# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0349/ # command:# Making conformation for sequence T0349 numbered 1 through 75 Created new target T0349 from T0349.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0349/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0349//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0349//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f06A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f06A expands to /projects/compbio/data/pdb/2f06.pdb.gz 2f06A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 22, because occupancy 0.5 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 26, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 28, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 30, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 32, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 308, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 312, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 344, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 348, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 350, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 352, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 354, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 356, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 358, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 360, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 746, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 750, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 752, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 754, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 756, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 758, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 760, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 762, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 773, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 777, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 779, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 781, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 783, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 785, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 850, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 854, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 856, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 858, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 860, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1051, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1055, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1057, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1059, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1061, because occupancy 0.500 <= existing 0.500 in 2f06A # T0349 read from 2f06A/merged-good-all-a2m # 2f06A read from 2f06A/merged-good-all-a2m # adding 2f06A to template set # found chain 2f06A in template set Warning: unaligning (T0349)R47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)G47 Warning: unaligning (T0349)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G47 T0349 13 :LSAVGALLDGADIGHLVLD 2f06A 17 :LTEVTEVLAKENINLSALC # choosing archetypes in rotamer library T0349 43 :VIP 2f06A 36 :IAE T0349 46 :R 2f06A 45 :L T0349 49 :LVH 2f06A 48 :IVS T0349 54 :DLAGARRLLTDAGLA 2f06A 51 :DPDKAYKALKDNHFA Number of specific fragments extracted= 5 number of extra gaps= 1 total=5 Number of alignments=1 # 2f06A read from 2f06A/merged-good-all-a2m # found chain 2f06A in template set Warning: unaligning (T0349)L12 because of BadResidue code BAD_PEPTIDE at template residue (2f06A)R16 Warning: unaligning (T0349)S35 because of BadResidue code BAD_PEPTIDE in next template residue (2f06A)I44 Warning: unaligning (T0349)I36 because of BadResidue code BAD_PEPTIDE at template residue (2f06A)I44 Warning: unaligning (T0349)R47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)G47 Warning: unaligning (T0349)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G47 T0349 13 :LSAVGALLDGADIGHLVLD 2f06A 17 :LTEVTEVLAKENINLSALC T0349 32 :QNM 2f06A 40 :ADF T0349 37 :L 2f06A 45 :L T0349 49 :LVH 2f06A 48 :IVS T0349 54 :DLAGARRLLTDAGLAHE 2f06A 51 :DPDKAYKALKDNHFAVN Number of specific fragments extracted= 5 number of extra gaps= 3 total=10 Number of alignments=2 # 2f06A read from 2f06A/merged-good-all-a2m # found chain 2f06A in template set Warning: unaligning (T0349)D9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)S14 Warning: unaligning (T0349)A10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)S14 Warning: unaligning (T0349)V11 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G15 Warning: unaligning (T0349)L12 because of BadResidue code BAD_PEPTIDE at template residue (2f06A)R16 Warning: unaligning (T0349)R47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)G47 Warning: unaligning (T0349)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G47 T0349 8 :N 2f06A 12 :N T0349 13 :LSAVGALLDGADIGH 2f06A 17 :LTEVTEVLAKENINL T0349 32 :QNMSILEGSL 2f06A 32 :SALCIAENAD T0349 46 :R 2f06A 45 :L T0349 49 :LVHE 2f06A 48 :IVSD T0349 55 :LAGARRLLTDAGLA 2f06A 52 :PDKAYKALKDNHFA Number of specific fragments extracted= 6 number of extra gaps= 2 total=16 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ve1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ve1A expands to /projects/compbio/data/pdb/1ve1.pdb.gz 1ve1A:# T0349 read from 1ve1A/merged-good-all-a2m # 1ve1A read from 1ve1A/merged-good-all-a2m # adding 1ve1A to template set # found chain 1ve1A in template set T0349 9 :DAVLLSAVGALLDG 1ve1A 177 :GGTITGVGRYLKER T0349 23 :ADIGHLVLD 1ve1A 192 :PHVKVIAVE T0349 32 :QNMSILEGS 1ve1A 202 :ARSNVLSGG T0349 41 :LGVIPRRVLVHEDD 1ve1A 231 :LSLLDGVIQVWEED T0349 55 :LAGARRLLTDAGLA 1ve1A 246 :FPLARRLAREEGLF Number of specific fragments extracted= 5 number of extra gaps= 0 total=21 Number of alignments=4 # 1ve1A read from 1ve1A/merged-good-all-a2m # found chain 1ve1A in template set T0349 8 :NDAVLLSAVGALLDG 1ve1A 176 :TGGTITGVGRYLKER T0349 23 :ADIGHLVLD 1ve1A 192 :PHVKVIAVE T0349 32 :QNMSILEGS 1ve1A 202 :ARSNVLSGG T0349 41 :LGVIPRRVLVHEDD 1ve1A 231 :LSLLDGVIQVWEED T0349 55 :LAGARRLLTDAGLA 1ve1A 246 :FPLARRLAREEGLF Number of specific fragments extracted= 5 number of extra gaps= 0 total=26 Number of alignments=5 # 1ve1A read from 1ve1A/merged-good-all-a2m # found chain 1ve1A in template set T0349 7 :TNDAVLLSAVGALLDGA 1ve1A 174 :SGTGGTITGVGRYLKER T0349 24 :DIGHLVLD 1ve1A 193 :HVKVIAVE T0349 32 :QNMSILEGS 1ve1A 202 :ARSNVLSGG T0349 41 :LGVIPRRVLVHEDD 1ve1A 231 :LSLLDGVIQVWEED T0349 55 :LAGARRLLTDAGLA 1ve1A 246 :FPLARRLAREEGLF Number of specific fragments extracted= 5 number of extra gaps= 0 total=31 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gt1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gt1A expands to /projects/compbio/data/pdb/1gt1.pdb.gz 1gt1A:# T0349 read from 1gt1A/merged-good-all-a2m # 1gt1A read from 1gt1A/merged-good-all-a2m # adding 1gt1A to template set # found chain 1gt1A in template set T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1gt1A 124 :VEDEDLEKFWKLTEDKGIDKKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=32 Number of alignments=7 # 1gt1A read from 1gt1A/merged-good-all-a2m # found chain 1gt1A in template set T0349 31 :DQNMSILEGSLGV 1gt1A 107 :DKHGQTTELTELF T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHEL 1gt1A 120 :VKLNVEDEDLEKFWKLTEDKGIDKKN Number of specific fragments extracted= 2 number of extra gaps= 0 total=34 Number of alignments=8 # 1gt1A read from 1gt1A/merged-good-all-a2m # found chain 1gt1A in template set T0349 50 :VHEDDLAGARRLLTDAGLAHE 1gt1A 124 :VEDEDLEKFWKLTEDKGIDKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=35 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gnkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gnkA expands to /projects/compbio/data/pdb/1gnk.pdb.gz 1gnkA:# T0349 read from 1gnkA/merged-good-all-a2m # 1gnkA read from 1gnkA/merged-good-all-a2m # adding 1gnkA to template set # found chain 1gnkA in template set T0349 48 :VLVHEDDLAGARRLLTDAGLA 1gnkA 6 :VIIKPFKLEDVREALSSIGIQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=36 Number of alignments=10 # 1gnkA read from 1gnkA/merged-good-all-a2m # found chain 1gnkA in template set Warning: unaligning (T0349)L41 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1gnkA)V53 T0349 16 :VGALLDGADIGHLVLD 1gnkA 16 :VREALSSIGIQGLTVT T0349 42 :GVIPR 1gnkA 54 :NFLPK T0349 47 :RVLVHEDDLAGARRLLTDAG 1gnkA 62 :DVAIADDQLDEVIDIVSKAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=39 Number of alignments=11 # 1gnkA read from 1gnkA/merged-good-all-a2m # found chain 1gnkA in template set T0349 48 :VLVHEDDLAGARRLLTDAGLAH 1gnkA 6 :VIIKPFKLEDVREALSSIGIQG Number of specific fragments extracted= 1 number of extra gaps= 0 total=40 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yj7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yj7A expands to /projects/compbio/data/pdb/1yj7.pdb.gz 1yj7A:Skipped atom 32, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 34, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 36, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 38, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 40, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 132, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 134, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 136, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 138, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 140, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 805, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 807, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 1136, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 1138, because occupancy 0.500 <= existing 0.500 in 1yj7A # T0349 read from 1yj7A/merged-good-all-a2m # 1yj7A read from 1yj7A/merged-good-all-a2m # adding 1yj7A to template set # found chain 1yj7A in template set T0349 13 :LSAVGALLDGADIGH 1yj7A 33 :ANQMQALLLSNDVNV T0349 28 :LVLDQNMS 1yj7A 49 :KEMDKSGN T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHEL 1yj7A 57 :MTLSVAAADFVRAITILNNNGFPKKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=13 # 1yj7A read from 1yj7A/merged-good-all-a2m # found chain 1yj7A in template set T0349 10 :AVLLSAVGALLDGADIGHL 1yj7A 30 :EKEANQMQALLLSNDVNVS T0349 29 :VLDQNMS 1yj7A 50 :EMDKSGN T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHEL 1yj7A 57 :MTLSVAAADFVRAITILNNNGFPKKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=46 Number of alignments=14 # 1yj7A read from 1yj7A/merged-good-all-a2m # found chain 1yj7A in template set T0349 1 :MRELLRTN 1yj7A 20 :MKEQLYTG T0349 9 :DAVLLSAVGALLDGADIG 1yj7A 29 :TEKEANQMQALLLSNDVN T0349 30 :LDQN 1yj7A 51 :MDKS T0349 39 :G 1yj7A 55 :G T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 1yj7A 56 :NMTLSVAAADFVRAITILNNNGFPKK T0349 74 :D 1yj7A 82 :K Number of specific fragments extracted= 6 number of extra gaps= 0 total=52 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nm2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nm2A expands to /projects/compbio/data/pdb/1nm2.pdb.gz 1nm2A:# T0349 read from 1nm2A/merged-good-all-a2m # 1nm2A read from 1nm2A/merged-good-all-a2m # adding 1nm2A to template set # found chain 1nm2A in template set T0349 13 :LSAVGALLDGADIGHLVLDQNMSILEG 1nm2A 257 :WDLCMETFKELGVTAIIEVCPGGTLTG T0349 40 :SLGVIPRRVLVHEDDLAGARRLLTDA 1nm2A 288 :ALPGVKTLALKTPDDLDAARELVAEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=54 Number of alignments=16 # 1nm2A read from 1nm2A/merged-good-all-a2m # found chain 1nm2A in template set T0349 13 :LSAVGALLDGADIGHLVLDQNMSILEG 1nm2A 257 :WDLCMETFKELGVTAIIEVCPGGTLTG T0349 40 :SLGVIPRRVLVHEDDLAGARRLLTDA 1nm2A 288 :ALPGVKTLALKTPDDLDAARELVAEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=56 Number of alignments=17 # 1nm2A read from 1nm2A/merged-good-all-a2m # found chain 1nm2A in template set T0349 8 :NDAVLLSAVGALLDGADIGHLVLDQNMSILEG 1nm2A 252 :ANPVRWDLCMETFKELGVTAIIEVCPGGTLTG T0349 40 :SLGVIPRRVLVHEDDLAGARRLLTDA 1nm2A 288 :ALPGVKTLALKTPDDLDAARELVAEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=58 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ipd/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ipd expands to /projects/compbio/data/pdb/1ipd.pdb.gz 1ipd:Warning: there is no chain 1ipd will retry with 1ipdA # T0349 read from 1ipd/merged-good-all-a2m # 1ipd read from 1ipd/merged-good-all-a2m # adding 1ipd to template set # found chain 1ipd in template set T0349 11 :VLLSAVGALLDGADIGHLVLDQNMS 1ipd 164 :RVARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1ipd 189 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=60 Number of alignments=19 # 1ipd read from 1ipd/merged-good-all-a2m # found chain 1ipd in template set T0349 11 :VLLSAVGALLDGADIGHLVLDQNMSI 1ipd 164 :RVARVAFEAARKRRKHVVSVDKANVL T0349 53 :DDLAGARRLLTDA 1ipd 190 :EVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=62 Number of alignments=20 # 1ipd read from 1ipd/merged-good-all-a2m # found chain 1ipd in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1ipd 165 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1ipd 189 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=64 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1a3yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1a3yA expands to /projects/compbio/data/pdb/1a3y.pdb.gz 1a3yA:# T0349 read from 1a3yA/merged-good-all-a2m # 1a3yA read from 1a3yA/merged-good-all-a2m # adding 1a3yA to template set # found chain 1a3yA in template set T0349 44 :IPRRVL 1a3yA 114 :MTGLLG T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1a3yA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=22 # 1a3yA read from 1a3yA/merged-good-all-a2m # found chain 1a3yA in template set T0349 35 :SILEGSLGV 1a3yA 112 :TIMTGLLGK T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1a3yA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=68 Number of alignments=23 # 1a3yA read from 1a3yA/merged-good-all-a2m # found chain 1a3yA in template set T0349 50 :VHEDDLAGARRLLTDAGLAHE 1a3yA 124 :IEDQDLEKFKEVTRENGIPEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=69 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qd9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qd9A expands to /projects/compbio/data/pdb/1qd9.pdb.gz 1qd9A:Skipped atom 598, because occupancy 0.230 <= existing 0.770 in 1qd9A Skipped atom 600, because occupancy 0.230 <= existing 0.770 in 1qd9A Skipped atom 602, because occupancy 0.230 <= existing 0.770 in 1qd9A # T0349 read from 1qd9A/merged-good-all-a2m # 1qd9A read from 1qd9A/merged-good-all-a2m # adding 1qd9A to template set # found chain 1qd9A in template set T0349 6 :RTNDAVLLSAVGALLDGADIGH 1qd9A 47 :KEQTHQVFSNLKAVLEEAGASF T0349 42 :GVIPRRVLV 1qd9A 70 :TVVKATVFI T0349 51 :HEDDLAGARRLLTDA 1qd9A 80 :DMEQFAEVNEVYGQY Number of specific fragments extracted= 3 number of extra gaps= 0 total=72 Number of alignments=25 # 1qd9A read from 1qd9A/merged-good-all-a2m # found chain 1qd9A in template set T0349 9 :DAVLLSAVGALLDGADIGHL 1qd9A 50 :THQVFSNLKAVLEEAGASFE T0349 35 :SILEG 1qd9A 70 :TVVKA T0349 46 :RRVLVHEDDLAGARRLLTDA 1qd9A 75 :TVFIADMEQFAEVNEVYGQY Number of specific fragments extracted= 3 number of extra gaps= 0 total=75 Number of alignments=26 # 1qd9A read from 1qd9A/merged-good-all-a2m # found chain 1qd9A in template set T0349 11 :VLLSAVGALLDGADIG 1qd9A 52 :QVFSNLKAVLEEAGAS T0349 37 :LEGSLGV 1qd9A 68 :FETVVKA T0349 