5000 0.0000 Constraint 82 525 0.8000 1.0000 1.5000 0.0000 Constraint 82 518 0.8000 1.0000 1.5000 0.0000 Constraint 82 507 0.8000 1.0000 1.5000 0.0000 Constraint 82 494 0.8000 1.0000 1.5000 0.0000 Constraint 82 478 0.8000 1.0000 1.5000 0.0000 Constraint 82 439 0.8000 1.0000 1.5000 0.0000 Constraint 82 422 0.8000 1.0000 1.5000 0.0000 Constraint 82 402 0.8000 1.0000 1.5000 0.0000 Constraint 82 280 0.8000 1.0000 1.5000 0.0000 Constraint 82 262 0.8000 1.0000 1.5000 0.0000 Constraint 82 254 0.8000 1.0000 1.5000 0.0000 Constraint 82 244 0.8000 1.0000 1.5000 0.0000 Constraint 82 237 0.8000 1.0000 1.5000 0.0000 Constraint 82 228 0.8000 1.0000 1.5000 0.0000 Constraint 82 220 0.8000 1.0000 1.5000 0.0000 Constraint 82 211 0.8000 1.0000 1.5000 0.0000 Constraint 82 202 0.8000 1.0000 1.5000 0.0000 Constraint 82 194 0.8000 1.0000 1.5000 0.0000 Constraint 82 182 0.8000 1.0000 1.5000 0.0000 Constraint 82 170 0.8000 1.0000 1.5000 0.0000 Constraint 82 161 0.8000 1.0000 1.5000 0.0000 Constraint 82 138 0.8000 1.0000 1.5000 0.0000 Constraint 82 126 0.8000 1.0000 1.5000 0.0000 Constraint 82 113 0.8000 1.0000 1.5000 0.0000 Constraint 82 106 0.8000 1.0000 1.5000 0.0000 Constraint 82 98 0.8000 1.0000 1.5000 0.0000 Constraint 82 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 729 0.8000 1.0000 1.5000 0.0000 Constraint 74 723 0.8000 1.0000 1.5000 0.0000 Constraint 74 716 0.8000 1.0000 1.5000 0.0000 Constraint 74 707 0.8000 1.0000 1.5000 0.0000 Constraint 74 692 0.8000 1.0000 1.5000 0.0000 Constraint 74 563 0.8000 1.0000 1.5000 0.0000 Constraint 74 542 0.8000 1.0000 1.5000 0.0000 Constraint 74 533 0.8000 1.0000 1.5000 0.0000 Constraint 74 525 0.8000 1.0000 1.5000 0.0000 Constraint 74 518 0.8000 1.0000 1.5000 0.0000 Constraint 74 507 0.8000 1.0000 1.5000 0.0000 Constraint 74 494 0.8000 1.0000 1.5000 0.0000 Constraint 74 478 0.8000 1.0000 1.5000 0.0000 Constraint 74 280 0.8000 1.0000 1.5000 0.0000 Constraint 74 262 0.8000 1.0000 1.5000 0.0000 Constraint 74 244 0.8000 1.0000 1.5000 0.0000 Constraint 74 237 0.8000 1.0000 1.5000 0.0000 Constraint 74 228 0.8000 1.0000 1.5000 0.0000 Constraint 74 220 0.8000 1.0000 1.5000 0.0000 Constraint 74 211 0.8000 1.0000 1.5000 0.0000 Constraint 74 202 0.8000 1.0000 1.5000 0.0000 Constraint 74 194 0.8000 1.0000 1.5000 0.0000 Constraint 74 182 0.8000 1.0000 1.5000 0.0000 Constraint 74 170 0.8000 1.0000 1.5000 0.0000 Constraint 74 161 0.8000 1.0000 1.5000 0.0000 Constraint 74 126 0.8000 1.0000 1.5000 0.0000 Constraint 74 113 0.8000 1.0000 1.5000 0.0000 Constraint 74 106 0.8000 1.0000 1.5000 0.0000 Constraint 74 98 0.8000 1.0000 1.5000 0.0000 Constraint 74 89 0.8000 1.0000 1.5000 0.0000 Constraint 74 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 