46 :RRVLVHEDDLAGARRLLTDA 1qd9A 75 :TVFIADMEQFAEVNEVYGQY Number of specific fragments extracted= 3 number of extra gaps= 0 total=78 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oo0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1oo0A expands to /projects/compbio/data/pdb/1oo0.pdb.gz 1oo0A:# T0349 read from 1oo0A/merged-good-all-a2m # 1oo0A read from 1oo0A/merged-good-all-a2m # adding 1oo0A to template set # found chain 1oo0A in template set T0349 43 :VIPRRVLVHEDDLAGARRLLTDAGLAHE 1oo0A 46 :MIRKEAFVHQSVMEELKRIIIDSEIMQE Number of specific fragments extracted= 1 number of extra gaps= 0 total=79 Number of alignments=28 # 1oo0A read from 1oo0A/merged-good-all-a2m # found chain 1oo0A in template set T0349 43 :VIPRRVLVHEDDLAGARRLLTDAGLAHE 1oo0A 46 :MIRKEAFVHQSVMEELKRIIIDSEIMQE Number of specific fragments extracted= 1 number of extra gaps= 0 total=80 Number of alignments=29 # 1oo0A read from 1oo0A/merged-good-all-a2m # found chain 1oo0A in template set T0349 43 :VIPRRVLVHEDDLAGARRLLTDAGLAHE 1oo0A 46 :MIRKEAFVHQSVMEELKRIIIDSEIMQE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwmA expands to /projects/compbio/data/pdb/1kwm.pdb.gz 1kwmA:Skipped atom 268, because occupancy 0.470 <= existing 0.530 in 1kwmA Skipped atom 270, because occupancy 0.470 <= existing 0.530 in 1kwmA Skipped atom 272, because occupancy 0.470 <= existing 0.530 in 1kwmA WARNING: atom 790 has residue number 4 < previous residue 95A in 1kwmA Skipped atom 1086, because occupancy 0.330 <= existing 0.670 in 1kwmA Skipped atom 1088, because occupancy 0.330 <= existing 0.670 in 1kwmA Skipped atom 1090, because occupancy 0.330 <= existing 0.670 in 1kwmA Skipped atom 1311, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1313, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1315, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1317, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1319, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1321, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1961, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1963, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1965, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1967, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1969, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1971, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1973, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 2225, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2227, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2229, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2231, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2315, because occupancy 0.340 <= existing 0.660 in 1kwmA Skipped atom 2317, because occupancy 0.340 <= existing 0.660 in 1kwmA # T0349 read from 1kwmA/merged-good-all-a2m # 1kwmA read from 1kwmA/merged-good-all-a2m # adding 1kwmA to template set # found chain 1kwmA in template set T0349 9 :DAVLLSAVGALLDGADIGHLVLDQNMSI 1kwmA 19A:DENHINIIRELASTTQIDFWKPDSVTQI T0349 41 :LGVIPRRVLVHEDDLAGARRLLTDAGLA 1kwmA 47A:KPHSTVDFRVKAEDTVTVENVLKQNELQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=83 Number of alignments=31 # 1kwmA read from 1kwmA/merged-good-all-a2m # found chain 1kwmA in template set T0349 5 :LRTNDAVLLSAVGALLDGADIGHLVLDQNMSI 1kwmA 15A:VNVEDENHINIIRELASTTQIDFWKPDSVTQI T0349 41 :LGVIPRRVLVHEDDLAGARRLLTDAGLAHE 1kwmA 47A:KPHSTVDFRVKAEDTVTVENVLKQNELQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=85 Number of alignments=32 # 1kwmA read from 1kwmA/merged-good-all-a2m # found chain 1kwmA in template set T0349 5 :LRTNDAVLLSAVGALLDGADIGHLV 1kwmA 15A:VNVEDENHINIIRELASTTQIDFWK T0349 34 :MSILEGSLGVIPRRVLVHEDDLAGARRLLTDAGLA 1kwmA 40A:PDSVTQIKPHSTVDFRVKAEDTVTVENVLKQNELQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=87 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cvlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cvlA expands to /projects/compbio/data/pdb/2cvl.pdb.gz 2cvlA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0349 read from 2cvlA/merged-good-all-a2m # 2cvlA read from 2cvlA/merged-good-all-a2m # adding 2cvlA to template set # found chain 2cvlA in template set T0349 5 :LRTNDAVLLSAVGALLDGADIGH 2cvlA 45 :IRVQTERVMENLKAVLEAAGSGL T0349 42 :GVIP 2cvlA 69 :RVVQ T0349 46 :RRVLVHEDDLAGARRLLTDA 2cvlA 74 :TCFLADMEDFPGFNEVYARY T0349 67 :LAHE 2cvlA 94 :FTPP Number of specific fragments extracted= 4 number of extra gaps= 0 total=91 Number of alignments=34 # 2cvlA read from 2cvlA/merged-good-all-a2m # found chain 2cvlA in template set T0349 6 :RTNDAVLLSAVGALLDGADIGH 2cvlA 46 :RVQTERVMENLKAVLEAAGSGL T0349 28 :LVLD 2cvlA 70 :VVQT T0349 46 :RRVLVHEDDLAGARRLLTDA 2cvlA 74 :TCFLADMEDFPGFNEVYARY T0349 67 :LAH 2cvlA 94 :FTP Number of specific fragments extracted= 4 number of extra gaps= 0 total=95 Number of alignments=35 # 2cvlA read from 2cvlA/merged-good-all-a2m # found chain 2cvlA in template set T0349 11 :VLLSAVGALLDGADIG 2cvlA 51 :RVMENLKAVLEAAGSG T0349 37 :LEGSLG 2cvlA 67 :LSRVVQ T0349 45 :PRRVLVHEDDLAGARRLLTDA 2cvlA 73 :TTCFLADMEDFPGFNEVYARY Number of specific fragments extracted= 3 number of extra gaps= 0 total=98 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g61A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1g61A/merged-good-all-a2m # 1g61A read from 1g61A/merged-good-all-a2m # found chain 1g61A in training set Warning: unaligning (T0349)N33 because of BadResidue code BAD_PEPTIDE in next template residue (1g61A)S2056 Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE at template residue (1g61A)S2056 T0349 13 :LSAVGALLD 1g61A 2037 :VNEVSEVLE T0349 25 :IGHLVLD 1g61A 2046 :TKCLQTN T0349 32 :Q 1g61A 2054 :G T0349 35 :SILEGSLGVIPRRVL 1g61A 2057 :SLVGSLSVANKYGLL T0349 50 :VHEDDLAGARRLLTDAGLAH 1g61A 2076 :VEDEELDRIKNFLKENNLDL Number of specific fragments extracted= 5 number of extra gaps= 1 total=103 Number of alignments=37 # 1g61A read from 1g61A/merged-good-all-a2m # found chain 1g61A in training set Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE in next template residue (1g61A)S2056 Warning: unaligning (T0349)S35 because of BadResidue code BAD_PEPTIDE at template residue (1g61A)S2056 T0349 9 :DAVLLSAVGALLD 1g61A 2033 :DKDDVNEVSEVLE T0349 25 :IGHLVLDQN 1g61A 2046 :TKCLQTNIG T0349 36 :ILEGSLGVI 1g61A 2057 :SLVGSLSVA T0349 45 :PRRVL 1g61A 2067 :KYGLL T0349 50 :VHEDDLAGARRLLTDAGLAHE 1g61A 2076 :VEDEELDRIKNFLKENNLDLN Number of specific fragments extracted= 5 number of extra gaps= 1 total=108 Number of alignments=38 # 1g61A read from 1g61A/merged-good-all-a2m # found chain 1g61A in training set Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE in next template residue (1g61A)S2056 Warning: unaligning (T0349)S35 because of BadResidue code BAD_PEPTIDE at template residue (1g61A)S2056 T0349 12 :LLSAVGALLD 1g61A 2036 :DVNEVSEVLE T0349 25 :IGHLVLDQN 1g61A 2046 :TKCLQTNIG T0349 36 :ILEGSLG 1g61A 2057 :SLVGSLS T0349 43 :VIPRRVL 1g61A 2065 :ANKYGLL T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1g61A 2076 :VEDEELDRIKNFLKENNLDLNV Number of specific fragments extracted= 5 number of extra gaps= 1 total=113 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vjqA expands to /projects/compbio/data/pdb/1vjq.pdb.gz 1vjqA:Skipped atom 292, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 294, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 296, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 298, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 300, because occupancy 0.500 <= existing 0.500 in 1vjqA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0349 read from 1vjqA/merged-good-all-a2m # 1vjqA read from 1vjqA/merged-good-all-a2m # adding 1vjqA to template set # found chain 1vjqA in template set Warning: unaligning (T0349)G26 because of BadResidue code BAD_PEPTIDE in next template residue (1vjqA)F28 Warning: unaligning (T0349)L28 because of BadResidue code BAD_PEPTIDE at template residue (1vjqA)F28 Warning: unaligning (T0349)V29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vjqA)D29 T0349 9 :DAVLLSAVGALLDGADI 1vjqA 10 :NEEQVAFLEALAKQDEL T0349 30 :LDQNMS 1vjqA 30 :WQNPPT T0349 38 :EGS 1vjqA 37 :PGQ T0349 45 :PRRVLVHEDDLAGARRLLTDAGLA 1vjqA 40 :PVVILIPSDMVEWFLEMLKAKGIP Number of specific fragments extracted= 4 number of extra gaps= 1 total=117 Number of alignments=40 # 1vjqA read from 1vjqA/merged-good-all-a2m # found chain 1vjqA in template set Warning: unaligning (T0349)G26 because of BadResidue code BAD_PEPTIDE in next template residue (1vjqA)F28 Warning: unaligning (T0349)H27 because of BadResidue code BAD_PEPTIDE at template residue (1vjqA)F28 Warning: unaligning (T0349)L28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vjqA)D29 T0349 5 :LRTNDAVLLSAVGALLDGADI 1vjqA 6 :IVPTNEEQVAFLEALAKQDEL T0349 30 :L 1vjqA 30 :W T0349 32 :QNMSILEGS 1vjqA 31 :QNPPTEPGQ T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 1vjqA 40 :PVVILIPSDMVEWFLEMLKAKGIPFT Number of specific fragments extracted= 4 number of extra gaps= 1 total=121 Number of alignments=41 # 1vjqA read from 1vjqA/merged-good-all-a2m # found chain 1vjqA in template set Warning: unaligning (T0349)N33 because of BadResidue code BAD_PEPTIDE in next template residue (1vjqA)F28 Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE at template residue (1vjqA)F28 Warning: unaligning (T0349)S35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vjqA)D29 T0349 4 :LLRTNDAVLLSAVGALLDGAD 1vjqA 5 :VIVPTNEEQVAFLEALAKQDE T0349 32 :Q 1vjqA 26 :L T0349 36 :ILEGS 1vjqA 30 :WQNPP T0349 41 :LGVIPRRVLVHEDDLAGARRLLTDAGLA 1vjqA 36 :EPGQPVVILIPSDMVEWFLEMLKAKGIP Number of specific fragments extracted= 4 number of extra gaps= 1 total=125 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pba/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pba expands to /projects/compbio/data/pdb/1pba.pdb.gz 1pba:Warning: there is no chain 1pba will retry with 1pbaA # T0349 read from 1pba/merged-good-all-a2m # 1pba read from 1pba/merged-good-all-a2m # adding 1pba to template set # found chain 1pba in template set Warning: unaligning (T0349)Q32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1pba)P40 Warning: unaligning (T0349)N33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1pba)P40 T0349 9 :DAVLLSAVGALLDGADIGH 1pba 19 :DENDISELHELASTRQIDF T0349 31 :D 1pba 38 :W T0349 34 :MSILE 1pba 41 :DSVTQ T0349 39 :GS 1pba 49 :HS T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 1pba 51 :TVDFRVKAEDILAVEDFLEQNELQYE Number of specific fragments extracted= 5 number of extra gaps= 1 total=130 Number of alignments=43 # 1pba read from 1pba/merged-good-all-a2m # found chain 1pba in template set Warning: unaligning (T0349)Q32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1pba)P40 Warning: unaligning (T0349)N33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1pba)P40 T0349 5 :LRTNDAVLLSAVGALLDGADIGHL 1pba 15 :VNVEDENDISELHELASTRQIDFW T0349 34 :MSILE 1pba 41 :DSVTQ T0349 39 :GS 1pba 49 :HS T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHELR 1pba 51 :TVDFRVKAEDILAVEDFLEQNELQYEVL Number of specific fragments extracted= 4 number of extra gaps= 1 total=134 Number of alignments=44 # 1pba read from 1pba/merged-good-all-a2m # found chain 1pba in template set Warning: unaligning (T0349)Q32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1pba)P40 Warning: unaligning (T0349)N33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1pba)P40 T0349 5 :LRTNDAVLLSAVGALLDGADIG 1pba 15 :VNVEDENDISELHELASTRQID T0349 30 :LD 1pba 37 :FW T0349 34 :MSILE 1pba 41 :DSVTQ T0349 39 :GSL 1pba 49 :HST T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHE 1pba 52 :VDFRVKAEDILAVEDFLEQNELQYE Number of specific fragments extracted= 5 number of extra gaps= 1 total=139 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gukA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gukA expands to /projects/compbio/data/pdb/2guk.pdb.gz 2gukA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 271, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 273, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 275, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 277, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 279, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 376, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 378, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 380, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 382, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 384, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 386, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 388, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 390, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 392, because occupancy 0.500 <= existing 0.500 in 2gukA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 589, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 591, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 593, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 595, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 597, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 599, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 601, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 603, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 605, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2gukA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 930, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 932, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 934, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 936, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 938, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 940, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 942, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 944, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 946, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 948, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 950, because occupancy 0.500 <= existing 0.500 in 2gukA # T0349 read from 2gukA/merged-good-all-a2m # 2gukA read from 2gukA/merged-good-all-a2m # adding 2gukA to template set # found chain 2gukA in template set T0349 10 :AVLLSAVGALLDGAD 2gukA 11 :RVFMHHIYEFEKGVR T0349 40 :SL 2gukA 26 :SM T0349 46 :RRVLVHEDDLAGARRLLTDAGLA 2gukA 28 :VLATLANDDIPYAEERLRSRQIP Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=46 # 2gukA read from 2gukA/merged-good-all-a2m # found chain 2gukA in template set T0349 9 :DAVLLSAVGALLDGAD 2gukA 10 :LRVFMHHIYEFEKGVR T0349 40 :S 2gukA 26 :S T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 2gukA 27 :MVLATLANDDIPYAEERLRSRQIPYF Number of specific fragments extracted= 3 number of extra gaps= 0 total=145 Number of alignments=47 # 2gukA read from 2gukA/merged-good-all-a2m # found chain 2gukA in template set T0349 48 :VLVHEDDLAGARRLLTDAGLA 2gukA 30 :ATLANDDIPYAEERLRSRQIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=146 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zvpA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zvpA expands to /projects/compbio/data/pdb/1zvp.pdb.gz 1zvpA:# T0349 read from 1zvpA/merged-good-all-a2m # 1zvpA read from 1zvpA/merged-good-all-a2m # adding 1zvpA to template set # found chain 1zvpA in template set T0349 15 :AVGALLDGADIGH 1zvpA 89 :AFATKLAEHGISA T0349 35 :SILEG 1zvpA 102 :NVIAG T0349 43 :VIPRRVLVHEDDLAGARRLLTD 1zvpA 107 :YYHDHIFVQKEKAQQALQALGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=149 Number of alignments=49 # 1zvpA read from 1zvpA/merged-good-all-a2m # found chain 