729 0.8000 1.0000 1.5000 0.0000 Constraint 65 723 0.8000 1.0000 1.5000 0.0000 Constraint 65 707 0.8000 1.0000 1.5000 0.0000 Constraint 65 692 0.8000 1.0000 1.5000 0.0000 Constraint 65 598 0.8000 1.0000 1.5000 0.0000 Constraint 65 587 0.8000 1.0000 1.5000 0.0000 Constraint 65 563 0.8000 1.0000 1.5000 0.0000 Constraint 65 556 0.8000 1.0000 1.5000 0.0000 Constraint 65 542 0.8000 1.0000 1.5000 0.0000 Constraint 65 533 0.8000 1.0000 1.5000 0.0000 Constraint 65 525 0.8000 1.0000 1.5000 0.0000 Constraint 65 518 0.8000 1.0000 1.5000 0.0000 Constraint 65 507 0.8000 1.0000 1.5000 0.0000 Constraint 65 494 0.8000 1.0000 1.5000 0.0000 Constraint 65 478 0.8000 1.0000 1.5000 0.0000 Constraint 65 319 0.8000 1.0000 1.5000 0.0000 Constraint 65 310 0.8000 1.0000 1.5000 0.0000 Constraint 65 303 0.8000 1.0000 1.5000 0.0000 Constraint 65 289 0.8000 1.0000 1.5000 0.0000 Constraint 65 280 0.8000 1.0000 1.5000 0.0000 Constraint 65 244 0.8000 1.0000 1.5000 0.0000 Constraint 65 237 0.8000 1.0000 1.5000 0.0000 Constraint 65 228 0.8000 1.0000 1.5000 0.0000 Constraint 65 220 0.8000 1.0000 1.5000 0.0000 Constraint 65 211 0.8000 1.0000 1.5000 0.0000 Constraint 65 202 0.8000 1.0000 1.5000 0.0000 Constraint 65 194 0.8000 1.0000 1.5000 0.0000 Constraint 65 182 0.8000 1.0000 1.5000 0.0000 Constraint 65 170 0.8000 1.0000 1.5000 0.0000 Constraint 65 161 0.8000 1.0000 1.5000 0.0000 Constraint 65 146 0.8000 1.0000 1.5000 0.0000 Constraint 65 126 0.8000 1.0000 1.5000 0.0000 Constraint 65 113 0.8000 1.0000 1.5000 0.0000 Constraint 65 106 0.8000 1.0000 1.5000 0.0000 Constraint 65 98 0.8000 1.0000 1.5000 0.0000 Constraint 65 89 0.8000 1.0000 1.5000 0.0000 Constraint 65 82 0.8000 1.0000 1.5000 0.0000 Constraint 65 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 729 0.8000 1.0000 1.5000 0.0000 Constraint 58 707 0.8000 1.0000 1.5000 0.0000 Constraint 58 598 0.8000 1.0000 1.5000 0.0000 Constraint 58 587 0.8000 1.0000 1.5000 0.0000 Constraint 58 563 0.8000 1.0000 1.5000 0.0000 Constraint 58 556 0.8000 1.0000 1.5000 0.0000 Constraint 58 542 0.8000 1.0000 1.5000 0.0000 Constraint 58 533 0.8000 1.0000 1.5000 0.0000 Constraint 58 525 0.8000 1.0000 1.5000 0.0000 Constraint 58 518 0.8000 1.0000 1.5000 0.0000 Constraint 58 507 0.8000 1.0000 1.5000 0.0000 Constraint 58 319 0.8000 1.0000 1.5000 0.0000 Constraint 58 310 0.8000 1.0000 1.5000 0.0000 Constraint 58 244 0.8000 1.0000 1.5000 0.0000 Constraint 58 237 0.8000 1.0000 1.5000 0.0000 Constraint 58 228 0.8000 1.0000 1.5000 0.0000 Constraint 58 220 0.8000 1.0000 1.5000 0.0000 Constraint 58 211 0.8000 1.0000 1.5000 0.0000 Constraint 58 202 0.8000 1.0000 1.5000 0.0000 Constraint 58 194 0.8000 1.0000 1.5000 0.0000 Constraint 58 182 0.8000 1.0000 1.5000 0.0000 