1zvpA in template set T0349 13 :LSAVGALLDGADIGHLVL 1zvpA 87 :TAAFATKLAEHGISANVI T0349 38 :E 1zvpA 105 :A T0349 42 :GVIPRRVLVHEDDLAGARRLLT 1zvpA 106 :GYYHDHIFVQKEKAQQALQALG Number of specific fragments extracted= 3 number of extra gaps= 0 total=152 Number of alignments=50 # 1zvpA read from 1zvpA/merged-good-all-a2m # found chain 1zvpA in template set T0349 14 :SAVGALLDGADIG 1zvpA 88 :AAFATKLAEHGIS T0349 34 :MSILEG 1zvpA 101 :ANVIAG T0349 43 :VIPRRVLVHEDDLAGARRLLT 1zvpA 107 :YYHDHIFVQKEKAQQALQALG Number of specific fragments extracted= 3 number of extra gaps= 0 total=155 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v6sA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1v6sA/merged-good-all-a2m # 1v6sA read from 1v6sA/merged-good-all-a2m # found chain 1v6sA in training set T0349 13 :LSAVGALLD 1v6sA 199 :IGVIESLLP T0349 24 :DIGHLVLDQNMS 1v6sA 208 :RIDRLLIGGAMA T0349 36 :ILEGSLGVI 1v6sA 225 :ALGGEVGRS T0349 49 :LVHEDDLAGARRLLTDA 1v6sA 234 :LVEEDRLDLAKDLLGRA Number of specific fragments extracted= 4 number of extra gaps= 0 total=159 Number of alignments=52 # 1v6sA read from 1v6sA/merged-good-all-a2m # found chain 1v6sA in training set T0349 13 :LSAVGALL 1v6sA 199 :IGVIESLL T0349 23 :ADIGHLVLDQNMS 1v6sA 207 :PRIDRLLIGGAMA T0349 36 :ILEGSLGVI 1v6sA 225 :ALGGEVGRS T0349 49 :LVHEDDLAGARRLLTDA 1v6sA 234 :LVEEDRLDLAKDLLGRA Number of specific fragments extracted= 4 number of extra gaps= 0 total=163 Number of alignments=53 # 1v6sA read from 1v6sA/merged-good-all-a2m # found chain 1v6sA in training set T0349 13 :LSAVGALLD 1v6sA 199 :IGVIESLLP T0349 24 :DIGHLVLDQNMS 1v6sA 208 :RIDRLLIGGAMA T0349 36 :ILEGSLG 1v6sA 225 :ALGGEVG T0349 47 :RVLVHEDDLAGARRLLTDA 1v6sA 232 :RSLVEEDRLDLAKDLLGRA Number of specific fragments extracted= 4 number of extra gaps= 0 total=167 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hdoA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1hdoA/merged-good-all-a2m # 1hdoA read from 1hdoA/merged-good-all-a2m # found chain 1hdoA in training set Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)V121 Warning: unaligning (T0349)V50 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)V121 Warning: unaligning (T0349)A65 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)G143 Warning: unaligning (T0349)G66 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)G143 T0349 11 :VLLSAVGALLDGADIGHLVLDQNMSILEGSL 1hdoA 89 :EGARNIVAAMKAHGVDKVVACTSAFLLWDPT T0349 51 :HEDDLA 1hdoA 122 :PPRLQA T0349 57 :GARRLLTD 1hdoA 134 :RMHKVLRE T0349 67 :L 1hdoA 144 :L Number of specific fragments extracted= 4 number of extra gaps= 2 total=171 Number of alignments=55 # 1hdoA read from 1hdoA/merged-good-all-a2m # found chain 1hdoA in training set T0349 4 :LLRTNDAVLLSAVGALLD 1hdoA 8 :IFGATGQTGLTTLAQAVQ T0349 23 :ADIGHLVLDQNMSILEGSL 1hdoA 26 :AGYEVTVLVRDSSRLPSEG T0349 43 :VIPRRVLVHE 1hdoA 45 :PRPAHVVVGD T0349 53 :DDLAGARRLL 1hdoA 56 :LQAADVDKTV Number of specific fragments extracted= 4 number of extra gaps= 0 total=175 Number of alignments=56 # 1hdoA read from 1hdoA/merged-good-all-a2m # found chain 1hdoA in training set Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)V121 Warning: unaligning (T0349)V43 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)V121 Warning: unaligning (T0349)A65 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)G143 Warning: unaligning (T0349)G66 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)G143 T0349 12 :LLSAVGALLDGADIGHLVLDQNMSILEGSL 1hdoA 90 :GARNIVAAMKAHGVDKVVACTSAFLLWDPT T0349 44 :IPRR 1hdoA 122 :PPRL T0349 49 :LVHEDDLAGARRLLTD 1hdoA 126 :QAVTDDHIRMHKVLRE T0349 67 :LA 1hdoA 144 :LK Number of specific fragments extracted= 4 number of extra gaps= 2 total=179 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dzkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1dzkA/merged-good-all-a2m # 1dzkA read from 1dzkA/merged-good-all-a2m # found chain 1dzkA in training set T0349 42 :GVIPRRVL 1dzkA 112 :TIMTGLLG T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1dzkA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=181 Number of alignments=58 # 1dzkA read from 1dzkA/merged-good-all-a2m # found chain 1dzkA in training set T0349 35 :SILEGSLGV 1dzkA 112 :TIMTGLLGK T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1dzkA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=59 # 1dzkA read from 1dzkA/merged-good-all-a2m # found chain 1dzkA in training set T0349 50 :VHEDDLAGARRLLTDAGLAHE 1dzkA 124 :IEDQDLEKFKEVTRENGIPEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=184 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zhvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zhvA expands to /projects/compbio/data/pdb/1zhv.pdb.gz 1zhvA:# T0349 read from 1zhvA/merged-good-all-a2m # 1zhvA read from 1zhvA/merged-good-all-a2m # adding 1zhvA to template set # found chain 1zhvA in template set T0349 13 :LSAVGALLDGADIGHLVLDQNM 1zhvA 80 :VLSVISPLSTNGIGIFVVSTFD T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAH 1zhvA 102 :GDHLLVRSNDLEKTADLLANAGHSL Number of specific fragments extracted= 2 number of extra gaps= 0 total=186 Number of alignments=61 # 1zhvA read from 1zhvA/merged-good-all-a2m # found chain 1zhvA in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNM 1zhvA 79 :IVLSVISPLSTNGIGIFVVSTFD T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHELRSD 1zhvA 102 :GDHLLVRSNDLEKTADLLANAGHSLLLEHH Number of specific fragments extracted= 2 number of extra gaps= 0 total=188 Number of alignments=62 # 1zhvA read from 1zhvA/merged-good-all-a2m # found chain 1zhvA in template set T0349 9 :DAVLLSAVGALLDGADIGHLVLDQ 1zhvA 76 :ETGIVLSVISPLSTNGIGIFVVST T0349 37 :LEG 1zhvA 100 :FDG T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHELRS 1zhvA 103 :DHLLVRSNDLEKTADLLANAGHSLLLEH Number of specific fragments extracted= 3 number of extra gaps= 0 total=191 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xaa/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xaa expands to /projects/compbio/data/pdb/1xaa.pdb.gz 1xaa:Warning: there is no chain 1xaa will retry with 1xaaA # T0349 read from 1xaa/merged-good-all-a2m # 1xaa read from 1xaa/merged-good-all-a2m # adding 1xaa to template set # found chain 1xaa in template set T0349 10 :AVLLSAVGALLDGADIGHLVLDQNMS 1xaa 17 :EAALKVLRALDEAEGLGLAYEVFPFG T0349 36 :ILEGSLGVI 1xaa 45 :AIDAFGEPF T0349 55 :LAGARRLLTD 1xaa 54 :PEPTRKGVEE T0349 65 :AGLAHELR 1xaa 78 :DGLPRKIR Number of specific fragments extracted= 4 number of extra gaps= 0 total=195 Number of alignments=64 # 1xaa read from 1xaa/merged-good-all-a2m # found chain 1xaa in template set T0349 11 :VLLSAVGALLD 1xaa 18 :AALKVLRALDE T0349 22 :GADIGHLVLDQNMSILEGSLGVI 1xaa 31 :GLGLAYEVFPFGGAAIDAFGEPF T0349 51 :HEDDLAGARR 1xaa 54 :PEPTRKGVEE T0349 65 :AGLAHELR 1xaa 78 :DGLPRKIR Number of specific fragments extracted= 4 number of extra gaps= 0 total=199 Number of alignments=65 # 1xaa read from 1xaa/merged-good-all-a2m # found chain 1xaa in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1xaa 165 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1xaa 189 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=201 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jbeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1jbeA/merged-good-all-a2m # 1jbeA read from 1jbeA/merged-good-all-a2m # found chain 1jbeA in training set Warning: unaligning (T0349)S40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbeA)A77 Warning: unaligning (T0349)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1jbeA)S79 Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE at template residue (1jbeA)S79 T0349 16 :VGALLDGADIGHLVLDQNMS 1jbeA 42 :ALNKLQAGGYGFVISDWNMP T0349 43 :VIPRRVLV 1jbeA 80 :ALPVLMVT T0349 51 :HEDDLAGARR 1jbeA 91 :KKENIIAAAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=204 Number of alignments=67 # 1jbeA read from 1jbeA/merged-good-all-a2m # found chain 1jbeA in training set Warning: unaligning (T0349)S40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbeA)A77 Warning: unaligning (T0349)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1jbeA)S79 Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE at template residue (1jbeA)S79 T0349 5 :LRTNDAV 1jbeA 34 :EEAEDGV T0349 15 :AVGALLDGADIGHLVLDQNMS 1jbeA 41 :DALNKLQAGGYGFVISDWNMP T0349 43 :VIPRRVLV 1jbeA 80 :ALPVLMVT T0349 51 :HEDDLAGARR 1jbeA 91 :KKENIIAAAQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=208 Number of alignments=68 # 1jbeA read from 1jbeA/merged-good-all-a2m # found chain 1jbeA in training set Warning: unaligning (T0349)S40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbeA)A77 Warning: unaligning (T0349)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1jbeA)S79 Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE at template residue (1jbeA)S79 T0349 16 :VGALLDGADIGHLVLDQNMSIL 1jbeA 42 :ALNKLQAGGYGFVISDWNMPNM T0349 43 :VIPRRVLVH 1jbeA 80 :ALPVLMVTA T0349 52 :EDDLAGARR 1jbeA 92 :KENIIAAAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=211 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1idm/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1idm expands to /projects/compbio/data/pdb/1idm.pdb.gz 1idm:Warning: there is no chain 1idm will retry with 1idmA # T0349 read from 1idm/merged-good-all-a2m # 1idm read from 1idm/merged-good-all-a2m # adding 1idm to template set # found chain 1idm in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1idm 163 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1idm 187 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=213 Number of alignments=70 # 1idm read from 1idm/merged-good-all-a2m # found chain 1idm in template set T0349 11 :VLLSAVGALLDGADIGHLVLDQNMSI 1idm 162 :RVARVAFEAARKRRKHVVSVDKANVL T0349 53 :DDLAGARRLLTDA 1idm 188 :EVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=215 Number of alignments=71 # 1idm read from 1idm/merged-good-all-a2m # found chain 1idm in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1idm 163 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1idm 187 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=217 Number of alignments=72 # command:Using radius: 29.0000 NUMB_ALIGNS: 72 evalue: 0 0.8723, weight 0.9884 evalue: 1 0.8723, weight 0.9884 evalue: 2 0.8723, weight 0.9884 evalue: 3 2.4278, weight 0.9674 evalue: 4 2.4278, weight 0.9674 evalue: 5 2.4278, weight 0.9674 evalue: 6 3.5066, weight 0.9528 evalue: 7 3.5066, weight 0.9528 evalue: 8 3.5066, weight 0.9528 evalue: 9 2.4397, weight 0.9672 evalue: 10 2.4397, weight 0.9672 evalue: 11 2.4397, weight 0.9672 evalue: 12 0.2267, weight 0.9971 evalue: 13 0.2267, weight 0.9971 evalue: 14 0.2267, weight 0.9971 evalue: 15 1.5778, weight 0.9789 evalue: 16 1.5778, weight 0.9789 evalue: 17 1.5778, weight 0.9789 evalue: 18 1.6700, weight 0.9776 evalue: 19 1.6700, weight 0.9776 evalue: 20 1.6700, weight 0.9776 evalue: 21 66.7000, weight 0.1000 evalue: 22 66.7000, weight 0.1000 evalue: 23 66.7000, weight 0.1000 evalue: 24 3.7561, weight 0.9495 evalue: 25 3.7561, weight 0.9495 evalue: 26 3.7561, weight 0.9495 evalue: 27 4.1579, weight 0.9440 evalue: 28 4.1579, weight 0.9440 evalue: 29 4.1579, weight 0.9440 evalue: 30 0.2685, weight 0.9965 evalue: 31 0.2685, weight 0.9965 evalue: 32 0.2685, weight 0.9965 evalue: 33 3.4511, weight 0.9536 evalue: 34 3.4511, weight 0.9536 evalue: 35 3.4511, weight 0.9536 evalue: 36 0.2452, weight 0.9969 evalue: 37 0.2452, weight 0.9969 evalue: 38 0.2452, weight 0.9969 evalue: 39 0.1717, weight 0.9978 evalue: 40 0.1717, weight 0.9978 evalue: 41 0.1717, weight 0.9978 evalue: 42 3.3717, weight 0.9547 evalue: 43 3.3717, weight 0.9547 evalue: 44 3.3717, weight 0.9547 evalue: 45 3.6706, weight 0.9506 evalue: 46 3.6706, weight 0.9506 evalue: 47 3.6706, weight 0.9506 evalue: 48 1.4213, weight 0.9810 evalue: 49 1.4213, weight 0.9810 evalue: 50 1.4213, weight 0.9810 evalue: 51 2.0152, weight 0.9730 evalue: 52 2.0152, weight 0.9730 evalue: 53 2.0152, weight 0.9730 evalue: 54 1.8689, weight 0.9749 evalue: 55 1.8689, weight 0.9749 evalue: 56 1.8689, weight 0.9749 evalue: 57 0.2922, weight 0.9962 evalue: 58 0.2922, weight 0.9962 evalue: 59 0.2922, weight 0.9962 evalue: 60 0.0121, weight 1.0000 evalue: 61 0.0121, weight 1.0000 evalue: 62 0.0121, weight 1.0000 evalue: 63 1.6700, weight 0.9776 evalue: 64 1.6700, weight 0.9776 evalue: 65 1.6700, weight 0.9776 evalue: 66 2.4979, weight 0.9665 evalue: 67 2.4979, weight 0.9665 evalue: 68 2.4979, weight 0.9665 evalue: 69 1.6200, weight 0.9783 evalue: 70 1.6200, weight 0.9783 evalue: 71 1.6200, weight 0.9783 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 21 RES2ATOM 3 30 RES2ATOM 4 38 RES2ATOM 5 46 RES2ATOM 6 57 RES2ATOM 7 64 RES2ATOM 8 72 RES2ATOM 9 80 RES2ATOM 10 85 RES2ATOM 11 92 RES2ATOM 12 100 RES2ATOM 13 108 RES2ATOM 14 114 RES2ATOM 15 119 RES2ATOM 17 130 RES2ATOM 18 135 RES2ATOM 19 143 RES2ATOM 20 151 RES2ATOM 22 163 RES2ATOM 23 168 RES2ATOM 24 176 RES2ATOM 26 188 RES2ATOM 27 198 RES2ATOM 28 206 RES2ATOM 29 213 RES2ATOM 30 221 RES2ATOM 31 229 RES2ATOM 32 238 RES2ATOM 33 246 RES2ATOM 34 254 RES2ATOM 35 260 RES2ATOM 36 268 RES2ATOM 37 276 RES2ATOM 39 289 RES2ATOM 40 295 RES2ATOM 42 307 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 45 329 RES2ATOM 46 340 RES2ATOM 47 351 RES2ATOM 48 358 RES2ATOM 49 366 RES2ATOM 50 373 RES2ATOM 51 383 RES2ATOM 52 392 RES2ATOM 53 400 RES2ATOM 54 408 RES2ATOM 55 416 RES2ATOM 57 425 RES2ATOM 58 430 RES2ATOM 59 441 RES2ATOM 60 452 RES2ATOM 61 460 RES2ATOM 62 468 RES2ATOM 63 475 RES2ATOM 64 483 RES2ATOM 66 492 RES2ATOM 67 500 RES2ATOM 68 505 RES2ATOM 69 515 RES2ATOM 70 524 RES2ATOM 71 532 RES2ATOM 72 543 RES2ATOM 73 549 RES2ATOM 74 557 Constraint 409 476 12.0502 15.0627 22.5941 60.7479 Constraint 401 469 11.9200 14.9000 22.3500 60.7438 Constraint 393 461 12.8275 16.0344 24.0516 59.7420 Constraint 374 442 11.8847 14.8558 22.2837 59.7388 Constraint 417 484 12.4868 15.6085 23.4128 58.7947 Constraint 409 484 12.8937 16.1172 24.1757 58.7947 Constraint 401 476 12.5111 15.6388 23.4582 58.7819 Constraint 384 461 12.4930 15.6162 23.4243 58.7745 Constraint 384 453 12.2952 15.3690 23.0535 58.7745 Constraint 393 469 13.8605 17.3257 25.9885 58.7671 Constraint 384 469 13.9471 17.4338 26.1507 57.7995 Constraint 367 442 11.3087 14.1358 21.2037 57.7862 Constraint 367 431 9.2518 11.5648 17.3472 57.7862 Constraint 401 484 13.2222 16.5277 24.7916 56.8286 Constraint 393 476 14.7655 18.4568 27.6853 56.8051 Constraint 374 461 12.6317 15.7896 23.6844 55.8618 Constraint 374 453 11.6238 14.5297 21.7946 55.8618 Constraint 384 476 15.7909 19.7386 29.6079 55.8376 Constraint 144 426 11.5546 14.4433 21.6649 55.6974 Constraint 136 426 12.2190 15.2738 22.9107 55.6974 Constraint 131 426 13.9998 17.4998 26.2497 55.6974 Constraint 120 442 13.0651 16.3313 24.4970 55.6974 Constraint 120 431 12.5916 15.7394 23.6092 55.6974 Constraint 120 426 10.3851 12.9814 19.4721 55.6974 Constraint 120 417 15.5732 19.4665 29.1998 55.6974 Constraint 120 409 14.3349 17.9186 26.8779 55.6974 Constraint 374 469 14.8958 18.6198 27.9297 54.8868 Constraint 367 461 10.5912 13.2390 19.8585 54.8868 Constraint 367 453 10.3518 12.9398 19.4097 54.8868 Constraint 393 484 16.2397 20.2997 30.4495 54.8519 Constraint 136 442 14.1741 17.7176 26.5764 54.7300 Constraint 367 469 13.3991 16.7488 25.1233 53.9119 Constraint 384 484 16.6190 20.7738 31.1607 53.8843 Constraint 144 442 13.5345 16.9182 25.3773 53.7626 Constraint 144 401 14.4796 18.0995 27.1492 53.7313 Constraint 120 401 13.6166 17.0208 25.5312 53.7313 Constraint 359 442 13.6441 17.0551 25.5826 53.6881 Constraint 359 431 11.1628 13.9535 20.9303 53.6881 Constraint 359 426 8.4858 10.6073 15.9109 53.6881 Constraint 374 476 15.8456 19.8070 29.7105 52.9249 Constraint 177 442 14.1841 17.7302 26.5952 52.7983 Constraint 177 426 11.7467 14.6834 22.0250 52.7983 Constraint 120 177 8.1627 10.2034 15.3050 52.7983 Constraint 115 426 12.6542 15.8178 23.7267 52.7972 Constraint 144 431 13.1803 16.4754 24.7131 52.7952 Constraint 144 417 16.0156 20.0195 30.0293 52.7952 Constraint 136 431 13.9540 17.4425 26.1638 52.7952 Constraint 131 442 15.2516 19.0645 28.5968 52.7952 Constraint 152 426 14.2216 17.7770 26.6655 52.7896 Constraint 144 409 15.0322 18.7902 28.1853 52.7876 Constraint 136 409 15.9666 19.9583 29.9374 52.7774 Constraint 136 401 15.1158 18.8947 28.3421 52.7639 Constraint 367 476 14.6213 18.2766 27.4150 51.9499 Constraint 177 409 15.0246 18.7807 28.1711 51.8233 Constraint 152 442 15.8043 19.7553 29.6330 51.8222 Constraint 144 453 10.2991 12.8739 19.3108 51.8204 Constraint 136 453 10.1424 12.6780 19.0170 51.8204 Constraint 131 453 11.5070 14.3837 21.5756 51.8204 Constraint 120 461 8.6981 10.8727 16.3090 51.8204 Constraint 120 453 9.2785 11.5982 17.3973 51.8204 Constraint 131 431 15.7545 19.6931 29.5396 51.8175 Constraint 120 393 17.3172 21.6465 32.4697 51.7546 Constraint 374 484 16.2430 20.3037 30.4556 50.9716 Constraint 115 461 11.0233 13.7791 20.6687 50.8531 Constraint 115 453 10.8062 13.5077 20.2616 50.8531 Constraint 136 461 10.3019 12.8774 19.3161 50.8530 Constraint 109 426 13.5261 16.9076 25.3614 50.8498 Constraint 152 431 16.1409 20.1761 30.2642 50.8446 Constraint 115 401 15.5806 19.4758 29.2137 50.8312 Constraint 131 401 16.3166 20.3957 30.5936 50.8291 Constraint 359 461 11.8523 14.8154 22.2230 50.7887 Constraint 359 453 12.3146 15.3932 23.0899 50.7887 Constraint 120 384 17.0549 21.3187 31.9780 50.7870 Constraint 367 484 14.3532 17.9416 26.9123 49.9940 Constraint 115 177 10.8299 13.5374 20.3061 49.8981 Constraint 177 431 13.3573 16.6966 25.0449 49.8961 Constraint 144 461 9.8576 12.3221 18.4831 49.8856 Constraint 109 453 11.4961 14.3701 21.5552 49.8722 Constraint 152 417 18.5002 23.1253 34.6879 49.8696 Constraint 101 426 11.1341 13.9176 20.8764 49.8688 Constraint 101 409 14.9212 18.6516 27.9773 49.8688 Constraint 115 409 16.3170 20.3962 30.5943 49.8606 Constraint 177 401 13.8343 17.2928 25.9392 49.8573 Constraint 359 469 15.1663 18.9579 28.4369 49.8138 Constraint 115 169 12.6514 15.8142 23.7213 49.8066 Constraint 169 442 15.7841 19.7302 29.5952 49.8046 Constraint 169 426 13.9118 17.3898 26.0847 49.8046 Constraint 177 453 11.2249 14.0311 21.0466 48.9213 Constraint 177 417 15.6063 19.5078 29.2617 48.9211 Constraint 131 461 11.7018 14.6273 21.9410 48.9182 Constraint 152 453 12.1325 15.1657 22.7485 48.9126 Constraint 120 469 11.6089 14.5111 21.7666 48.9106 Constraint 109 461 12.1114 15.1392 22.7088 48.9048 Constraint 115 442 14.0759 17.5949 26.3923 48.8932 Constraint 115 431 14.2681 17.8351 26.7527 48.8932 Constraint 101 453 9.9909 12.4887 18.7330 48.8912 Constraint 109 401 16.1276 20.1595 30.2393 48.8838 Constraint 136 417 16.2641 20.3301 30.4952 48.8809 Constraint 131 417 17.8996 22.3745 33.5617 48.8809 Constraint 152 401 16.4129 20.5161 30.7742 48.8737 Constraint 169 453 13.4424 16.8029 25.2044 48.8298 Constraint 169 431 15.6959 19.6199 29.4298 48.8270 Constraint 109 177 11.9769 14.9711 22.4567 47.9507 Constraint 152 461 12.5620 15.7025 23.5538 47.9452 Constraint 144 469 12.4925 15.6156 23.4234 47.9432 Constraint 136 469 12.8358 16.0447 24.0671 47.9432 Constraint 131 469 14.3732 17.9665 26.9497 47.9432 Constraint 101 442 13.1420 16.4275 24.6412 47.9340 Constraint 101 431 13.0215 16.2769 24.4153 47.9340 Constraint 101 417 15.6770 19.5962 29.3943 47.9340 Constraint 152 409 17.6190 22.0237 33.0356 47.9171 Constraint 136 476 12.1059 15.1324 22.6986 47.9161 Constraint 115 417 16.8782 21.0977 31.6466 47.9156 Constraint 109 409 17.2195 21.5243 32.2865 47.9132 Constraint 131 409 17.3054 21.6317 32.4476 47.9033 Constraint 101 401 13.9139 17.3924 26.0886 47.9028 Constraint 144 393 17.7634 22.2043 33.3064 47.8774 Constraint 144 384 17.7271 22.1588 33.2382 47.8773 Constraint 120 374 15.1481 18.9351 28.4027 47.8743 Constraint 109 169 13.9732 17.4665 26.1998 47.8592 Constraint 164 442 14.8860 18.6075 27.9112 47.8587 Constraint 164 426 12.9159 16.1448 24.2173 47.8587 Constraint 359 476 16.5352 20.6690 31.0034 47.8518 Constraint 352 442 12.3429 15.4286 23.1429 47.8020 Constraint 352 431 10.1868 12.7336 19.1003 47.8020 Constraint 352 426 7.4727 9.3409 14.0113 47.8020 Constraint 152 469 15.0087 18.7608 28.1413 46.9703 Constraint 101 177 11.5649 14.4561 21.6842 46.9697 Constraint 101 461 9.5781 11.9727 17.9590 46.9564 Constraint 115 476 12.4113 15.5142 23.2713 46.9488 Constraint 144 476 11.8854 14.8567 22.2851 46.9487 Constraint 120 476 11.0949 13.8686 20.8029 46.9487 Constraint 144 374 15.3380 19.1725 28.7587 46.8994 Constraint 330 442 14.9766 18.7208 28.0811 46.8957 Constraint 330 431 13.0840 16.3549 24.5324 46.8957 Constraint 330 426 11.2933 14.1167 21.1750 46.8957 Constraint 330 417 15.7377 19.6721 29.5081 46.8957 Constraint 330 409 13.3271 16.6589 24.9883 46.8957 Constraint 164 431 14.8087 18.5109 27.7664 46.8810 Constraint 101 169 14.3710 17.9637 26.9455 46.8782 Constraint 177 461 10.7191 13.3988 20.0982 46.0191 Constraint 177 476 13.3640 16.7049 25.0574 45.9844 Constraint 101 469 12.6505 15.8131 23.7197 45.9814 Constraint 131 476 12.3435 15.4294 23.1441 45.9813 Constraint 115 469 13.2044 16.5055 24.7582 45.9742 Constraint 189 442 13.4925 16.8657 25.2985 45.9668 Constraint 189 431 12.7433 15.9291 23.8936 45.9668 Constraint 189 426 10.7988 13.4985 20.2478 45.9668 Constraint 131 189 9.8438 12.3048 18.4572 45.9668 Constraint 120 189 7.0088 8.7610 13.1415 45.9668 Constraint 101 484 10.1123 12.6404 18.9606 45.9630 Constraint 169 461 13.4264 16.7831 25.1746 45.9276 Constraint 101 393 17.1584 21.4480 32.1720 45.9260 Constraint 144 367 13.0938 16.3673 24.5509 45.9218 Constraint 136 367 14.1506 17.6882 26.5323 45.9218 Constraint 131 367 15.9361 19.9202 29.8802 45.9218 Constraint 131 359 16.1793 20.2242 30.3363 45.9218 Constraint 120 367 12.3899 15.4874 23.2311 45.9218 Constraint 120 359 12.2899 15.3623 23.0435 45.9218 Constraint 109 164 12.1258 15.1573 22.7359 45.9133 Constraint 359 484 15.5865 19.4832 29.2248 45.8959 Constraint 341 442 14.3871 17.9839 26.9759 45.8919 Constraint 341 431 11.8389 14.7986 22.1979 45.8919 Constraint 341 426 10.0184 12.5230 18.7845 45.8919 Constraint 341 417 14.0209 17.5262 26.2893 45.8919 Constraint 177 469 13.1820 16.4775 24.7163 45.0441 Constraint 109 442 14.3171 17.8963 26.8445 45.0110 Constraint 109 431 14.9256 18.6570 27.9856 45.0110 Constraint 152 476 13.3229 16.6536 24.9804 45.0083 Constraint 101 476 11.6613 14.5766 21.8649 45.0004 Constraint 189 417 15.2870 19.1088 28.6632 44.9918 Constraint 189 409 13.8463 17.3079 25.9619 44.9918 Constraint 144 484 9.8664 12.3330 18.4995 44.9750 Constraint 136 484 9.4864 11.8580 17.7870 44.9750 Constraint 120 484 8.5204 10.6504 15.9757 44.9750 Constraint 101 384 17.2304 21.5380 32.3070 44.9585 Constraint 169 469 15.4850 19.3562 29.0343 44.9527 Constraint 115 393 18.6328 23.2911 34.9366 44.9504 Constraint 164 453 11.6520 14.5651 21.8476 44.9491 Constraint 152 367 16.0260 20.0325 30.0487 44.9488 Constraint 144 359 12.9174 16.1467 24.2201 44.9468 Constraint 136 359 14.2762 17.8452 26.7678 44.9468 Constraint 101 164 12.6647 15.8309 23.7464 44.9323 Constraint 164 409 15.9666 19.9583 29.9374 44.9311 Constraint 352 461 9.6666 12.0832 18.1248 44.9027 Constraint 352 453 10.4480 13.0600 19.5900 44.9027 Constraint 109 417 17.3201 21.6501 32.4752 44.0333 Constraint 109 476 12.3815 15.4769 23.2154 44.0330 Constraint 115 484 9.4074 11.7592 17.6388 44.0077 Constraint 109 484 10.3516 12.9395 19.4092 44.0077 Constraint 131 484 10.0492 12.5615 18.8422 44.0076 Constraint 189 401 13.5122 16.8903 25.3354 44.0007 Constraint 330 461 11.4476 14.3095 21.4643 43.9963 Constraint 330 453 12.8946 16.1182 24.1773 43.9963 Constraint 164 461 12.0495 15.0619 22.5929 43.9817 Constraint 152 359 15.8315 19.7893 29.6840 43.9738 Constraint 164 401 14.7883 18.4853 27.7280 43.9428 Constraint 352 469 13.2910 16.6137 24.9206 43.9277 Constraint 426 493 8.8845 11.1057 16.6585 43.2744 Constraint 417 493 12.7449 15.9311 23.8967 43.2744 Constraint 409 493 12.1782 15.2227 22.8341 43.2744 Constraint 115 189 10.3096 12.8870 19.3305 43.0666 Constraint 109 469 13.7309 17.1636 25.7454 43.0584 Constraint 115 367 14.7246 18.4057 27.6086 43.0216 Constraint 115 359 15.0597 18.8246 28.2369 43.0216 Constraint 164 469 14.4508 18.0634 27.0952 43.0067 Constraint 341 461 11.3257 14.1571 21.2357 42.9925 Constraint 341 453 12.7369 15.9211 23.8817 42.9925 Constraint 169 476 14.5879 18.2349 27.3523 42.9907 Constraint 431 501 9.5351 11.9189 17.8784 42.2994 Constraint 426 501 11.0594 13.8243 20.7364 42.2994 Constraint 417 501 13.8862 17.3578 26.0367 42.2994 Constraint 409 501 13.0505 16.3131 24.4696 42.2994 Constraint 214 442 13.6025 17.0031 25.5047 42.1864 Constraint 214 431 11.7601 14.7001 22.0502 42.1864 Constraint 214 426 9.2968 11.6210 17.4315 42.1864 Constraint 214 417 13.8626 17.3282 25.9923 42.1864 Constraint 214 409 11.4745 14.3431 21.5146 42.1864 Constraint 144 214 10.8090 13.5113 20.2669 42.1864 Constraint 136 214 12.3785 15.4731 23.2097 42.1864 Constraint 131 214 13.5642 16.9552 25.4328 42.1864 Constraint 120 214 9.0407 11.3009 16.9514 42.1864 Constraint 189 461 9.9946 12.4933 18.7399 42.0898 Constraint 189 453 10.4936 13.1170 19.6756 42.0898 Constraint 177 484 11.2940 14.1174 21.1762 42.0759 Constraint 152 484 11.1252 13.9065 20.8598 42.0672 Constraint 177 367 12.1756 15.2195 22.8292 42.0477 Constraint 177 359 12.3078 15.3847 23.0770 42.0477 Constraint 101 374 15.6957 19.6196 29.4294 42.0458 Constraint 131 393 19.2634 24.0792 36.1188 42.0414 Constraint 115 374 16.7472 20.9340 31.4010 42.0376 Constraint 109 393 18.8516 23.5645 35.3467 42.0356 Constraint 120 330 8.6153 10.7692 16.1537 42.0145 Constraint 169 484 13.6189 17.0236 25.5354 41.9844 Constraint 352 476 14.4042 18.0053 27.0079 41.9658 Constraint 374 501 17.5972 21.9965 32.9948 41.3218 Constraint 374 493 15.8183 19.7728 29.6592 41.3218 Constraint 401 493 13.5767 16.9709 25.4564 41.3084 Constraint 152 214 13.8808 17.3510 26.0265 41.2135 Constraint 214 401 11.0598 13.8248 20.7371 41.2088 Constraint 222 442 14.4993 18.1241 27.1862 41.1623 Constraint 222 431 12.3133 15.3916 23.0875 41.1623 Constraint 222 426 10.0306 12.5382 18.8073 41.1623 Constraint 222 417 13.9533 17.4416 26.1624 41.1623 Constraint 222 409 11.2487 14.0609 21.0914 41.1623 Constraint 144 222 13.3680 16.7100 25.0650 41.1623 Constraint 136 222 14.5856 18.2320 27.3480 41.1623 Constraint 131 222 15.6220 19.5275 29.2912 41.1623 Constraint 120 222 10.9075 13.6344 20.4516 41.1623 Constraint 199 442 13.1366 16.4207 24.6310 41.1397 Constraint 199 431 11.9546 14.9432 22.4148 41.1397 Constraint 199 426 10.1047 12.6309 18.9464 41.1397 Constraint 199 417 14.3461 17.9326 26.8988 41.1397 Constraint 199 409 12.6602 15.8253 23.7379 41.1397 Constraint 136 199 10.3674 12.9592 19.4389 41.1397 Constraint 131 199 11.9795 14.9744 22.4615 41.1397 Constraint 120 199 8.2522 10.3153 15.4729 41.1397 Constraint 109 189 10.4375 13.0469 19.5704 41.1192 Constraint 101 189 8.5911 10.7389 16.1084 41.1192 Constraint 109 367 15.7680 19.7100 29.5650 41.0742 Constraint 109 359 15.9147 19.8934 29.8401 41.0742 Constraint 189 393 16.7513 20.9391 31.4087 41.0490 Constraint 164 476 13.6512 17.0640 25.5960 41.0448 Constraint 152 330 12.8253 16.0316 24.0474 41.0395 Constraint 144 330 9.9629 12.4537 18.6805 41.0395 Constraint 136 330 11.1466 13.9333 20.9000 41.0395 Constraint 131 330 12.5232 15.6539 23.4809 41.0395 Constraint 120 341 10.8473 13.5591 20.3387 41.0106 Constraint 352 484 12.8894 16.1118 24.1676 40.9848 Constraint 367 493 13.3264 16.6580 24.9870 40.3442 Constraint 401 501 15.6104 19.5130 29.2694 40.3334 Constraint 152 222 16.3900 20.4875 30.7313 40.1893 Constraint 222 401 11.0401 13.8001 20.7002 40.1847 Constraint 169 401 13.3847 16.7309 25.0964 40.1824 Constraint 199 401 12.2397 15.2997 22.9495 40.1620 Constraint 189 476 12.6351 15.7939 23.6909 40.1338 Constraint 330 476 15.5964 19.4956 29.2433 40.1066 Constraint 101 367 13.6191 17.0238 25.5358 40.0932 Constraint 101 359 13.3638 16.7047 25.0571 40.0932 Constraint 109 374 17.4018 21.7522 32.6283 40.0901 Constraint 189 384 16.1947 20.2434 30.3651 40.0815 Constraint 144 341 11.9891 14.9863 22.4795 40.0377 Constraint 136 341 13.3248 16.6560 24.9840 40.0377 Constraint 131 341 14.9918 18.7398 28.1097 40.0377 Constraint 144 352 10.5230 13.1537 19.7306 40.0357 Constraint 136 352 11.6103 14.5128 21.7692 40.0357 Constraint 131 352 13.4297 16.7872 25.1808 40.0357 Constraint 120 352 9.1581 11.4476 17.1714 40.0357 Constraint 164 367 14.4035 18.0044 27.0066 40.0103 Constraint 164 359 14.8900 18.6125 27.9188 40.0103 Constraint 367 501 14.8517 18.5646 27.8469 39.3692 Constraint 384 501 16.7777 20.9721 31.4581 39.3450 Constraint 384 493 15.8419 19.8024 29.7036 39.3450 Constraint 230 431 12.7566 15.9458 23.9187 39.3278 Constraint 230 426 10.4617 13.0771 19.6157 39.3278 Constraint 230 409 10.6366 13.2958 19.9437 39.3278 Constraint 144 230 15.5604 19.4506 29.1758 39.3278 Constraint 136 230 16.8787 21.0984 31.6476 39.3278 Constraint 131 230 17.8476 22.3095 33.4643 39.3278 Constraint 120 230 13.2925 16.6156 24.9234 39.3278 Constraint 115 214 12.4241 15.5301 23.2951 39.2863 Constraint 207 442 13.5745 16.9682 25.4523 39.2355 Constraint 207 431 12.0350 15.0438 22.5657 39.2355 Constraint 207 426 10.0019 12.5024 18.7536 39.2355 Constraint 207 417 14.4613 18.0766 27.1149 39.2355 Constraint 207 409 12.5308 15.6635 23.4952 39.2355 Constraint 144 207 9.9856 12.4820 18.7230 39.2355 Constraint 136 207 11.7461 14.6826 22.0240 39.2355 Constraint 131 207 12.9188 16.1485 24.2227 39.2355 Constraint 120 207 8.6123 10.7654 16.1481 39.2355 Constraint 214 393 14.1837 17.7297 26.5945 39.2320 Constraint 255 442 16.0261 20.0327 30.0490 39.2189 Constraint 255 431 14.4394 18.0492 27.0738 39.2189 Constraint 255 426 12.3671 15.4588 23.1883 39.2189 Constraint 255 417 15.0168 18.7710 28.1565 39.2189 Constraint 255 409 12.8604 16.0755 24.1132 39.2189 Constraint 330 469 13.9707 17.4634 26.1951 39.1663 Constraint 341 469 14.1050 17.6313 26.4470 39.1154 Constraint 115 330 11.3997 14.2496 21.3744 39.1143 Constraint 341 476 16.0974 20.1217 30.1825 39.1028 Constraint 169 359 14.6837 18.3546 27.5319 39.0955 Constraint 152 352 13.4796 16.8495 25.2743 39.0627 Constraint 152 341 14.8252 18.5315 27.7972 39.0627 Constraint 136 393 17.5163 21.8954 32.8430 39.0509 Constraint 115 384 17.9783 22.4729 33.7094 39.0407 Constraint 136 384 17.3016 21.6269 32.4404 39.0405 Constraint 109 384 19.1027 23.8784 35.8176 39.0346 Constraint 136 374 15.0609 18.8261 28.2391 39.0272 Constraint 393 501 18.0823 22.6028 33.9043 38.3566 Constraint 393 493 16.4086 20.5107 30.7661 38.3566 Constraint 109 214 12.5170 15.6463 23.4694 38.3198 Constraint 101 214 9.2670 11.5837 17.3756 38.3198 Constraint 214 461 10.6430 13.3037 19.9556 38.3095 Constraint 214 453 11.3776 14.2220 21.3330 38.3095 Constraint 177 374 12.4041 15.5051 23.2577 38.2911 Constraint 169 417 15.2753 19.0942 28.6413 38.2685 Constraint 169 409 14.6163 18.2704 27.4057 38.2685 Constraint 115 222 13.9101 17.3877 26.0815 38.2621 Constraint 207 401 12.1502 15.1878 22.7817 38.2579 Constraint 115 199 12.0574 15.0717 22.6076 38.2395 Constraint 189 469 12.0092 15.0115 22.5172 38.2126 Constraint 222 393 13.5309 