Constraint 58 161 0.8000 1.0000 1.5000 0.0000 Constraint 58 113 0.8000 1.0000 1.5000 0.0000 Constraint 58 106 0.8000 1.0000 1.5000 0.0000 Constraint 58 98 0.8000 1.0000 1.5000 0.0000 Constraint 58 89 0.8000 1.0000 1.5000 0.0000 Constraint 58 82 0.8000 1.0000 1.5000 0.0000 Constraint 58 74 0.8000 1.0000 1.5000 0.0000 Constraint 58 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 729 0.8000 1.0000 1.5000 0.0000 Constraint 50 707 0.8000 1.0000 1.5000 0.0000 Constraint 50 619 0.8000 1.0000 1.5000 0.0000 Constraint 50 598 0.8000 1.0000 1.5000 0.0000 Constraint 50 587 0.8000 1.0000 1.5000 0.0000 Constraint 50 563 0.8000 1.0000 1.5000 0.0000 Constraint 50 556 0.8000 1.0000 1.5000 0.0000 Constraint 50 551 0.8000 1.0000 1.5000 0.0000 Constraint 50 542 0.8000 1.0000 1.5000 0.0000 Constraint 50 533 0.8000 1.0000 1.5000 0.0000 Constraint 50 525 0.8000 1.0000 1.5000 0.0000 Constraint 50 518 0.8000 1.0000 1.5000 0.0000 Constraint 50 507 0.8000 1.0000 1.5000 0.0000 Constraint 50 402 0.8000 1.0000 1.5000 0.0000 Constraint 50 325 0.8000 1.0000 1.5000 0.0000 Constraint 50 319 0.8000 1.0000 1.5000 0.0000 Constraint 50 310 0.8000 1.0000 1.5000 0.0000 Constraint 50 303 0.8000 1.0000 1.5000 0.0000 Constraint 50 295 0.8000 1.0000 1.5000 0.0000 Constraint 50 289 0.8000 1.0000 1.5000 0.0000 Constraint 50 280 0.8000 1.0000 1.5000 0.0000 Constraint 50 262 0.8000 1.0000 1.5000 0.0000 Constraint 50 244 0.8000 1.0000 1.5000 0.0000 Constraint 50 237 0.8000 1.0000 1.5000 0.0000 Constraint 50 228 0.8000 1.0000 1.5000 0.0000 Constraint 50 220 0.8000 1.0000 1.5000 0.0000 Constraint 50 211 0.8000 1.0000 1.5000 0.0000 Constraint 50 202 0.8000 1.0000 1.5000 0.0000 Constraint 50 194 0.8000 1.0000 1.5000 0.0000 Constraint 50 182 0.8000 1.0000 1.5000 0.0000 Constraint 50 170 0.8000 1.0000 1.5000 0.0000 Constraint 50 161 0.8000 1.0000 1.5000 0.0000 Constraint 50 153 0.8000 1.0000 1.5000 0.0000 Constraint 50 146 0.8000 1.0000 1.5000 0.0000 Constraint 50 113 0.8000 1.0000 1.5000 0.0000 Constraint 50 106 0.8000 1.0000 1.5000 0.0000 Constraint 50 98 0.8000 1.0000 1.5000 0.0000 Constraint 50 89 0.8000 1.0000 1.5000 0.0000 Constraint 50 82 0.8000 1.0000 1.5000 0.0000 Constraint 50 74 0.8000 1.0000 1.5000 0.0000 Constraint 50 65 0.8000 1.0000 1.5000 0.0000 Constraint 50 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 619 0.8000 1.0000 1.5000 0.0000 Constraint 39 608 0.8000 1.0000 1.5000 0.0000 Constraint 39 598 0.8000 1.0000 1.5000 0.0000 Constraint 39 587 0.8000 1.0000 1.5000 0.0000 Constraint 39 579 0.8000 1.0000 1.5000 0.0000 Constraint 39 572 0.8000 1.0000 1.5000 0.0000 Constraint 39 563 0.8000 1.0000 1.5000 0.0000 Constraint 39 556 0.8000 1.0000 1.5000 0.0000 Constraint 39 551 0.8000 1.0000 1.5000 0.0000 Constraint 39 542 0.8000 1.0000 1.5000 0.0000 Constraint 39 533 0.8000 1.0000 1.5000 0.0000 Constraint 39 525 0.8000 1.0000 1.5000 0.0000 Constraint 39 518 0.8000 1.0000 1.5000 0.0000 Constraint 39 507 0.8000 1.0000 1.5000 0.0000 Constraint 39 471 0.8000 1.0000 1.5000 0.0000 Constraint 39 325 0.8000 1.0000 1.5000 0.0000 Constraint 39 319 0.8000 1.0000 1.5000 0.0000 Constraint 39 310 0.8000 1.0000 1.5000 0.0000 Constraint 39 303 0.8000 1.0000 1.5000 0.0000 Constraint 39 289 0.8000 1.0000 1.5000 0.0000 Constraint 39 280 0.8000 1.0000 1.5000 0.0000 Constraint 39 237 0.8000 1.0000 1.5000 0.0000 Constraint 39 228 0.8000 1.0000 1.5000 0.0000 Constraint 39 220 0.8000 1.0000 1.5000 0.0000 Constraint 39 211 0.8000 1.0000 1.5000 0.0000 Constraint 39 202 0.8000 1.0000 1.5000 0.0000 Constraint 39 194 0.8000 1.0000 1.5000 0.0000 Constraint 39 182 0.8000 1.0000 1.5000 0.0000 Constraint 39 170 0.8000 1.0000 1.5000 0.0000 Constraint 39 161 0.8000 1.0000 1.5000 0.0000 Constraint 39 146 0.8000 1.0000 1.5000 0.0000 Constraint 39 113 0.8000 1.0000 1.5000 0.0000 Constraint 39 106 0.8000 1.0000 1.5000 0.0000 Constraint 39 98 0.8000 1.0000 1.5000 0.0000 Constraint 39 89 0.8000 1.0000 1.5000 0.0000 Constraint 39 82 0.8000 1.0000 1.5000 0.0000 Constraint 39 74 0.8000 1.0000 1.5000 0.0000 Constraint 39 65 0.8000 1.0000 1.5000 0.0000 Constraint 39 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 628 0.8000 1.0000 1.5000 0.0000 Constraint 32 619 0.8000 1.0000 1.5000 0.0000 Constraint 32 608 0.8000 1.0000 1.5000 0.0000 Constraint 32 598 0.8000 1.0000 1.5000 0.0000 Constraint 32 587 0.8000 1.0000 1.5000 0.0000 Constraint 32 579 0.8000 1.0000 1.5000 0.0000 Constraint 32 572 0.8000 1.0000 1.5000 0.0000 Constraint 32 563 0.8000 1.0000 1.5000 0.0000 Constraint 32 556 0.8000 1.0000 1.5000 0.0000 Constraint 32 551 0.8000 1.0000 1.5000 0.0000 Constraint 32 542 0.8000 1.0000 1.5000 0.0000 Constraint 32 533 0.8000 1.0000 1.5000 0.0000 Constraint 32 525 0.8000 1.0000 1.5000 0.0000 Constraint 32 518 0.8000 1.0000 1.5000 0.0000 Constraint 32 402 0.8000 1.0000 1.5000 0.0000 Constraint 32 352 0.8000 1.0000 1.5000 0.0000 Constraint 32 343 0.8000 1.0000 1.5000 0.0000 Constraint 32 336 0.8000 1.0000 1.5000 0.0000 Constraint 32 331 0.8000 1.0000 1.5000 0.0000 Constraint 32 325 0.8000 1.0000 1.5000 0.0000 Constraint 32 319 0.8000 1.0000 1.5000 0.0000 Constraint 32 310 0.8000 1.0000 1.5000 0.0000 Constraint 32 303 0.8000 1.0000 1.5000 0.0000 Constraint 32 295 0.8000 1.0000 1.5000 0.0000 Constraint 32 289 0.8000 1.0000 1.5000 0.0000 Constraint 32 280 0.8000 1.0000 1.5000 0.0000 Constraint 32 228 0.8000 1.0000 1.5000 0.0000 Constraint 32 220 0.8000 1.0000 1.5000 0.0000 Constraint 32 