16.9136 25.3704 38.2079 Constraint 247 442 15.3375 19.1719 28.7578 38.1838 Constraint 247 431 13.4533 16.8166 25.2249 38.1838 Constraint 247 426 11.6517 14.5646 21.8470 38.1838 Constraint 247 409 12.3681 15.4601 23.1902 38.1838 Constraint 177 247 16.2878 20.3598 30.5397 38.1838 Constraint 120 247 11.9858 14.9822 22.4733 38.1838 Constraint 330 484 12.8347 16.0434 24.0651 38.1506 Constraint 177 330 11.1035 13.8793 20.8190 38.1404 Constraint 144 255 14.7469 18.4337 27.6505 38.1227 Constraint 136 255 16.2643 20.3304 30.4956 38.1227 Constraint 120 255 12.7613 15.9516 23.9274 38.1227 Constraint 115 341 13.7868 17.2335 25.8503 38.1105 Constraint 164 484 11.9049 14.8812 22.3218 38.1037 Constraint 93 426 10.8003 13.5004 20.2506 38.0520 Constraint 93 152 12.2291 15.2864 22.9296 38.0520 Constraint 169 330 13.9663 17.4579 26.1869 38.0490 Constraint 164 330 13.0263 16.2829 24.4243 38.0490 Constraint 115 230 16.0878 20.1097 30.1646 37.3949 Constraint 214 469 14.1503 17.6878 26.5318 37.3345 Constraint 109 222 13.8383 17.2979 25.9468 37.2957 Constraint 101 222 10.2652 12.8315 19.2473 37.2957 Constraint 222 461 11.8936 14.8669 22.3004 37.2853 Constraint 222 453 12.6560 15.8200 23.7300 37.2853 Constraint 214 384 13.2711 16.5889 24.8834 37.2761 Constraint 109 199 12.3769 15.4711 23.2067 37.2731 Constraint 101 199 9.8262 12.2827 18.4240 37.2731 Constraint 199 461 10.2052 12.7565 19.1348 37.2627 Constraint 199 453 10.8164 13.5206 20.2808 37.2627 Constraint 255 401 12.2665 15.3332 22.9997 37.2529 Constraint 199 393 15.2194 19.0242 28.5363 37.2358 Constraint 144 247 14.0852 17.6065 26.4098 37.2062 Constraint 136 247 15.4635 19.3294 28.9941 37.2062 Constraint 131 247 16.1045 20.1306 30.1959 37.2062 Constraint 323 442 16.1839 20.2299 30.3449 37.2024 Constraint 323 426 13.4172 16.7716 25.1573 37.2024 Constraint 323 409 15.3699 19.2124 28.8185 37.2024 Constraint 323 401 15.9536 19.9419 29.9129 37.2024 Constraint 169 367 13.5967 16.9958 25.4937 37.1965 Constraint 189 374 13.6789 17.0987 25.6480 37.1688 Constraint 109 330 12.1179 15.1474 22.7211 37.1669 Constraint 341 484 14.1319 17.6648 26.4972 37.1468 Constraint 177 352 10.6761 13.3452 20.0177 37.1366 Constraint 115 352 11.9973 14.9966 22.4949 37.1356 Constraint 131 384 19.0195 23.7744 35.6615 37.1057 Constraint 93 461 9.9711 12.4638 18.6958 37.0744 Constraint 93 453 10.1453 12.6817 19.0225 37.0744 Constraint 93 401 13.7223 17.1528 25.7293 37.0744 Constraint 93 442 13.4068 16.7585 25.1377 37.0732 Constraint 93 431 12.9841 16.2301 24.3452 37.0732 Constraint 93 417 15.5799 19.4749 29.2123 37.0732 Constraint 93 409 14.3283 17.9104 26.8656 37.0732 Constraint 109 230 15.9958 19.9948 29.9922 36.4285 Constraint 101 230 12.6605 15.8256 23.7384 36.4285 Constraint 152 230 18.1996 22.7495 34.1242 36.4201 Constraint 230 401 9.8146 12.2683 18.4025 36.3734 Constraint 230 393 12.3129 15.3911 23.0867 36.3734 Constraint 214 476 14.9242 18.6552 27.9828 36.3535 Constraint 115 207 11.8887 14.8609 22.2914 36.3354 Constraint 239 431 12.8654 16.0818 24.1227 36.3331 Constraint 239 426 11.2071 14.0088 21.0132 36.3331 Constraint 239 409 11.2306 14.0382 21.0573 36.3331 Constraint 120 239 13.4406 16.8008 25.2012 36.3331 Constraint 164 417 15.0439 18.8048 28.2072 36.3226 Constraint 222 476 16.2749 20.3436 30.5155 36.3104 Constraint 222 469 15.0595 18.8243 28.2365 36.3104 Constraint 255 393 14.0376 17.5471 26.3206 36.3035 Constraint 199 469 13.1854 16.4817 24.7226 36.2877 Constraint 255 384 13.7597 17.1996 25.7993 36.2854 Constraint 207 393 15.2108 19.0135 28.5203 36.2811 Constraint 177 384 15.3468 19.1835 28.7752 36.2634 Constraint 222 384 12.6126 15.7657 23.6485 36.2519 Constraint 115 247 14.9303 18.6628 27.9943 36.2509 Constraint 359 493 14.5395 18.1743 27.2615 36.2461 Constraint 323 417 17.2517 21.5647 32.3470 36.2352 Constraint 189 484 10.0106 12.5132 18.7698 36.2254 Constraint 247 401 12.3816 15.4770 23.2155 36.2178 Constraint 115 255 15.6432 19.5540 29.3311 36.1898 Constraint 247 417 14.0697 17.5871 26.3807 36.1896 Constraint 101 330 9.3759 11.7199 17.5798 36.1859 Constraint 177 341 11.8041 14.7551 22.1326 36.1636 Constraint 109 341 14.5973 18.2466 27.3699 36.1631 Constraint 93 393 16.9527 21.1909 31.7864 36.0955 Constraint 169 352 13.6563 17.0704 25.6056 36.0722 Constraint 169 341 14.9251 18.6563 27.9845 36.0722 Constraint 164 352 13.0934 16.3667 24.5501 36.0722 Constraint 164 341 14.4710 18.0888 27.1332 36.0722 Constraint 93 169 15.4889 19.3611 29.0416 36.0583 Constraint 93 164 13.5359 16.9199 25.3799 36.0583 Constraint 230 461 13.5103 16.8878 25.3317 35.4508 Constraint 230 453 13.9244 17.4055 26.1083 35.4508 Constraint 230 384 11.0848 13.8560 20.7840 35.4059 Constraint 214 484 13.6342 17.0428 25.5642 35.3813 Constraint 109 207 11.7211 14.6514 21.9771 35.3689 Constraint 101 207 8.4836 10.6045 15.9068 35.3689 Constraint 136 239 17.2670 21.5837 32.3755 35.3657 Constraint 207 461 10.1612 12.7015 19.0523 35.3585 Constraint 207 453 11.0547 13.8183 20.7275 35.3585 Constraint 230 442 13.8976 17.3720 26.0580 35.3481 Constraint 230 417 12.3524 15.4405 23.1607 35.3481 Constraint 255 461 14.0942 17.6177 26.4266 35.3420 Constraint 255 453 14.2680 17.8350 26.7526 35.3420 Constraint 222 484 14.9269 18.6586 27.9879 35.3381 Constraint 199 476 13.5043 16.8803 25.3205 35.3068 Constraint 109 247 14.5385 18.1731 27.2596 35.2845 Constraint 359 501 15.5577 19.4471 29.1707 35.2711 Constraint 199 384 14.5418 18.1772 27.2658 35.2544 Constraint 189 367 11.4259 14.2824 21.4236 35.2162 Constraint 189 359 10.3558 12.9447 19.4171 35.2162 Constraint 109 352 13.2037 16.5046 24.7570 35.1881 Constraint 101 341 11.6448 14.5561 21.8341 35.1821 Constraint 131 374 15.9918 19.9898 29.9847 35.1595 Constraint 93 177 13.0720 16.3400 24.5100 35.1529 Constraint 93 484 10.1294 12.6618 18.9927 35.1272 Constraint 93 476 12.3158 15.3947 23.0921 35.1206 Constraint 93 469 12.9095 16.1369 24.2054 35.1206 Constraint 230 469 16.3476 20.4345 30.6517 34.4759 Constraint 115 239 16.0451 20.0564 30.0846 34.4002 Constraint 144 239 15.8003 19.7504 29.6256 34.3983 Constraint 131 239 17.6299 22.0374 33.0561 34.3983 Constraint 207 469 13.4385 16.7981 25.1972 34.3836 Constraint 255 469 16.6186 20.7733 31.1599 34.3670 Constraint 214 374 11.7309 14.6636 21.9954 34.3634 Constraint 239 442 14.5133 18.1416 27.2124 34.3331 Constraint 247 461 13.2455 16.5569 24.8354 34.3068 Constraint 247 453 13.7628 17.2035 25.8052 34.3068 Constraint 101 247 11.4169 14.2711 21.4066 34.3035 Constraint 323 453 14.2774 17.8468 26.7702 34.3031 Constraint 323 431 13.7089 17.1361 25.7041 34.3002 Constraint 247 384 13.4233 16.7791 25.1686 34.2619 Constraint 109 255 15.2535 19.0669 28.6003 34.2424 Constraint 308 426 15.2893 19.1116 28.6674 34.2209 Constraint 101 352 10.6947 13.3684 20.0526 34.2071 Constraint 93 384 16.7023 20.8778 31.3167 34.1396 Constraint 230 484 16.7374 20.9217 31.3826 33.5036 Constraint 109 239 15.4995 19.3744 29.0616 33.4338 Constraint 101 239 12.1132 15.1415 22.7123 33.4338 Constraint 207 476 14.0988 17.6234 26.4352 33.4026 Constraint 255 476 17.6241 22.0301 33.0452 33.3860 Constraint 239 401 10.9095 13.6369 20.4554 33.3787 Constraint 199 484 12.0175 15.0218 22.5328 33.3569 Constraint 207 384 14.4334 18.0417 27.0626 33.3503 Constraint 239 417 12.6613 15.8266 23.7399 33.3447 Constraint 222 374 11.5182 14.3977 21.5966 33.3392 Constraint 247 469 15.7520 19.6900 29.5350 33.3319 Constraint 101 255 11.9488 14.9360 22.4040 33.2614 Constraint 308 409 16.9275 21.1594 31.7391 33.2536 Constraint 247 393 13.7305 17.1631 25.7447 33.2352 Constraint 239 461 13.5765 16.9706 25.4559 32.4561 Constraint 239 453 14.0585 17.5731 26.3597 32.4561 Constraint 177 393 14.1964 17.7455 26.6182 32.4237 Constraint 239 384 11.9794 14.9742 22.4613 32.4112 Constraint 214 367 9.5911 11.9889 17.9834 32.4108 Constraint 214 359 8.1715 10.2144 15.3216 32.4108 Constraint 261 442 14.9974 18.7467 28.1201 32.3961 Constraint 261 431 13.5838 16.9797 25.4696 32.3961 Constraint 261 426 11.3168 14.1460 21.2190 32.3961 Constraint 261 417 14.7142 18.3927 27.5890 32.3961 Constraint 261 409 12.6237 15.7796 23.6693 32.3961 Constraint 199 374 12.1555 15.1943 22.7915 32.3672 Constraint 277 442 16.5989 20.7486 31.1229 32.3625 Constraint 277 431 15.1120 18.8899 28.3349 32.3625 Constraint 277 426 13.5488 16.9361 25.4041 32.3625 Constraint 277 417 16.9008 21.1260 31.6890 32.3625 Constraint 277 409 14.9075 18.6344 27.9517 32.3625 Constraint 247 476 17.2665 21.5831 32.3747 32.3509 Constraint 269 431 14.4917 18.1147 27.1720 32.3385 Constraint 269 426 12.6460 15.8075 23.7112 32.3385 Constraint 269 409 14.2445 17.8057 26.7085 32.3385 Constraint 352 501 12.9711 16.2138 24.3207 32.3060 Constraint 352 493 11.2529 14.0661 21.0991 32.3060 Constraint 152 323 14.1495 17.6868 26.5303 32.2991 Constraint 144 323 11.3531 14.1914 21.2871 32.2991 Constraint 136 323 12.8476 16.0595 24.0893 32.2991 Constraint 131 323 14.4168 18.0210 27.0315 32.2991 Constraint 120 323 10.3582 12.9477 19.4216 32.2991 Constraint 315 442 16.7103 20.8879 31.3318 32.2973 Constraint 315 431 15.2907 19.1134 28.6701 32.2973 Constraint 315 426 13.7391 17.1738 25.7607 32.2973 Constraint 315 417 17.5978 21.9972 32.9959 32.2973 Constraint 315 409 15.6240 19.5300 29.2951 32.2973 Constraint 308 401 17.2409 21.5512 32.3268 32.2760 Constraint 86 426 13.4923 16.8654 25.2981 32.1348 Constraint 86 409 17.3670 21.7088 32.5631 32.1348 Constraint 86 152 12.7369 15.9211 23.8816 32.1348 Constraint 86 144 11.9018 14.8773 22.3159 32.1348 Constraint 239 469 15.9103 19.8879 29.8319 31.4812 Constraint 152 239 18.3325 22.9156 34.3734 31.4803 Constraint 207 484 12.3602 15.4503 23.1754 31.4527 Constraint 255 484 15.8581 19.8226 29.7339 31.4328 Constraint 207 374 13.0440 16.3050 24.4575 31.4125 Constraint 323 461 11.7575 14.6968 22.0452 31.4009 Constraint 222 367 9.8942 12.3677 18.5516 31.3867 Constraint 222 359 8.1308 10.1634 15.2452 31.3867 Constraint 277 461 13.8918 17.3648 26.0472 31.3849 Constraint 277 453 14.5208 18.1510 27.2266 31.3849 Constraint 277 384 16.4148 20.5185 30.7778 31.3849 Constraint 247 484 15.5423 19.4279 29.1419 31.3786 Constraint 152 247 16.0422 20.0527 30.0791 31.3655 Constraint 199 367 10.5053 13.1316 19.6974 31.3641 Constraint 199 359 8.7214 10.9018 16.3527 31.3641 Constraint 269 374 14.2323 17.7904 26.6856 31.3609 Constraint 269 442 15.7513 19.6891 29.5337 31.3385 Constraint 269 417 16.0802 20.1002 30.1503 31.3385 Constraint 308 431 16.1182 20.1478 30.2217 31.3187 Constraint 189 330 8.4510 10.5638 15.8457 31.3089 Constraint 144 261 12.5929 15.7411 23.6117 31.2998 Constraint 136 261 14.4011 18.0014 27.0020 31.2998 Constraint 131 261 14.8470 18.5587 27.8381 31.2998 Constraint 120 261 10.7619 13.4524 20.1786 31.2998 Constraint 177 255 14.9781 18.7226 28.0840 31.2773 Constraint 131 255 15.3459 19.1824 28.7736 31.2773 Constraint 120 277 12.3651 15.4563 23.1845 31.2663 Constraint 115 277 15.1881 18.9851 28.4777 31.2663 Constraint 120 269 11.0245 13.7807 20.6710 31.2423 Constraint 86 401 16.1033 20.1292 30.1937 31.1572 Constraint 86 442 15.3661 19.2076 28.8113 31.1560 Constraint 86 431 15.7877 19.7346 29.6019 31.1560 Constraint 86 417 17.9716 22.4645 33.6967 31.1560 Constraint 86 169 17.1746 21.4683 32.2024 31.1380 Constraint 86 164 15.1552 18.9440 28.4160 31.1380 Constraint 230 374 10.0737 12.5922 18.8883 30.5164 Constraint 239 484 16.1472 20.1840 30.2761 30.5089 Constraint 230 476 16.6880 20.8600 31.2900 30.4962 Constraint 164 374 12.9032 16.1290 24.1936 30.4521 Constraint 261 453 12.9225 16.1532 24.2297 30.4520 Constraint 255 374 12.4316 15.5395 23.3093 30.4464 Constraint 330 501 12.1006 15.1257 22.6886 30.4448 Constraint 330 493 11.0735 13.8418 20.7628 30.4448 Constraint 261 401 11.9513 14.9391 22.4086 30.4300 Constraint 164 247 17.1776 21.4720 32.2081 30.4082 Constraint 277 401 14.6644 18.3305 27.4958 30.3965 Constraint 341 493 13.1880 16.4851 24.7276 30.3958 Constraint 269 461 13.3103 16.6379 24.9568 30.3944 Constraint 269 453 13.8715 17.3393 26.0090 30.3944 Constraint 269 401 13.9630 17.4537 26.1806 30.3725 Constraint 247 374 12.2900 15.3626 23.0438 30.3608 Constraint 315 401 15.8042 19.7552 29.6329 30.3524 Constraint 177 323 11.7212 14.6515 21.9773 30.3506 Constraint 115 261 13.7365 17.1706 25.7559 30.3334 Constraint 189 341 9.0296 11.2870 16.9304 30.3071 Constraint 189 352 8.5904 10.7380 16.1070 30.3051 Constraint 109 277 14.5111 18.1389 27.2083 30.2853 Constraint 86 461 12.5898 15.7372 23.6059 30.1908 Constraint 86 453 11.7806 14.7257 22.0886 30.1908 Constraint 442 506 10.9915 13.7394 20.6091 29.5883 Constraint 431 506 8.4388 10.5485 15.8228 29.5883 Constraint 426 506 10.1007 12.6259 18.9389 29.5883 Constraint 417 506 12.6597 15.8247 23.7370 29.5883 Constraint 409 506 11.6420 14.5525 21.8288 29.5883 Constraint 230 367 9.2585 11.5731 17.3597 29.5522 Constraint 230 359 8.2443 10.3053 15.4580 29.5522 Constraint 277 374 14.4473 18.0591 27.0886 29.4818 Constraint 239 476 16.9316 21.1645 31.7468 29.4812 Constraint 261 384 14.7323 18.4154 27.6231 29.4625 Constraint 261 374 12.6138 15.7672 23.6508 29.4625 Constraint 207 367 10.8487 13.5609 20.3413 29.4599 Constraint 207 359 8.8375 11.0468 16.5702 29.4599 Constraint 144 493 10.2685 12.8356 19.2534 29.4547 Constraint 136 493 9.4247 11.7809 17.6713 29.4547 Constraint 131 493 11.0623 13.8279 20.7418 29.4547 Constraint 120 493 7.8326 9.7907 14.6860 29.4547 Constraint 115 493 8.9385 11.1731 16.7597 29.4547 Constraint 109 493 11.2086 14.0108 21.0162 29.4547 Constraint 101 493 10.0370 12.5462 18.8193 29.4547 Constraint 152 374 14.1532 17.6915 26.5372 29.4447 Constraint 255 367 11.3947 14.2434 21.3650 29.4433 Constraint 341 501 13.3747 16.7184 25.0775 29.4430 Constraint 277 367 13.3104 16.6379 24.9569 29.4323 Constraint 261 393 14.1886 17.7357 26.6036 29.4322 Constraint 323 484 13.6599 17.0749 25.6124 29.4102 Constraint 269 367 12.6814 15.8517 23.7776 29.4083 Constraint 115 323 13.1763 16.4704 24.7056 29.3990 Constraint 308 453 16.1221 20.1527 30.2290 29.3910 Constraint 269 384 15.6847 19.6059 29.4089 29.3746 Constraint 290 426 14.1092 17.6365 26.4547 29.3713 Constraint 315 393 18.7980 23.4975 35.2462 29.3640 Constraint 109 261 13.1383 16.4229 24.6343 29.3524 Constraint 152 255 15.7126 19.6408 29.4612 29.3267 Constraint 144 277 12.9547 16.1933 24.2900 29.3110 Constraint 164 323 14.5289 18.1611 27.2417 29.3085 Constraint 101 277 11.3892 14.2365 21.3548 29.3043 Constraint 93 189 10.0534 12.5668 18.8502 29.3024 Constraint 109 269 13.6824 17.1031 25.6546 29.2949 Constraint 144 269 11.3735 14.2169 21.3254 29.2870 Constraint 136 269 13.7157 17.1447 25.7170 29.2870 Constraint 131 269 14.2682 17.8352 26.7528 29.2870 Constraint 177 269 13.9529 17.4411 26.1616 29.2668 Constraint 93 374 15.5553 19.4441 29.1662 29.2501 Constraint 86 177 15.0770 18.8463 28.2694 29.2357 Constraint 86 484 11.4485 14.3106 21.4660 29.2185 Constraint 401 506 14.1209 17.6512 26.4768 28.6106 Constraint 374 506 15.9497 19.9371 29.9056 28.6106 Constraint 214 330 7.5109 9.3886 14.0829 28.5036 Constraint 214 341 7.3388 9.1735 13.7602 28.4881 Constraint 169 374 10.5375 13.1719 19.7579 28.4865 Constraint 136 501 13.1660 16.4575 24.6862 28.4798 Constraint 120 501 11.0301 13.7877 20.6815 28.4798 Constraint 115 501 12.3233 15.4041 23.1062 28.4798 Constraint 109 501 14.2194 17.7742 26.6614 28.4798 Constraint 101 501 12.3889 15.4861 23.2292 28.4798 Constraint 222 330 9.4410 11.8013 17.7019 28.4322 Constraint 109 323 14.1012 17.6265 26.4398 28.4265 Constraint 315 453 14.9917 18.7396 28.1095 28.4203 Constraint 247 367 10.7058 13.3822 20.0734 28.4082 