211 0.8000 1.0000 1.5000 0.0000 Constraint 32 202 0.8000 1.0000 1.5000 0.0000 Constraint 32 182 0.8000 1.0000 1.5000 0.0000 Constraint 32 161 0.8000 1.0000 1.5000 0.0000 Constraint 32 153 0.8000 1.0000 1.5000 0.0000 Constraint 32 146 0.8000 1.0000 1.5000 0.0000 Constraint 32 138 0.8000 1.0000 1.5000 0.0000 Constraint 32 126 0.8000 1.0000 1.5000 0.0000 Constraint 32 113 0.8000 1.0000 1.5000 0.0000 Constraint 32 106 0.8000 1.0000 1.5000 0.0000 Constraint 32 98 0.8000 1.0000 1.5000 0.0000 Constraint 32 89 0.8000 1.0000 1.5000 0.0000 Constraint 32 82 0.8000 1.0000 1.5000 0.0000 Constraint 32 74 0.8000 1.0000 1.5000 0.0000 Constraint 32 65 0.8000 1.0000 1.5000 0.0000 Constraint 32 58 0.8000 1.0000 1.5000 0.0000 Constraint 32 50 0.8000 1.0000 1.5000 0.0000 Constraint 32 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 635 0.8000 1.0000 1.5000 0.0000 Constraint 23 628 0.8000 1.0000 1.5000 0.0000 Constraint 23 619 0.8000 1.0000 1.5000 0.0000 Constraint 23 608 0.8000 1.0000 1.5000 0.0000 Constraint 23 598 0.8000 1.0000 1.5000 0.0000 Constraint 23 587 0.8000 1.0000 1.5000 0.0000 Constraint 23 579 0.8000 1.0000 1.5000 0.0000 Constraint 23 572 0.8000 1.0000 1.5000 0.0000 Constraint 23 563 0.8000 1.0000 1.5000 0.0000 Constraint 23 556 0.8000 1.0000 1.5000 0.0000 Constraint 23 551 0.8000 1.0000 1.5000 0.0000 Constraint 23 542 0.8000 1.0000 1.5000 0.0000 Constraint 23 533 0.8000 1.0000 1.5000 0.0000 Constraint 23 525 0.8000 1.0000 1.5000 0.0000 Constraint 23 518 0.8000 1.0000 1.5000 0.0000 Constraint 23 507 0.8000 1.0000 1.5000 0.0000 Constraint 23 486 0.8000 1.0000 1.5000 0.0000 Constraint 23 478 0.8000 1.0000 1.5000 0.0000 Constraint 23 471 0.8000 1.0000 1.5000 0.0000 Constraint 23 459 0.8000 1.0000 1.5000 0.0000 Constraint 23 452 0.8000 1.0000 1.5000 0.0000 Constraint 23 352 0.8000 1.0000 1.5000 0.0000 Constraint 23 343 0.8000 1.0000 1.5000 0.0000 Constraint 23 336 0.8000 1.0000 1.5000 0.0000 Constraint 23 331 0.8000 1.0000 1.5000 0.0000 Constraint 23 325 0.8000 1.0000 1.5000 0.0000 Constraint 23 319 0.8000 1.0000 1.5000 0.0000 Constraint 23 310 0.8000 1.0000 1.5000 0.0000 Constraint 23 303 0.8000 1.0000 1.5000 0.0000 Constraint 23 295 0.8000 1.0000 1.5000 0.0000 Constraint 23 289 0.8000 1.0000 1.5000 0.0000 Constraint 23 280 0.8000 1.0000 1.5000 0.0000 Constraint 23 254 0.8000 1.0000 1.5000 0.0000 Constraint 23 220 0.8000 1.0000 1.5000 0.0000 Constraint 23 194 0.8000 1.0000 1.5000 0.0000 Constraint 23 182 0.8000 1.0000 1.5000 0.0000 Constraint 23 161 0.8000 1.0000 1.5000 0.0000 Constraint 23 153 0.8000 1.0000 1.5000 0.0000 Constraint 23 146 0.8000 1.0000 1.5000 0.0000 Constraint 23 138 0.8000 1.0000 1.5000 0.0000 Constraint 23 126 0.8000 1.0000 1.5000 0.0000 Constraint 23 113 0.8000 1.0000 1.5000 0.0000 Constraint 23 106 0.8000 1.0000 1.5000 0.0000 Constraint 23 98 0.8000 1.0000 1.5000 0.0000 Constraint 23 89 0.8000 1.0000 1.5000 0.0000 Constraint 23 82 0.8000 1.0000 1.5000 0.0000 Constraint 23 74 0.8000 1.0000 1.5000 0.0000 Constraint 23 65 0.8000 1.0000 1.5000 0.0000 Constraint 23 58 0.8000 1.0000 1.5000 0.0000 Constraint 23 50 0.8000 1.0000 1.5000 0.0000 Constraint 23 39 0.8000 1.0000 1.5000 0.0000 Constraint 23 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 642 0.8000 1.0000 1.5000 0.0000 Constraint 17 635 0.8000 1.0000 1.5000 0.0000 Constraint 17 628 0.8000 1.0000 1.5000 0.0000 Constraint 17 619 0.8000 1.0000 1.5000 0.0000 Constraint 17 608 0.8000 1.0000 1.5000 0.0000 Constraint 17 598 0.8000 1.0000 1.5000 0.0000 Constraint 17 587 0.8000 1.0000 1.5000 0.0000 Constraint 17 579 0.8000 1.0000 1.5000 0.0000 Constraint 17 572 0.8000 1.0000 1.5000 0.0000 Constraint 17 563 0.8000 1.0000 1.5000 0.0000 Constraint 17 556 0.8000 1.0000 1.5000 0.0000 Constraint 17 551 0.8000 1.0000 1.5000 0.0000 Constraint 17 542 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 525 0.8000 1.0000 1.5000 0.0000 Constraint 17 518 0.8000 1.0000 1.5000 0.0000 Constraint 17 507 0.8000 1.0000 1.5000 0.0000 Constraint 17 471 0.8000 1.0000 1.5000 0.0000 Constraint 17 459 0.8000 1.0000 1.5000 0.0000 Constraint 17 452 0.8000 1.0000 1.5000 0.0000 Constraint 17 352 0.8000 1.0000 1.5000 0.0000 Constraint 17 343 0.8000 1.0000 1.5000 0.0000 Constraint 17 331 0.8000 1.0000 1.5000 0.0000 Constraint 17 325 0.8000 1.0000 1.5000 0.0000 Constraint 17 319 0.8000 1.0000 1.5000 0.0000 Constraint 17 310 0.8000 1.0000 1.5000 0.0000 Constraint 17 303 0.8000 1.0000 1.5000 0.0000 Constraint 17 295 0.8000 1.0000 1.5000 0.0000 Constraint 17 289 0.8000 1.0000 1.5000 0.0000 Constraint 17 280 0.8000 1.0000 1.5000 0.0000 Constraint 17 220 0.8000 1.0000 1.5000 0.0000 Constraint 17 182 0.8000 1.0000 1.5000 0.0000 Constraint 17 153 0.8000 1.0000 1.5000 0.0000 Constraint 17 146 0.8000 1.0000 1.5000 0.0000 Constraint 17 138 0.8000 1.0000 1.5000 0.0000 Constraint 17 126 0.8000 1.0000 1.5000 0.0000 Constraint 17 113 0.8000 1.0000 1.5000 0.0000 Constraint 17 106 0.8000 1.0000 1.5000 0.0000 Constraint 17 98 0.8000 1.0000 1.5000 0.0000 Constraint 17 89 0.8000 1.0000 1.5000 0.0000 Constraint 17 82 0.8000 1.0000 1.5000 0.0000 Constraint 17 74 0.8000 1.0000 1.5000 0.0000 Constraint 17 65 0.8000 1.0000 1.5000 0.0000 Constraint 17 58 0.8000 1.0000 1.5000 0.0000 Constraint 17 50 0.8000 1.0000 1.5000 0.0000 Constraint 17 39 0.8000 1.0000 1.5000 0.0000 Constraint 17 32 0.8000 1.0000 1.5000 0.0000 Constraint 17 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 729 0.8000 1.0000 