Constraint 247 359 9.3703 11.7129 17.5693 28.4082 Constraint 290 431 15.3461 19.1826 28.7740 28.3964 Constraint 290 409 14.6754 18.3442 27.5164 28.3964 Constraint 290 453 15.2893 19.1117 28.6675 28.3937 Constraint 239 393 10.8825 13.6031 20.4047 28.3874 Constraint 290 442 16.8188 21.0235 31.5353 28.3829 Constraint 101 261 9.8857 12.3572 18.5358 28.3714 Constraint 120 315 11.6327 14.5409 21.8113 28.3689 Constraint 255 359 9.7356 12.1694 18.2542 28.3471 Constraint 177 261 14.3917 17.9896 26.9844 28.3461 Constraint 120 308 12.1925 15.2407 22.8610 28.3434 Constraint 169 323 14.6509 18.3136 27.4704 28.3413 Constraint 277 359 11.8726 14.8408 22.2612 28.3361 Constraint 115 269 13.6332 17.0415 25.5623 28.3206 Constraint 152 269 14.1279 17.6599 26.4898 28.3141 Constraint 101 269 10.4636 13.0795 19.6192 28.3139 Constraint 269 359 11.2581 14.0726 21.1089 28.3121 Constraint 308 384 18.7463 23.4329 35.1493 28.2980 Constraint 93 367 13.1518 16.4397 24.6596 28.2764 Constraint 93 359 13.2388 16.5486 24.8228 28.2764 Constraint 93 341 11.3537 14.1921 21.2881 28.2764 Constraint 93 330 9.9991 12.4989 18.7484 28.2764 Constraint 120 290 12.7437 15.9296 23.8945 28.2751 Constraint 115 290 15.0524 18.8155 28.2233 28.2751 Constraint 101 290 12.0962 15.1203 22.6804 28.2751 Constraint 86 374 17.9410 22.4263 33.6394 28.2237 Constraint 367 506 13.4751 16.8439 25.2658 27.6330 Constraint 393 506 16.5852 20.7315 31.0973 27.6222 Constraint 384 506 15.2510 19.0638 28.5956 27.6222 Constraint 323 469 13.7304 17.1630 25.7445 27.5938 Constraint 261 461 11.9317 14.9147 22.3720 27.5498 Constraint 152 393 16.9441 21.1802 31.7703 27.5390 Constraint 239 374 10.8662 13.5827 20.3741 27.5217 Constraint 152 493 11.8525 14.8156 22.2234 27.5199 Constraint 308 417 17.8840 22.3550 33.5325 27.5193 Constraint 214 352 6.6336 8.2919 12.4379 27.5132 Constraint 131 501 14.4737 18.0922 27.1383 27.5124 Constraint 261 367 11.5111 14.3888 21.5832 27.5099 Constraint 164 230 17.8438 22.3047 33.4571 27.5094 Constraint 277 469 15.4653 19.3317 28.9975 27.5077 Constraint 164 384 15.4271 19.2839 28.9259 27.5004 Constraint 93 214 10.4376 13.0470 19.5705 27.4915 Constraint 222 341 7.9095 9.8869 14.8303 27.4640 Constraint 199 330 8.0363 10.0454 15.0681 27.4568 Constraint 93 222 11.1166 13.8958 20.8437 27.4483 Constraint 101 323 11.3966 14.2457 21.3686 27.4455 Constraint 199 341 7.7752 9.7190 14.5785 27.4413 Constraint 290 417 16.6905 20.8632 31.2947 27.4080 Constraint 290 384 16.3421 20.4276 30.6415 27.4053 Constraint 290 374 14.9416 18.6770 28.0155 27.4053 Constraint 290 367 13.7498 17.1873 25.7809 27.3940 Constraint 144 315 11.8987 14.8734 22.3101 27.3940 Constraint 136 315 13.9571 17.4464 26.1696 27.3940 Constraint 269 393 16.2733 20.3417 30.5125 27.3863 Constraint 169 247 16.8352 21.0440 31.5660 27.3823 Constraint 189 261 12.3533 15.4416 23.1624 27.3685 Constraint 136 277 14.5797 18.2246 27.3370 27.3611 Constraint 131 277 15.1095 18.8869 28.3304 27.3611 Constraint 169 255 17.2616 21.5770 32.3655 27.3530 Constraint 177 277 14.8021 18.5026 27.7540 27.3409 Constraint 93 352 10.3581 12.9477 19.4215 27.3015 Constraint 86 476 12.9610 16.2012 24.3018 27.2696 Constraint 86 469 14.5868 18.2334 27.3502 27.2696 Constraint 86 384 19.3822 24.2278 36.3417 27.2256 Constraint 93 230 13.4544 16.8180 25.2271 26.5811 Constraint 261 469 14.7218 18.4023 27.6034 26.5749 Constraint 308 442 16.3521 20.4401 30.6602 26.5664 Constraint 239 367 9.8809 12.3511 18.5267 26.5575 Constraint 239 359 9.2434 11.5543 17.3314 26.5575 Constraint 177 493 11.6025 14.5031 21.7546 26.5556 Constraint 144 501 12.9412 16.1765 24.2648 26.5450 Constraint 269 469 15.1485 18.9356 28.4034 26.5173 Constraint 164 239 19.0171 23.7714 35.6571 26.5137 Constraint 296 426 14.5566 18.1957 27.2936 26.5088 Constraint 277 393 16.4267 20.5333 30.8000 26.4977 Constraint 277 484 14.1656 17.7070 26.5606 26.4947 Constraint 222 352 7.8325 9.7906 14.6860 26.4890 Constraint 308 461 14.3346 17.9183 26.8774 26.4888 Constraint 296 409 15.3663 19.2079 28.8118 26.4867 Constraint 269 484 13.8473 17.3091 25.9637 26.4853 Constraint 199 352 7.1511 8.9389 13.4083 26.4664 Constraint 169 493 14.1961 17.7451 26.6176 26.4641 Constraint 308 484 14.9466 18.6832 28.0248 26.4508 Constraint 93 199 11.4560 14.3200 21.4801 26.4447 Constraint 290 401 14.7439 18.4299 27.6448 26.4304 Constraint 290 393 17.3237 21.6547 32.4820 26.4304 Constraint 152 261 14.2997 17.8746 26.8119 26.4157 Constraint 261 359 10.8752 13.5940 20.3910 26.4137 Constraint 177 315 12.0222 15.0277 22.5415 26.3961 Constraint 152 277 14.7924 18.4905 27.7358 26.3882 Constraint 277 341 9.8143 12.2679 18.4018 26.3546 Constraint 169 261 17.0635 21.3293 31.9940 26.3534 Constraint 144 290 13.7131 17.1414 25.7121 26.3199 Constraint 290 359 12.7539 15.9424 23.9136 26.2978 Constraint 86 367 15.4246 19.2808 28.9212 26.2711 Constraint 86 352 13.2597 16.5746 24.8619 26.2711 Constraint 442 516 13.6374 17.0468 25.5701 25.6706 Constraint 431 516 10.7751 13.4689 20.2033 25.6706 Constraint 426 516 12.3387 15.4234 23.1351 25.6706 Constraint 417 516 14.8138 18.5172 27.7759 25.6706 Constraint 409 516 13.2672 16.5840 24.8760 25.6706 Constraint 230 330 10.4954 13.1192 19.6788 25.6449 Constraint 323 476 14.9594 18.6992 28.0488 25.6318 Constraint 230 341 9.1684 11.4604 17.1907 25.6295 Constraint 261 476 15.3263 19.1578 28.7367 25.5939 Constraint 177 501 14.8637 18.5796 27.8694 25.5807 Constraint 152 501 15.2131 19.0164 28.5246 25.5776 Constraint 207 330 8.3139 10.3923 15.5885 25.5526 Constraint 277 476 16.1873 20.2341 30.3512 25.5458 Constraint 207 341 7.2384 9.0480 13.5719 25.5372 Constraint 152 384 17.0503 21.3128 31.9693 25.5341 Constraint 315 461 13.1022 16.3778 24.5667 25.5181 Constraint 296 374 15.5490 19.4362 29.1543 25.4956 Constraint 290 461 13.7279 17.1599 25.7399 25.4915 Constraint 93 247 13.4890 16.8612 25.2919 25.4529 Constraint 93 493 10.1132 12.6415 18.9623 25.4508 Constraint 115 308 14.4620 18.0775 27.1163 25.4433 Constraint 131 315 14.5680 18.2100 27.3151 25.4387 Constraint 255 330 9.4073 11.7591 17.6387 25.4282 Constraint 189 323 8.7007 10.8758 16.3137 25.4233 Constraint 189 315 10.4643 13.0804 19.6206 25.4151 Constraint 255 341 9.8780 12.3475 18.5213 25.4128 Constraint 101 296 12.2330 15.2913 22.9369 25.4125 Constraint 93 255 13.7724 17.2155 25.8232 25.4024 Constraint 277 352 10.4544 13.0680 19.6020 25.3797 Constraint 269 330 10.1928 12.7410 19.1116 25.3576 Constraint 109 290 13.6521 17.0652 25.5978 25.3562 Constraint 81 152 13.2372 16.5465 24.8198 25.3457 Constraint 81 144 12.2949 15.3686 23.0529 25.3457 Constraint 81 136 11.9777 14.9722 22.4583 25.3457 Constraint 269 341 10.4240 13.0300 19.5451 25.3422 Constraint 86 359 15.2822 19.1028 28.6541 25.2742 Constraint 86 341 13.8060 17.2575 25.8863 25.2742 Constraint 86 330 12.1110 15.1388 22.7081 25.2742 Constraint 453 516 12.8757 16.0947 24.1420 24.6929 Constraint 401 516 16.2716 20.3396 30.5093 24.6929 Constraint 230 352 8.3532 10.4416 15.6623 24.6546 Constraint 93 239 13.3210 16.6512 24.9768 24.5832 Constraint 207 352 7.4078 9.2598 13.8896 24.5623 Constraint 169 393 12.1745 15.2182 22.8273 24.5464 Constraint 315 469 15.7853 19.7316 29.5975 24.5431 Constraint 93 207 9.4946 11.8682 17.8023 24.5406 Constraint 269 476 15.5484 19.4355 29.1533 24.5363 Constraint 296 367 13.5273 16.9091 25.3636 24.5314 Constraint 164 493 12.0889 15.1111 22.6667 24.5293 Constraint 296 401 15.2346 19.0433 28.5649 24.5207 Constraint 290 469 16.0832 20.1040 30.1560 24.5166 Constraint 315 484 14.4171 18.0214 27.0320 24.5051 Constraint 247 330 8.2011 10.2514 15.3771 24.5009 Constraint 115 315 14.3287 17.9109 26.8664 24.4938 Constraint 247 341 8.9521 11.1901 16.7851 24.4855 Constraint 261 330 10.4559 13.0699 19.6048 24.4477 Constraint 144 308 11.2626 14.0783 21.1174 24.4422 Constraint 136 308 13.4532 16.8165 25.2248 24.4422 Constraint 131 308 14.0723 17.5904 26.3855 24.4422 Constraint 164 255 16.2938 20.3672 30.5508 24.4396 Constraint 255 352 9.2156 11.5195 17.2792 24.4379 Constraint 189 277 13.0510 16.3138 24.4707 24.4340 Constraint 189 269 11.7959 14.7448 22.1172 24.4303 Constraint 81 367 16.5079 20.6349 30.9524 24.3680 Constraint 81 359 16.3303 20.4128 30.6192 24.3680 Constraint 81 352 13.9407 17.4259 26.1388 24.3680 Constraint 81 341 14.4794 18.0992 27.1488 24.3680 Constraint 269 352 10.6196 13.2745 19.9118 24.3673 Constraint 81 442 16.6187 20.7734 31.1601 24.3668 Constraint 81 431 16.9406 21.1758 31.7637 24.3668 Constraint 81 426 14.5894 18.2368 27.3552 24.3668 Constraint 81 417 19.1658 23.9572 35.9358 24.3668 Constraint 81 409 18.1368 22.6710 34.0066 24.3668 Constraint 308 393 19.0200 23.7750 35.6625 24.3572 Constraint 81 169 18.2289 22.7861 34.1792 24.3488 Constraint 81 164 16.4094 20.5117 30.7675 24.3488 Constraint 86 393 18.2718 22.8397 34.2596 24.3208 Constraint 374 516 17.3647 21.7059 32.5588 23.7394 Constraint 367 516 14.8313 18.5391 27.8086 23.7153 Constraint 393 516 18.6486 23.3108 34.9662 23.7046 Constraint 384 516 16.8005 21.0007 31.5010 23.7046 Constraint 214 493 13.0193 16.2742 24.4113 23.6630 Constraint 261 484 13.6410 17.0512 25.5768 23.6406 Constraint 222 493 14.6169 18.2712 27.4067 23.6198 Constraint 296 442 16.6332 20.7915 31.1872 23.6066 Constraint 296 431 15.1491 18.9364 28.4045 23.6066 Constraint 323 493 12.2611 15.3263 22.9895 23.6033 Constraint 214 323 10.0413 12.5516 18.8274 23.6011 Constraint 169 384 12.7931 15.9914 23.9871 23.5908 Constraint 189 493 11.5953 14.4942 21.7413 23.5858 Constraint 290 484 14.3356 17.9195 26.8792 23.5443 Constraint 290 476 16.5428 20.6785 31.0177 23.5282 Constraint 109 315 14.7714 18.4642 27.6963 23.5213 Constraint 247 352 8.2876 10.3595 15.5392 23.5106 Constraint 207 315 10.6005 13.2506 19.8760 23.5060 Constraint 199 315 10.3432 12.9290 19.3935 23.5060 Constraint 109 308 14.0478 17.5598 26.3396 23.4959 Constraint 152 315 13.1382 16.4227 24.6340 23.4928 Constraint 261 341 10.6552 13.3190 19.9786 23.4794 Constraint 152 308 12.9355 16.1694 24.2541 23.4750 Constraint 189 308 10.8482 13.5603 20.3405 23.4692 Constraint 109 296 13.9801 17.4751 26.2127 23.4573 Constraint 177 308 11.6337 14.5421 21.8132 23.4548 Constraint 131 290 14.3840 17.9800 26.9701 23.4010 Constraint 81 461 14.0016 17.5020 26.2530 23.4003 Constraint 81 453 13.1528 16.4410 24.6615 23.4003 Constraint 81 401 17.1624 21.4530 32.1795 23.3892 Constraint 81 374 18.3673 22.9592 34.4388 23.3892 Constraint 86 189 12.7524 15.9405 23.9108 23.3852 Constraint 81 330 12.0411 15.0513 22.5770 23.3712 Constraint 169 269 15.6128 19.5160 29.2740 23.3466 Constraint 230 493 15.7071 19.6339 29.4509 22.7526 Constraint 214 501 14.7093 18.3866 27.5799 22.6881 Constraint 308 469 15.9543 19.9428 29.9142 22.6817 Constraint 239 330 10.9967 13.7459 20.6188 22.6502 Constraint 222 501 15.6924 19.6155 29.4233 22.6449 Constraint 239 341 10.3086 12.8857 19.3286 22.6348 Constraint 296 461 14.0174 17.5218 26.2827 22.6290 Constraint 296 453 14.6226 18.2783 27.4174 22.6290 Constraint 164 393 13.0804 16.3505 24.5258 22.6005 Constraint 169 501 16.3626 20.4532 30.6799 22.5870 Constraint 164 501 15.0434 18.8043 28.2064 22.5870 Constraint 315 476 16.3358 20.4198 30.6297 22.5812 Constraint 222 323 11.4767 14.3459 21.5189 22.5769 Constraint 101 315 11.8664 14.8329 22.2494 22.5403 Constraint 207 308 12.5486 15.6857 23.5286 22.5311 Constraint 199 308 12.4229 15.5286 23.2929 22.5311 Constraint 169 239 18.6415 23.3019 34.9528 22.5300 Constraint 93 501 11.0590 13.8237 20.7356 22.5206 Constraint 101 308 11.4656 14.3320 21.4981 22.5149 Constraint 214 315 10.2293 12.7866 19.1799 22.5095 Constraint 261 352 9.5838 11.9797 17.9695 22.5045 Constraint 199 269 11.0843 13.8554 20.7831 22.4839 Constraint 164 261 15.1089 18.8861 28.3291 22.4835 Constraint 81 177 15.8345 19.7931 29.6896 22.4466 Constraint 81 484 12.8259 16.0323 24.0485 22.4254 Constraint 164 277 16.1852 20.2316 30.3473 22.4246 Constraint 73 359 15.7450 19.6812 29.5218 22.4203 Constraint 73 352 13.6488 17.0610 25.5915 22.4203 Constraint 73 152 15.2291 19.0364 28.5546 22.4203 Constraint 73 144 13.4917 16.8646 25.2969 22.4203 Constraint 73 136 12.7159 15.8949 23.8424 22.4203 Constraint 73 131 11.8016 14.7520 22.1279 22.4203 Constraint 230 501 16.5892 20.7366 31.1048 21.7777 Constraint 230 323 12.5455 15.6818 23.5227 21.6623 Constraint 239 352 9.4799 11.8498 17.7747 21.6599 Constraint 296 476 16.8808 21.1011 31.6516 21.6540 Constraint 296 469 16.2886 20.3607 30.5411 21.6540 Constraint 296 417 16.2339 20.2923 30.4385 21.6432 Constraint 189 501 13.7998 17.2498 25.8746 21.6332 Constraint 199 323 8.7161 10.8952 16.3427 21.5846 Constraint 86 214 13.0448 16.3060 24.4591 21.5743 Constraint 230 296 13.1734 16.4667 24.7001 21.5605 Constraint 214 308 12.0377 15.0471 22.5706 21.5345 Constraint 86 222 13.8212 17.2765 25.9148 21.5311 Constraint 222 315 11.5100 14.3876 21.5813 21.5285 Constraint 93 323 11.4530 14.3162 21.4743 21.5215 Constraint 199 277 12.0197 15.0247 22.5370 21.5100 Constraint 93 261 11.4771 14.3464 21.5196 21.5095 Constraint 296 384 15.6768 19.5960 29.3940 21.5081 Constraint 144 296 12.2106 15.2633 22.8950 21.5074 Constraint 136 296 13.8981 17.3726 26.0588 21.5074 Constraint 131 296 14.4354 18.0443 27.0664 21.5074 Constraint 120 296 11.1174 13.8967 20.8451 21.5074 Constraint 115 296 13.5552 16.9440 25.4161 21.5074 Constraint 222 308 13.7618 17.2023 25.8035 21.5064 Constraint 86 255 14.7475 18.4343 27.6515 21.4821 Constraint 164 315 14.2629 17.8286 26.7429 21.4798 Constraint 93 277 12.7440 15.9300 23.8951 21.4614 Constraint 136 290 13.1290 16.4112 24.6168 21.4511 Constraint 73 442 15.9066 19.8833 29.8249 21.4414 Constraint 73 431 15.8729 19.8411 29.7617 21.4414 Constraint 73 426 13.8444 17.3055 25.9583 21.4414 Constraint 73 367 15.5394 19.4242 29.1363 21.4414 Constraint 73 330 11.8786 14.8482 22.2723 21.4235 Constraint 73 164 17.6260 22.0324 33.0487 21.4235 Constraint 93 290 12.4909 15.6137 23.4205 21.4132 Constraint 164 269 13.9506 17.4382 26.1573 21.4007 Constraint 207 493 13.9862 17.4827 26.2240 20.7121 Constraint 359 506 12.5592 15.6990 23.5485 20.7027 Constraint 323 501 10.9141 13.6427 20.4640 20.7011 Constraint 199 493 12.3739 15.4674 23.2011 20.6891 Constraint 296 484 13.9717 17.4647 26.1970 20.6818 Constraint 86 230 15.8035 19.7543 29.6315 20.6639 Constraint 207 323 9.0976 11.3720 17.0579 20.6299 Constraint 247 493 14.0924 17.6155 26.4233 20.6276 Constraint 261 323 12.7026 15.8783 23.8174 20.6023 Constraint 230 315 12.6506 15.8132 23.7198 20.5707 Constraint 247 323 11.0397 13.7996 20.6994 20.5637 Constraint 255 323 12.5861 15.7326 23.5990 20.5415 Constraint 255 315 11.5294 14.4118 21.6177 20.5377 Constraint 152 296 14.2221 17.7777 26.6665 20.5344 Constraint 86 247 14.3862 17.9828 26.9741 20.5326 Constraint 222 296 11.6938 14.6173 21.9259 20.5289 Constraint 86 199 14.3573 17.9466 26.9199 20.5275 Constraint 81 493 12.9645 16.2056 24.3084 20.5265 Constraint 86 493 11.1126 13.8908 20.8362 20.5238 Constraint 189 290 15.5726 19.4658 29.1986 20.5226 Constraint 169 315 14.3933 17.9916 26.9874 20.5126 Constraint 222 290 11.5892 14.4866 21.7298 20.4884 Constraint 164 308 14.2568 17.8210 26.7316 20.4844 Constraint 73 461 12.9317 16.1646 24.2469 20.4750 Constraint 73 453 12.6887 15.8609 23.7913 20.4750 Constraint 93 269 12.4129 15.5162 23.2742 20.4636 Constraint 169 277 16.3546 20.4433 30.6650 20.4517 Constraint 73 341 12.9272 16.1590 24.2384 20.4446 Constraint 73 417 17.8767 22.3459 33.5188 20.4414 Constraint 73 409 16.8367 21.0458 31.5687 20.4414 Constraint 73 401 16.2663 20.3329 30.4993 20.4414 Constraint 73 374 17.4335 