1.5000 0.0000 Constraint 9 642 0.8000 1.0000 1.5000 0.0000 Constraint 9 635 0.8000 1.0000 1.5000 0.0000 Constraint 9 628 0.8000 1.0000 1.5000 0.0000 Constraint 9 619 0.8000 1.0000 1.5000 0.0000 Constraint 9 608 0.8000 1.0000 1.5000 0.0000 Constraint 9 598 0.8000 1.0000 1.5000 0.0000 Constraint 9 587 0.8000 1.0000 1.5000 0.0000 Constraint 9 579 0.8000 1.0000 1.5000 0.0000 Constraint 9 572 0.8000 1.0000 1.5000 0.0000 Constraint 9 563 0.8000 1.0000 1.5000 0.0000 Constraint 9 556 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 542 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 525 0.8000 1.0000 1.5000 0.0000 Constraint 9 518 0.8000 1.0000 1.5000 0.0000 Constraint 9 507 0.8000 1.0000 1.5000 0.0000 Constraint 9 486 0.8000 1.0000 1.5000 0.0000 Constraint 9 471 0.8000 1.0000 1.5000 0.0000 Constraint 9 459 0.8000 1.0000 1.5000 0.0000 Constraint 9 452 0.8000 1.0000 1.5000 0.0000 Constraint 9 431 0.8000 1.0000 1.5000 0.0000 Constraint 9 352 0.8000 1.0000 1.5000 0.0000 Constraint 9 343 0.8000 1.0000 1.5000 0.0000 Constraint 9 336 0.8000 1.0000 1.5000 0.0000 Constraint 9 331 0.8000 1.0000 1.5000 0.0000 Constraint 9 325 0.8000 1.0000 1.5000 0.0000 Constraint 9 319 0.8000 1.0000 1.5000 0.0000 Constraint 9 310 0.8000 1.0000 1.5000 0.0000 Constraint 9 303 0.8000 1.0000 1.5000 0.0000 Constraint 9 295 0.8000 1.0000 1.5000 0.0000 Constraint 9 289 0.8000 1.0000 1.5000 0.0000 Constraint 9 280 0.8000 1.0000 1.5000 0.0000 Constraint 9 254 0.8000 1.0000 1.5000 0.0000 Constraint 9 244 0.8000 1.0000 1.5000 0.0000 Constraint 9 237 0.8000 1.0000 1.5000 0.0000 Constraint 9 228 0.8000 1.0000 1.5000 0.0000 Constraint 9 220 0.8000 1.0000 1.5000 0.0000 Constraint 9 182 0.8000 1.0000 1.5000 0.0000 Constraint 9 161 0.8000 1.0000 1.5000 0.0000 Constraint 9 153 0.8000 1.0000 1.5000 0.0000 Constraint 9 146 0.8000 1.0000 1.5000 0.0000 Constraint 9 138 0.8000 1.0000 1.5000 0.0000 Constraint 9 126 0.8000 1.0000 1.5000 0.0000 Constraint 9 113 0.8000 1.0000 1.5000 0.0000 Constraint 9 106 0.8000 1.0000 1.5000 0.0000 Constraint 9 98 0.8000 1.0000 1.5000 0.0000 Constraint 9 89 0.8000 1.0000 1.5000 0.0000 Constraint 9 82 0.8000 1.0000 1.5000 0.0000 Constraint 9 74 0.8000 1.0000 1.5000 0.0000 Constraint 9 65 0.8000 1.0000 1.5000 0.0000 Constraint 9 58 0.8000 1.0000 1.5000 0.0000 Constraint 9 50 0.8000 1.0000 1.5000 0.0000 Constraint 9 39 0.8000 1.0000 1.5000 0.0000 Constraint 9 32 0.8000 1.0000 1.5000 0.0000 Constraint 9 23 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 729 0.8000 1.0000 1.5000 0.0000 Constraint 3 723 0.8000 1.0000 1.5000 0.0000 Constraint 3 650 0.8000 1.0000 1.5000 0.0000 Constraint 3 642 0.8000 1.0000 1.5000 0.0000 Constraint 3 635 0.8000 1.0000 1.5000 0.0000 Constraint 