21.7918 32.6877 20.4414 Constraint 73 169 19.1780 23.9725 35.9588 20.4235 Constraint 239 493 15.4036 19.2545 28.8818 19.7579 Constraint 277 493 14.1676 17.7095 26.5643 19.7366 Constraint 255 493 14.4246 18.0307 27.0461 19.7323 Constraint 261 493 13.8969 17.3711 26.0567 19.7318 Constraint 269 493 13.9372 17.4215 26.1323 19.7271 Constraint 352 506 9.8811 12.3514 18.5271 19.7143 Constraint 199 501 14.8536 18.5670 27.8505 19.7142 Constraint 239 323 13.2013 16.5017 24.7525 19.6676 Constraint 247 501 14.3513 17.9391 26.9086 19.6527 Constraint 207 296 12.4083 15.5104 23.2656 19.6180 Constraint 199 296 13.0575 16.3219 24.4829 19.6180 Constraint 207 277 10.8834 13.6043 20.4064 19.6059 Constraint 296 393 16.3989 20.4987 30.7480 19.5803 Constraint 214 290 11.8586 14.8233 22.2349 19.5787 Constraint 214 296 11.3950 14.2438 21.3656 19.5761 Constraint 177 296 13.1441 16.4302 24.6453 19.5589 Constraint 230 308 14.9300 18.6625 27.9937 19.5508 Constraint 81 501 14.1017 17.6271 26.4406 19.5488 Constraint 86 261 13.4757 16.8446 25.2669 19.5377 Constraint 81 476 13.6809 17.1012 25.6518 19.5232 Constraint 81 469 15.2098 19.0122 28.5184 19.5232 Constraint 152 290 13.2850 16.6062 24.9093 19.5163 Constraint 86 323 14.2458 17.8072 26.7109 19.5162 Constraint 73 484 12.1133 15.1416 22.7124 19.5000 Constraint 86 277 14.5595 18.1994 27.2991 19.4896 Constraint 86 290 14.3225 17.9031 26.8547 19.4414 Constraint 239 501 15.7645 19.7056 29.5584 18.7830 Constraint 308 476 15.1335 18.9169 28.3754 18.7739 Constraint 207 501 15.4715 19.3394 29.0091 18.7595 Constraint 255 501 15.1306 18.9132 28.3698 18.7574 Constraint 269 501 15.2934 19.1167 28.6750 18.7522 Constraint 341 506 10.3796 12.9745 19.4618 18.7471 Constraint 308 493 13.5907 16.9884 25.4826 18.7020 Constraint 86 239 14.8080 18.5099 27.7649 18.6660 Constraint 352 516 13.1318 16.4147 24.6221 18.6288 Constraint 86 207 12.6182 15.7727 23.6590 18.6234 Constraint 199 290 13.7837 17.2296 25.8445 18.5795 Constraint 239 315 12.5226 15.6533 23.4799 18.5760 Constraint 81 323 14.1256 17.6571 26.4856 18.5626 Constraint 247 315 10.9627 13.7034 20.5552 18.5598 Constraint 239 308 15.3727 19.2158 28.8237 18.5539 Constraint 86 501 12.4732 15.5915 23.3872 18.5520 Constraint 93 296 13.4150 16.7687 25.1530 18.5507 Constraint 177 290 14.2349 17.7936 26.6904 18.5412 Constraint 247 308 14.3980 17.9975 26.9963 18.5377 Constraint 81 189 12.5906 15.7382 23.6073 18.4991 Constraint 86 269 14.1437 17.6797 26.5195 18.4918 Constraint 73 177 15.9557 19.9446 29.9169 18.4761 Constraint 330 506 9.7563 12.1954 18.2932 17.7943 Constraint 290 493 12.5821 15.7276 23.5914 17.7356 Constraint 315 493 13.1478 16.4347 24.6521 17.7058 Constraint 152 506 14.6628 18.3285 27.4927 17.6864 Constraint 144 506 11.9664 14.9580 22.4370 17.6864 Constraint 136 506 11.7159 14.6448 21.9673 17.6864 Constraint 131 506 13.7901 17.2377 25.8565 17.6864 Constraint 120 506 9.8548 12.3184 18.4777 17.6864 Constraint 115 506 11.8554 14.8193 22.2289 17.6864 Constraint 109 506 13.9497 17.4371 26.1556 17.6864 Constraint 101 506 12.0742 15.0927 22.6391 17.6864 Constraint 189 296 12.5153 15.6442 23.4663 17.6788 Constraint 207 290 13.5580 16.9474 25.4212 17.6249 Constraint 73 493 11.8655 14.8319 22.2479 17.6011 Constraint 73 323 12.6917 15.8647 23.7970 17.5837 Constraint 169 308 13.4907 16.8634 25.2951 17.5415 Constraint 169 290 14.5176 18.1470 27.2205 17.4721 Constraint 359 516 13.4601 16.8252 25.2378 16.7851 Constraint 290 501 12.4810 15.6012 23.4018 16.7607 Constraint 177 506 12.0785 15.0981 22.6471 16.7358 Constraint 81 214 12.3114 15.3892 23.0838 16.6882 Constraint 81 222 12.8760 16.0950 24.1426 16.6450 Constraint 73 501 12.2403 15.3004 22.9506 16.6042 Constraint 73 476 12.8917 16.1146 24.1719 16.5978 Constraint 73 469 13.6395 17.0494 25.5741 16.5978 Constraint 81 255 12.3327 15.4159 23.1239 16.5960 Constraint 164 296 14.5510 18.1888 27.2832 16.5709 Constraint 81 393 18.4436 23.0546 34.5818 16.5316 Constraint 73 189 13.3678 16.7097 25.0646 16.5244 Constraint 277 501 13.6244 17.0305 25.5457 15.8594 Constraint 261 501 14.1085 17.6356 26.4534 15.8547 Constraint 214 506 13.9067 17.3833 26.0750 15.8282 Constraint 341 516 10.8569 13.5711 20.3567 15.7967 Constraint 222 506 14.7801 18.4751 27.7127 15.7850 Constraint 81 230 14.9389 18.6736 28.0105 15.7778 Constraint 93 315 12.1349 15.1686 22.7530 15.6704 Constraint 81 247 11.5852 14.4815 21.7223 15.6465 Constraint 93 308 11.0494 13.8118 20.7176 15.6450 Constraint 81 199 14.3501 17.9376 26.9064 15.6414 Constraint 81 277 12.3805 15.4756 23.2134 15.6340 Constraint 81 261 11.4453 14.3066 21.4599 15.6293 Constraint 86 308 13.6055 17.0069 25.5104 15.6146 Constraint 65 164 18.5257 23.1571 34.7357 15.5953 Constraint 65 152 16.5986 20.7482 31.1223 15.5953 Constraint 65 144 14.5245 18.1556 27.2334 15.5953 Constraint 65 136 13.3594 16.6993 25.0489 15.5953 Constraint 65 131 13.2018 16.5023 24.7534 15.5953 Constraint 81 290 13.0221 16.2776 24.4164 15.5858 Constraint 330 516 10.6034 13.2543 19.8814 14.8438 Constraint 315 501 12.7000 15.8750 23.8125 14.8036 Constraint 152 516 17.9608 22.4510 33.6765 14.7360 Constraint 144 516 14.9138 18.6423 27.9634 14.7360 Constraint 136 516 14.4272 18.0340 27.0510 14.7360 Constraint 131 516 16.8422 21.0527 31.5791 14.7360 Constraint 120 516 12.4646 15.5807 23.3710 14.7360 Constraint 109 516 16.7856 20.9821 31.4731 14.7360 Constraint 101 516 14.5550 18.1937 27.2905 14.7360 Constraint 73 214 12.8781 16.0976 24.1464 14.7134 Constraint 169 506 15.0136 18.7670 28.1505 14.6959 Constraint 164 506 13.6420 17.0525 25.5787 14.6959 Constraint 73 222 12.8991 16.1238 24.1857 14.6703 Constraint 86 315 14.1611 17.7014 26.5522 14.6651 Constraint 73 277 12.1801 15.2251 22.8376 14.6564 Constraint 73 261 11.4594 14.3242 21.4864 14.6516 Constraint 81 269 12.6005 15.7506 23.6259 14.6362 Constraint 86 296 13.7816 17.2270 25.8405 14.6236 Constraint 73 255 12.9491 16.1864 24.2795 14.6212 Constraint 65 442 15.7403 19.6754 29.5130 14.6164 Constraint 65 431 15.0669 18.8336 28.2504 14.6164 Constraint 65 426 13.4347 16.7933 25.1900 14.6164 Constraint 65 417 17.6923 22.1153 33.1730 14.6164 Constraint 65 409 16.2543 20.3179 30.4768 14.6164 Constraint 65 384 17.9678 22.4597 33.6896 14.6164 Constraint 65 374 16.6987 20.8734 31.3101 14.6164 Constraint 65 367 14.0281 17.5351 26.3027 14.6164 Constraint 65 359 14.0958 17.6197 26.4296 14.6164 Constraint 65 330 11.3701 14.2127 21.3190 14.6164 Constraint 65 169 19.8821 24.8527 37.2790 14.6164 Constraint 169 296 13.7391 17.1739 25.7609 14.6096 Constraint 65 352 12.8902 16.1127 24.1691 14.6069 Constraint 73 384 16.8075 21.0094 31.5141 14.5878 Constraint 164 290 12.2079 15.2599 22.8899 14.5699 Constraint 230 506 15.5065 19.3831 29.0746 13.9199 Constraint 189 506 11.7639 14.7049 22.0574 13.7862 Constraint 177 516 14.8253 18.5317 27.7975 13.7854 Constraint 81 239 13.2522 16.5652 24.8479 13.7799 Constraint 81 207 12.2831 15.3539 23.0308 13.7373 Constraint 93 506 11.1610 13.9512 20.9268 13.7041 Constraint 81 315 12.9847 16.2308 24.3462 13.6875 Constraint 81 308 12.4818 15.6023 23.4035 13.6875 Constraint 73 247 12.1916 15.2395 22.8592 13.6718 Constraint 73 199 14.7250 18.4062 27.6094 13.6667 Constraint 73 269 12.4237 15.5296 23.2944 13.6585 Constraint 73 290 12.0528 15.0661 22.5991 13.6575 Constraint 65 461 12.0941 15.1176 22.6764 13.6500 Constraint 65 453 12.7101 15.8877 23.8315 13.6500 Constraint 65 401 15.8232 19.7790 29.6685 13.6280 Constraint 65 341 12.0092 15.0114 22.5172 13.6280 Constraint 65 177 16.7834 20.9792 31.4689 13.5996 Constraint 81 384 17.3259 21.6573 32.4860 13.5420 Constraint 308 501 10.9639 13.7049 20.5574 12.9677 Constraint 296 501 12.4564 15.5705 23.3558 12.9232 Constraint 296 493 11.9689 14.9611 22.4416 12.9232 Constraint 323 506 9.1325 11.4156 17.1234 12.8918 Constraint 214 516 15.6254 19.5317 29.2976 12.8777 Constraint 199 506 12.9355 16.1694 24.2540 12.8556 Constraint 222 516 15.7003 19.6253 29.4380 12.8345 Constraint 73 230 14.8087 18.5109 27.7663 12.8052 Constraint 169 516 17.4168 21.7710 32.6565 12.7423 Constraint 164 516 16.1403 20.1754 30.2631 12.7423 Constraint 115 516 12.9496 16.1870 24.2806 12.7423 Constraint 81 296 12.0566 15.0707 22.6060 12.7232 Constraint 73 315 12.3300 15.4125 23.1188 12.7098 Constraint 65 484 12.0581 15.0726 22.6089 12.6750 Constraint 58 442 13.8570 17.3213 25.9820 12.6606 Constraint 58 431 13.5000 16.8750 25.3125 12.6606 Constraint 58 426 11.6804 14.6005 21.9007 12.6606 Constraint 58 417 16.0041 20.0051 30.0077 12.6606 Constraint 58 409 14.8434 18.5542 27.8313 12.6606 Constraint 58 401 14.2638 17.8298 26.7447 12.6606 Constraint 58 393 17.4209 21.7761 32.6642 12.6606 Constraint 58 384 16.8873 21.1091 31.6637 12.6606 Constraint 58 374 14.9706 18.7132 28.0698 12.6606 Constraint 58 367 12.7253 15.9067 23.8600 12.6606 Constraint 58 359 12.1285 15.1607 22.7410 12.6606 Constraint 58 352 10.4324 13.0405 19.5607 12.6606 Constraint 58 341 10.1628 12.7036 19.0553 12.6606 Constraint 58 330 9.1097 11.3872 17.0807 12.6606 Constraint 58 169 17.0494 21.3118 31.9676 12.6606 Constraint 58 164 15.6223 19.5279 29.2919 12.6606 Constraint 58 152 13.6880 17.1100 25.6650 12.6606 Constraint 58 144 11.4692 14.3364 21.5047 12.6606 Constraint 58 136 10.9178 13.6472 20.4708 12.6606 Constraint 58 131 10.9654 13.7068 20.5602 12.6606 Constraint 58 120 7.2032 9.0041 13.5061 12.6606 Constraint 442 525 13.1408 16.4260 24.6390 11.9991 Constraint 431 525 10.1090 12.6362 18.9543 11.9991 Constraint 426 525 11.1962 13.9953 20.9930 11.9991 Constraint 417 525 13.5146 16.8933 25.3399 11.9991 Constraint 409 525 11.8051 14.7563 22.1345 11.9991 Constraint 239 506 14.9825 18.7281 28.0922 11.9231 Constraint 230 516 16.2277 20.2846 30.4269 11.9231 Constraint 207 506 14.3086 17.8858 26.8286 11.9009 Constraint 269 506 13.5595 16.9494 25.4241 11.8923 Constraint 73 239 13.4215 16.7768 25.1652 11.8052 Constraint 247 506 13.1218 16.4023 24.6034 11.7962 Constraint 73 207 12.4531 15.5663 23.3495 11.7625 Constraint 73 308 10.6346 13.2933 19.9399 11.7310 Constraint 65 501 10.0466 12.5583 18.8374 11.7256 Constraint 65 493 10.4686 13.0858 19.6286 11.7256 Constraint 65 323 11.4166 14.2707 21.4061 11.7198 Constraint 65 393 17.9691 22.4613 33.6920 11.7187 Constraint 65 476 13.7960 17.2449 25.8674 11.7076 Constraint 65 469 13.5223 16.9029 25.3543 11.7076 Constraint 86 506 13.6682 17.0853 25.6279 11.7072 Constraint 81 506 14.5099 18.1373 27.2060 11.7072 Constraint 58 461 10.5041 13.1301 19.6952 11.6942 Constraint 58 453 10.4818 13.1023 19.6534 11.6942 Constraint 47 442 12.4346 15.5433 23.3149 11.6932 Constraint 47 431 11.4725 14.3406 21.5109 11.6932 Constraint 47 426 10.6192 13.2740 19.9111 11.6932 Constraint 47 417 14.4976 18.1219 27.1829 11.6932 Constraint 47 409 13.3084 16.6355 24.9532 11.6932 Constraint 47 401 13.6607 17.0759 25.6138 11.6932 Constraint 47 393 16.5454 20.6818 31.0227 11.6932 Constraint 47 374 14.6877 18.3596 27.5394 11.6932 Constraint 47 367 12.4612 15.5765 23.3648 11.6932 Constraint 47 359 11.7596 14.6995 22.0493 11.6932 Constraint 47 352 10.4084 13.0104 19.5157 11.6932 Constraint 47 341 9.7998 12.2497 18.3745 11.6932 Constraint 47 330 9.5787 11.9734 17.9601 11.6932 Constraint 47 164 16.6598 20.8247 31.2371 11.6932 Constraint 47 152 15.9372 19.9215 29.8823 11.6932 Constraint 47 144 13.1774 16.4718 24.7077 11.6932 Constraint 47 136 12.3615 15.4518 23.1777 11.6932 Constraint 47 131 13.3524 16.6904 25.0357 11.6932 Constraint 47 120 8.9932 11.2416 16.8623 11.6932 Constraint 47 115 10.0032 12.5040 18.7560 11.6932 Constraint 58 177 14.1436 17.6795 26.5192 11.6628 Constraint 73 393 15.4854 19.3567 29.0351 11.5943 Constraint 461 525 8.8108 11.0135 16.5202 11.0215 Constraint 453 525 12.1540 15.1925 22.7887 11.0215 Constraint 401 525 14.6782 18.3478 27.5216 11.0215 Constraint 384 525 15.2716 19.0895 28.6343 11.0215 Constraint 239 516 15.4521 19.3151 28.9726 10.9231 Constraint 277 506 13.3315 16.6644 24.9967 10.9039 Constraint 255 506 13.5122 16.8902 25.3354 10.9009 Constraint 261 506 13.4804 16.8505 25.2758 10.9004 Constraint 269 516 14.4332 18.0415 27.0623 10.8954 Constraint 323 516 9.1402 11.4253 17.1379 10.8950 Constraint 290 506 12.2724 15.3405 23.0107 10.8545 Constraint 189 516 14.2745 17.8431 26.7647 10.8358 Constraint 247 516 14.0259 17.5324 26.2986 10.7962 Constraint 73 296 10.7798 13.4747 20.2121 10.7950 Constraint 65 261 11.5839 14.4799 21.7199 10.7751 Constraint 93 516 11.5783 14.4729 21.7094 10.7568 Constraint 58 323 9.6515 12.0644 18.0965 10.7524 Constraint 65 255 13.1050 16.3812 24.5718 10.7437 Constraint 65 247 12.3179 15.3974 23.0961 10.7437 Constraint 47 461 8.4862 10.6077 15.9115 10.7268 Constraint 47 453 9.5455 11.9318 17.8978 10.7268 Constraint 47 384 15.2395 19.0494 28.5741 10.7268 Constraint 58 484 10.9412 13.6766 20.5148 10.7192 Constraint 58 476 13.0696 16.3369 24.5054 10.7192 Constraint 58 469 13.2557 16.5697 24.8545 10.7192 Constraint 73 506 13.9953 17.4941 26.2412 10.7101 Constraint 47 177 14.7908 18.4886 27.7328 10.6954 Constraint 65 189 13.8916 17.3645 26.0467 10.6690 Constraint 367 525 13.6501 17.0626 25.5939 10.0438 Constraint 277 516 14.0585 17.5731 26.3597 9.9070 Constraint 199 516 15.2498 19.0623 28.5934 9.9051 Constraint 255 516 14.2502 17.8127 26.7190 9.9040 Constraint 261 516 14.4633 18.0791 27.1186 9.9035 Constraint 290 516 12.1404 15.1755 22.7632 9.8576 Constraint 65 230 15.3128 19.1410 28.7115 9.8328 Constraint 39 442 11.5334 14.4168 21.6251 9.7902 Constraint 39 431 9.5739 11.9674 17.9512 9.7902 Constraint 39 426 8.1459 10.1823 15.2735 9.7902 Constraint 39 409 10.9595 13.6994 20.5491 9.7902 Constraint 39 401 11.4676 14.3344 21.5017 9.7902 Constraint 39 374 12.1399 15.1749 22.7623 9.7902 Constraint 39 367 9.8147 12.2683 18.4025 9.7902 Constraint 39 359 8.9602 11.2002 16.8004 9.7902 Constraint 39 352 7.3951 9.2438 13.8658 9.7902 Constraint 39 341 7.4773 9.3466 14.0200 9.7902 Constraint 39 330 6.9971 8.7464 13.1196 9.7902 Constraint 39 164 12.7188 15.8985 23.8478 9.7902 Constraint 39 152 13.2058 16.5072 24.7609 9.7902 Constraint 39 144 9.9340 12.4176 18.6263 9.7902 Constraint 39 136 8.8742 11.0928 16.6391 9.7902 Constraint 39 131 11.2831 14.1039 21.1558 9.7902 Constraint 39 120 6.6839 8.3549 12.5324 9.7902 Constraint 39 115 8.7168 10.8960 16.3440 9.7902 Constraint 47 169 16.7795 20.9743 31.4615 9.7861 Constraint 47 323 8.8751 11.0939 16.6408 9.7850 Constraint 65 290 11.1407 13.9259 20.8889 9.7786 Constraint 65 277 12.4123 15.5153 23.2730 9.7786 Constraint 65 269 12.1500 15.1875 22.7812 9.7786 Constraint 58 501 9.7154 12.1442 18.2163 9.7698 Constraint 58 493 9.2062 11.5078 17.2617 9.7698 Constraint 86 516 14.9778 18.7222 28.0833 9.7568 Constraint 81 516 16.3166 20.3958 30.5936 9.7568 Constraint 65 214 12.4730 15.5913 23.3869 9.7548 Constraint 47 484 10.1564 12.6955 19.0433 9.7518 Constraint 47 476 11.4732 14.3415 21.5123 9.7518 Constraint 47 469 10.4660 13.0824 19.6237 9.7518 Constraint 393 525 15.1572 18.9465 28.4198 9.0273 Constraint 374 525 14.3281 17.9101 26.8651 9.0273 Constraint 308 506 10.3850 12.9812 19.4718 8.9884 Constraint 207 516 16.6572 20.8214 31.2322 8.9505 Constraint 39 169 12.3215 15.4019 23.1028 8.8366 Constraint 39 323 8.6074 10.7593 16.1389 8.8355 Constraint 65 239 12.6320 15.7900 23.6849 8.8349 Constraint 39 461 6.1157 7.6446 11.4669 8.8237 Constraint 39 453 8.0099 10.0124 15.0186 8.8237 Constraint 39 417 11.8270 14.7838 22.1757 8.8237 Constraint 39 393 13.4235 16.7794 25.1691 8.8237 Constraint 39 384 12.3549 15.4436 23.1655 8.8237 Constraint 39 109 10.8738 13.5922 20.3883 8.8237 Constraint 65 296 10.8420 13.5525 20.3288 8.8226 Constraint 47 501 6.2933 7.8666 11.7999 8.8024 Constraint 47 493 7.8088 9.7610 14.6415 8.8024 Constraint 39 177 10.5626 13.2033 19.8049 8.7923 Constraint 65 315 12.0255 15.0319 22.5479 8.7702 Constraint 65 308 11.0619 13.8274 20.7411 8.7702 Constraint 73 516 14.8973 18.6216 27.9324 8.7597 Constraint 65 222 11.2448 14.0560 21.0840 8.7570 Constraint 65 199 14.7681 18.4601 27.6902 8.7564 Constraint 58 189 11.0978 13.8722 20.8084 8.7132 Constraint 359 525 14.2496 17.8120 26.7179 7.9948 Constraint 352 525 11.9190 14.8988 22.3482 7.9948 Constraint 341 525 12.8839 16.1049 24.1574 7.9948 Constraint 296 506 12.2578 15.3222 22.9834 7.9932 Constraint 315 506 9.0972 11.3715 17.0573 7.9922 Constraint 308 516 11.2439 14.0549 21.0823 7.9915 Constraint 101 525 16.9594 21.1992 31.7988 7.9010 Constraint 39 501 7.1403 8.9254 13.3880 7.8488 Constraint 39 493 6.4646 8.0807 12.1211 7.8488 Constraint 39 484 9.2216 11.5269 17.2904 7.8488 Constraint 39 476 11.0698 13.8373 20.7559 7.8488 Constraint 39 469 9.5469 11.9336 17.9005 7.8488 Constraint 58 261 8.2170 10.2712 15.4069 7.8404 Constraint 58 255 9.5294 11.9117 17.8676 7.8090 Constraint 58 247 8.6148 10.7685 16.1527 7.8090 Constraint 58 214 9.4684 11.8355 17.7533 7.8085 Constraint 58 315 10.4040 13.0050 19.5074 7.8028 Constraint 58 308 10.6362 13.2953 19.9429 7.8028 Constraint 47 189 12.1939 15.2423 22.8635 7.7458 Constraint 330 525 12.2125 15.2656 22.8983 7.0419 Constraint 296 516 12.2862 15.3578 23.0367 6.9964 Constraint 315 516 9.2382 11.5477 17.3216 6.9953 Constraint 230 525 15.1388 18.9235 28.3852 6.9463 Constraint 222 525 15.6283 19.5354 29.3031 6.9463 Constraint 214 525 15.6633 19.5791 29.3686 6.9463 Constraint 207 525 17.3042 21.6302 32.4453 6.9463 Constraint 199 525 15.4050 19.2562 28.8843 6.9233 Constraint 189 525 16.2607 20.3258 30.4888 6.9233 Constraint 93 525 16.8586 21.0732 31.6098 6.9039 Constraint 58 230 11.8261 14.7827 22.1740 6.8981 Constraint 47 261 10.7019 13.3774 20.0661 6.8730 Constraint 39 261 9.1534 11.4417 17.1625 6.8730 Constraint 58 290 6.7290 8.4112 12.6168 6.8439 Constraint 58 277 8.6347 10.7933 16.1900 6.8439 Constraint 58 269 8.6034 10.7543 16.1314 6.8439 Constraint 47 255 12.2695 15.3369 23.0053 6.8416 Constraint 47 247 11.0027 13.7533 20.6300 6.8416 Constraint 39 255 11.5017 14.3772 21.5658 6.8416 Constraint 39 247 9.8427 12.3034 18.4551 6.8416 Constraint 47 214 11.0802 13.8502 20.7754 6.8411 Constraint 47 315 11.7745 14.7182 22.0772 6.8354 Constraint 47 308 11.6254 14.5317 21.7976 6.8354 Constraint 65 207 11.7729 14.7162 22.0743 6.8229 Constraint 58 222 8.9776 11.2219 16.8329 6.8107 Constraint 58 199 10.6977 13.3722 20.0582 6.8101 Constraint 65 506 12.4907 15.6134 23.4200 6.8080 Constraint 58 506 11.9651 14.9563 22.4345 6.8080 Constraint 47 506 9.4718 11.8397 17.7596 6.8080 Constraint 277 525 12.1185 15.1481 22.7221 6.0030 Constraint 269 525 12.0435 15.0544 22.5816 6.0030 Constraint 255 525 11.6417 14.5521 21.8282 6.0003 Constraint 239 525 13.6461 17.0576 25.5864 5.9463 Constraint 177 525 15.3397 19.1746 28.7619 5.9457 Constraint 152 525 18.4958 23.1198 34.6796 5.9457 Constraint 144 525 15.4711 19.3389 29.0083 5.9457 Constraint 136 525 15.1841 18.9801 28.4701 5.9457 Constraint 131 525 17.4271 21.7838 32.6757 5.9457 Constraint 120 525 13.1717 16.4646 24.6968 5.9457 Constraint 115 525 15.0222 18.7778 28.1667 5.9457 Constraint 109 525 17.2126 21.5157 32.2736 5.9457 Constraint 47 230 13.3883 16.7354 25.1031 5.9307 Constraint 39 230 12.5584 15.6980 23.5470 5.9307 Constraint 247 525 13.3906 16.7383 25.1075 5.9041 Constraint 58 239 9.6242 12.0302 18.0453 5.9003 Constraint 58 296 7.4861 9.3577 14.0365 5.8879 Constraint 39 214 8.5177 10.6471 15.9706 5.8875 Constraint 39 315 10.9283 13.6604 20.4906 5.8859 Constraint 39 308 12.4438 15.5547 23.3320 5.8859 Constraint 47 290 8.3161 10.3952 15.5927 5.8765 Constraint 47 277 11.2260 14.0325 21.0487 5.8765 Constraint 47 269 11.7463 14.6829 22.0244 5.8765 Constraint 39 290 8.7900 10.9875 16.4812 5.8765 Constraint 39 277 10.8844 13.6055 20.4083 5.8765 Constraint 39 269 10.4922 13.1153 19.6730 5.8765 Constraint 58 207 9.4547 11.8184 17.7276 5.8555 Constraint 65 516 12.5964 15.7455 23.6183 5.8544 Constraint 58 516 12.5233 15.6541 23.4812 5.8544 Constraint 47 516 8.9601 11.2002 16.8002 5.8544 Constraint 39 516 9.7201 12.1501 18.2251 5.8544 Constraint 39 506 7.5456 9.4320 14.1480 5.8544 Constraint 47 222 10.8494 13.5618 20.3427 5.8433 Constraint 47 199 11.6272 14.5340 21.8010 5.8427 Constraint 39 189 9.5167 11.8959 17.8438 5.8427 Constraint 308 525 9.5205 11.9007 17.8510 5.0445 Constraint 290 525 11.1502 13.9377 20.9065 5.0030 Constraint 261 525 11.1955 13.9944 20.9917 5.0030 Constraint 164 525 16.8850 21.1063 31.6594 4.9489 Constraint 47 239 11.1662 13.9578 20.9367 4.9329 Constraint 39 239 11.7483 14.6854 22.0280 4.9329 Constraint 47 296 9.1131 11.3914 17.0871 4.9205 Constraint 39 296 10.6929 13.3662 20.0493 4.9205 Constraint 442 533 16.3418 20.4272 30.6409 4.9099 Constraint 431 533 12.6475 15.8094 23.7141 4.9099 Constraint 426 533 13.2867 16.6084 24.9126 4.9099 Constraint 417 533 14.6118 18.2647 27.3971 4.9099 Constraint 409 533 11.9698 14.9623 22.4435 4.9099 Constraint 101 533 19.6701 24.5876 36.8814 4.9099 Constraint 93 533 18.3543 22.9429 34.4143 4.9099 Constraint 39 222 10.2147 12.7684 19.1526 4.8897 Constraint 39 199 8.4183 10.5229 15.7843 4.8891 Constraint 47 207 11.1314 13.9143 20.8714 4.8881 Constraint 315 525 8.0794 10.0993 15.1489 4.0483 Constraint 296 525 9.7067 12.1334 18.2000 4.0483 Constraint 323 525 10.7694 13.4618 20.1926 4.0477 Constraint 230 533 15.0817 18.8522 28.2783 3.9553 Constraint 222 533 17.3327 21.6658 32.4987 3.9553 Constraint 214 533 17.4147 21.7684 32.6526 3.9553 Constraint 207 533 18.8151 23.5188 35.2783 3.9553 Constraint 39 207 8.3449 10.4312 15.6467 3.9345 Constraint 469 533 13.7084 17.1355 25.7032 3.9323 Constraint 461 533 12.9499 16.1874 24.2811 3.9323 Constraint 453 533 15.9606 19.9507 29.9261 3.9323 Constraint 401 533 15.0441 18.8051 28.2076 3.9323 Constraint 393 533 16.2134 20.2668 30.4002 3.9323 Constraint 384 533 13.6830 17.1037 25.6556 3.9323 Constraint 374 533 14.2329 17.7912 26.6868 3.9323 Constraint 199 533 16.4846 20.6058 30.9086 3.9323 Constraint 189 533 17.7896 22.2371 33.3556 3.9323 Constraint 81 525 18.3283 22.9103 34.3655 3.9294 Constraint 277 533 14.4194 18.0243 27.0364 3.9099 Constraint 269 533 13.8159 17.2699 25.9049 3.9099 Constraint 247 533 12.2135 15.2669 22.9004 3.9099 Constraint 86 533 21.0610 26.3263 39.4894 3.9099 Constraint 31 461 9.3257 11.6571 17.4857 2.9699 Constraint 31 453 10.8239 13.5299 20.2949 2.9699 Constraint 31 442 12.6873 15.8591 23.7887 2.9699 Constraint 31 431 10.3893 12.9866 19.4799 2.9699 Constraint 31 426 9.5575 11.9469 17.9203 2.9699 Constraint 31 417 13.3301 16.6627 24.9940 2.9699 Constraint 31 409 10.8295 13.5369 20.3054 2.9699 Constraint 31 401 12.1298 15.1623 22.7434 2.9699 Constraint 31 393 13.5107 16.8884 25.3326 2.9699 Constraint 31 384 10.8247 13.5308 20.2962 2.9699 Constraint 31 374 11.1834 13.9792 20.9688 2.9699 Constraint 31 367 9.3671 11.7088 17.5632 2.9699 Constraint 31 359 7.1264 8.9080 13.3620 2.9699 Constraint 31 352 7.2156 9.0195 13.5293 2.9699 Constraint 31 341 5.9973 7.4966 11.2449 2.9699 Constraint 31 330 8.0618 10.0772 15.1158 2.9699 Constraint 31 323 6.9190 8.6488 12.9732 2.9699 Constraint 31 230 13.4688 16.8360 25.2540 2.9699 Constraint 31 169 14.3013 17.8766 26.8150 2.9699 Constraint 31 164 14.0678 17.5848 26.3772 2.9699 Constraint 31 152 13.5331 16.9164 25.3746 2.9699 Constraint 31 144 10.1809 12.7261 19.0892 2.9699 Constraint 31 136 10.4243 13.0304 19.5456 2.9699 Constraint 31 131 12.8413 16.0516 24.0775 2.9699 Constraint 31 120 8.1754 10.2193 15.3289 2.9699 Constraint 31 115 10.7836 13.4795 20.2192 2.9699 Constraint 31 109 12.5790 15.7238 23.5857 2.9699 Constraint 31 101 9.9357 12.4197 18.6295 2.9699 Constraint 239 533 13.4292 16.7865 25.1798 2.9553 Constraint 367 533 12.3836 15.4795 23.2192 2.9547 Constraint 359 533 13.1426 16.4282 24.6424 2.9547 Constraint 352 533 11.9454 14.9317 22.3976 2.9547 Constraint 341 533 12.0213 15.0266 22.5399 2.9547 Constraint 330 533 14.5890 18.2363 27.3544 2.9547 Constraint 177 533 16.1971 20.2463 30.3695 2.9547 Constraint 169 533 20.0347 25.0434 37.5651 2.9547 Constraint 169 525 15.9414 19.9268 29.8902 2.9547 Constraint 164 533 19.1341 23.9176 35.8764 2.9547 Constraint 152 533 21.3614 26.7018 40.0527 2.9547 Constraint 144 533 17.6275 22.0344 33.0516 2.9547 Constraint 136 533 17.3806 21.7258 32.5887 2.9547 Constraint 131 533 20.3335 25.4169 38.1253 2.9547 Constraint 120 533 15.3174 19.1468 28.7201 2.9547 Constraint 115 533 17.9866 22.4833 33.7249 2.9547 Constraint 109 533 20.9847 26.2309 39.3463 2.9547 Constraint 86 525 15.6911 19.6139 29.4208 2.9518 Constraint 81 533 21.0055 26.2569 39.3853 2.9323 Constraint 290 533 12.2050 15.2562 22.8843 2.9099 Constraint 261 533 12.1113 15.1391 22.7087 2.9099 Constraint 255 533 12.2375 15.2969 22.9453 2.9099 Constraint 476 544 17.6423 22.0528 33.0792 2.0000 Constraint 469 544 13.9216 17.4020 26.1029 2.0000 Constraint 461 544 13.0436 16.3046 24.4568 2.0000 Constraint 453 544 15.7551 19.6939 29.5409 2.0000 Constraint 442 544 14.6622 18.3278 27.4916 2.0000 Constraint 431 544 10.4800 13.1000 19.6500 2.0000 Constraint 426 544 11.8644 14.8305 22.2458 2.0000 Constraint 417 544 12.0498 15.0622 22.5933 2.0000 Constraint 409 544 9.2424 11.5530 17.3295 2.0000 Constraint 401 544 13.5112 16.8890 25.3336 2.0000 Constraint 393 544 13.8469 17.3086 25.9629 2.0000 Constraint 384 544 10.1535 12.6918 19.0378 2.0000 Constraint 374 544 13.6923 17.1154 25.6731 2.0000 Constraint 367 544 11.9948 14.9934 22.4902 2.0000 Constraint 359 544 11.5768 14.4710 21.7065 2.0000 Constraint 352 544 11.9463 14.9329 22.3994 2.0000 Constraint 341 544 11.5243 14.4054 21.6082 2.0000 Constraint 330 544 14.7724 18.4655 27.6983 2.0000 Constraint 230 544 15.7300 19.6625 29.4937 2.0000 Constraint 222 544 17.8778 22.3472 33.5208 2.0000 Constraint 214 544 14.9431 18.6789 28.0183 2.0000 Constraint 207 544 16.1612 20.2014 30.3022 2.0000 Constraint 199 544 14.8068 18.5085 27.7627 2.0000 Constraint 189 544 16.0483 20.0603 30.0905 2.0000 Constraint 177 544 16.0034 20.0043 30.0064 2.0000 Constraint 169 544 20.2237 25.2796 37.9195 2.0000 Constraint 164 544 19.2803 24.1003 36.1505 2.0000 Constraint 152 544 19.6774 24.5968 36.8952 2.0000 Constraint 144 544 15.9263 19.9078 29.8617 2.0000 Constraint 136 544 17.6706 22.0883 33.1324 2.0000 Constraint 131 544 20.1722 25.2153 37.8229 2.0000 Constraint 120 544 15.0177 18.7721 28.1582 2.0000 Constraint 115 544 18.5195 23.1493 34.7240 2.0000 Constraint 109 544 20.7726 25.9658 38.9487 2.0000 Constraint 101 544 17.8402 22.3002 33.4503 2.0000 Constraint 93 544 17.8778 22.3473 33.5209 2.0000 Constraint 484 550 17.4211 21.7764 32.6646 1.9971 Constraint 476 550 18.7389 23.4236 35.1354 1.9971 Constraint 469 550 15.7597 19.6997 29.5495 1.9971 Constraint 461 550 15.2464 19.0580 28.5871 1.9971 Constraint 453 550 18.4623 23.0779 34.6168 1.9971 Constraint 442 550 18.3294 22.9117 34.3676 1.9971 Constraint 431 550 15.2367 19.0458 28.5687 1.9971 Constraint 426 550 16.9024 21.1280 31.6920 1.9971 Constraint 417 550 18.1308 22.6635 33.9952 1.9971 Constraint 409 550 16.4191 20.5238 30.7857 1.9971 Constraint 401 550 19.5843 24.4804 36.7206 1.9971 Constraint 384 550 18.2573 22.8216 34.2324 1.9971 Constraint 367 550 17.7484 22.1855 33.2783 1.9971 Constraint 359 550 16.9445 21.1807 31.7710 1.9971 Constraint 352 550 15.4776 19.3470 29.0204 1.9971 Constraint 341 550 15.1263 18.9079 28.3619 1.9971 Constraint 330 550 16.0728 20.0911 30.1366 1.9971 Constraint 323 550 15.0007 18.7508 28.1262 1.9971 Constraint 239 550 18.2051 22.7563 34.1345 1.9971 Constraint 230 550 18.7101 23.3876 35.0814 1.9971 Constraint 222 550 18.7734 23.4667 35.2001 1.9971 Constraint 214 550 17.8206 22.2758 33.4137 1.9971 Constraint 177 550 20.4161 25.5202 38.2803 1.9971 Constraint 144 550 18.8499 23.5623 35.3435 1.9971 Constraint 136 550 18.6891 23.3614 35.0420 1.9971 Constraint 120 550 15.9676 19.9595 29.9392 1.9971 Constraint 115 550 17.5111 21.8888 32.8333 1.9971 Constraint 101 550 17.3952 21.7440 32.6161 1.9971 Constraint 93 550 15.4310 19.2888 28.9332 1.9971 Constraint 31 501 8.8793 11.0991 16.6486 1.9950 Constraint 31 493 10.3583 12.9479 19.4218 1.9950 Constraint 31 484 13.7377 17.1722 25.7583 1.9950 Constraint 31 476 15.0724 18.8405 28.2607 1.9950 Constraint 31 469 12.3437 15.4296 23.1445 1.9950 Constraint 31 315 9.3472 11.6840 17.5260 1.9728 Constraint 31 308 10.0485 12.5606 18.8409 1.9728 Constraint 31 296 12.3113 15.3892 23.0837 1.9728 Constraint 31 290 12.1846 15.2307 22.8461 1.9728 Constraint 31 277 9.6103 12.0129 18.0193 1.9728 Constraint 31 269 8.3114 10.3893 15.5839 1.9728 Constraint 31 261 9.9685 12.4606 18.6909 1.9728 Constraint 31 239 12.1729 15.2162 22.8243 1.9720 Constraint 31 222 8.1044 10.1305 15.1958 1.9720 Constraint 31 214 8.7541 10.9427 16.4140 1.9720 Constraint 31 177 9.4495 11.8119 17.7178 1.9720 Constraint 315 533 8.8267 11.0333 16.5500 1.9553 Constraint 308 533 5.5618 6.9523 10.4284 1.9553 Constraint 296 533 10.4138 13.0173 19.5259 1.9553 Constraint 323 533 12.8697 16.0872 24.1308 1.9547 Constraint 393 550 17.1141 21.3927 32.0890 1.0000 Constraint 374 550 17.3172 21.6465 32.4697 1.0000 Constraint 323 544 14.3125 17.8907 26.8360 1.0000 Constraint 277 544 15.8325 19.7906 29.6859 1.0000 Constraint 269 544 18.9799 23.7249 35.5873 1.0000 Constraint 247 550 18.1832 22.7290 34.0935 1.0000 Constraint 247 544 15.7048 19.6310 29.4464 1.0000 Constraint 239 544 19.1507 23.9384 35.9076 1.0000 Constraint 207 550 20.1109 25.1386 37.7079 1.0000 Constraint 199 550 18.5519 23.1899 34.7848 1.0000 Constraint 189 550 20.3066 25.3832 38.0749 1.0000 Constraint 86 544 21.7013 27.1266 40.6899 1.0000 Constraint 81 544 22.3801 27.9751 41.9626 1.0000 Constraint 164 550 19.4521 24.3151 36.4726 0.9971 Constraint 152 550 20.1751 25.2189 37.8284 0.9971 Constraint 131 550 16.9639 21.2048 31.8073 0.9971 Constraint 109 550 14.5599 18.1999 27.2998 0.9971 Constraint 86 550 11.3221 14.1526 21.2289 0.9971 Constraint 81 550 13.6637 17.0796 25.6195 0.9971 Constraint 73 550 9.4292 11.7865 17.6797 0.9971 Constraint 65 550 10.0243 12.5304 18.7955 0.9971 Constraint 58 550 13.0388 16.2985 24.4478 0.9971 Constraint 47 550 11.5251 14.4064 21.6095 0.9971 Constraint 39 550 14.7323 18.4154 27.6231 0.9971 Constraint 31 550 16.8658 21.0823 31.6234 0.9971 Constraint 31 516 16.5085 20.6356 30.9535 0.9971 Constraint 31 506 14.5938 18.2422 27.3633 0.9971 Constraint 22 550 19.8790 24.8488 37.2732 0.9971 Constraint 22 516 18.6159 23.2699 34.9048 0.9971 Constraint 22 506 16.8271 21.0339 31.5508 0.9971 Constraint 22 501 12.6919 15.8649 23.7974 0.9971 Constraint 22 493 12.8831 16.1038 24.1557 0.9971 Constraint 22 484 15.1685 18.9606 28.4409 0.9971 Constraint 22 476 14.7385 18.4231 27.6347 0.9971 Constraint 22 469 12.5759 15.7199 23.5798 0.9971 Constraint 22 461 10.4398 13.0497 19.5746 0.9971 Constraint 22 453 11.6906 14.6133 21.9199 0.9971 Constraint 22 442 11.2810 14.1012 21.1518 0.9971 Constraint 22 431 7.9114 9.8892 14.8338 0.9971 Constraint 22 426 6.8755 8.5944 12.8916 0.9971 Constraint 22 417 8.2605 10.3256 15.4884 0.9971 Constraint 22 409 4.0255 5.0319 7.5479 0.9971 Constraint 22 401 6.5259 8.1574 12.2361 0.9971 Constraint 22 393 7.1709 8.9637 13.4455 0.9971 Constraint 22 384 3.6126 4.5158 6.7736 0.9971 Constraint 22 374 5.9508 7.4385 11.1577 0.9971 Constraint 22 367 4.7627 5.