3 628 0.8000 1.0000 1.5000 0.0000 Constraint 3 619 0.8000 1.0000 1.5000 0.0000 Constraint 3 608 0.8000 1.0000 1.5000 0.0000 Constraint 3 598 0.8000 1.0000 1.5000 0.0000 Constraint 3 587 0.8000 1.0000 1.5000 0.0000 Constraint 3 579 0.8000 1.0000 1.5000 0.0000 Constraint 3 572 0.8000 1.0000 1.5000 0.0000 Constraint 3 563 0.8000 1.0000 1.5000 0.0000 Constraint 3 556 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 542 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 525 0.8000 1.0000 1.5000 0.0000 Constraint 3 518 0.8000 1.0000 1.5000 0.0000 Constraint 3 507 0.8000 1.0000 1.5000 0.0000 Constraint 3 494 0.8000 1.0000 1.5000 0.0000 Constraint 3 486 0.8000 1.0000 1.5000 0.0000 Constraint 3 478 0.8000 1.0000 1.5000 0.0000 Constraint 3 471 0.8000 1.0000 1.5000 0.0000 Constraint 3 459 0.8000 1.0000 1.5000 0.0000 Constraint 3 452 0.8000 1.0000 1.5000 0.0000 Constraint 3 447 0.8000 1.0000 1.5000 0.0000 Constraint 3 439 0.8000 1.0000 1.5000 0.0000 Constraint 3 431 0.8000 1.0000 1.5000 0.0000 Constraint 3 352 0.8000 1.0000 1.5000 0.0000 Constraint 3 343 0.8000 1.0000 1.5000 0.0000 Constraint 3 336 0.8000 1.0000 1.5000 0.0000 Constraint 3 331 0.8000 1.0000 1.5000 0.0000 Constraint 3 325 0.8000 1.0000 1.5000 0.0000 Constraint 3 319 0.8000 1.0000 1.5000 0.0000 Constraint 3 310 0.8000 1.0000 1.5000 0.0000 Constraint 3 303 0.8000 1.0000 1.5000 0.0000 Constraint 3 289 0.8000 1.0000 1.5000 0.0000 Constraint 3 280 0.8000 1.0000 1.5000 0.0000 Constraint 3 262 0.8000 1.0000 1.5000 0.0000 Constraint 3 254 0.8000 1.0000 1.5000 0.0000 Constraint 3 244 0.8000 1.0000 1.5000 0.0000 Constraint 3 237 0.8000 1.0000 1.5000 0.0000 Constraint 3 228 0.8000 1.0000 1.5000 0.0000 Constraint 3 220 0.8000 1.0000 1.5000 0.0000 Constraint 3 211 0.8000 1.0000 1.5000 0.0000 Constraint 3 202 0.8000 1.0000 1.5000 0.0000 Constraint 3 194 0.8000 1.0000 1.5000 0.0000 Constraint 3 182 0.8000 1.0000 1.5000 0.0000 Constraint 3 170 0.8000 1.0000 1.5000 0.0000 Constraint 3 161 0.8000 1.0000 1.5000 0.0000 Constraint 3 153 0.8000 1.0000 1.5000 0.0000 Constraint 3 146 0.8000 1.0000 1.5000 0.0000 Constraint 3 138 0.8000 1.0000 1.5000 0.0000 Constraint 3 126 0.8000 1.0000 1.5000 0.0000 Constraint 3 113 0.8000 1.0000 1.5000 0.0000 Constraint 3 106 0.8000 1.0000 1.5000 0.0000 Constraint 3 98 0.8000 1.0000 1.5000 0.0000 Constraint 3 89 0.8000 1.0000 1.5000 0.0000 Constraint 3 82 0.8000 1.0000 1.5000 0.0000 Constraint 3 74 0.8000 1.0000 1.5000 0.0000 Constraint 3 65 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 50 0.8000 1.0000 1.5000 0.0000 Constraint 3 39 0.8000 1.0000 1.5000 0.0000 Constraint 3 32 0.8000 1.0000 1.5000 0.0000 Constraint 3 23 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: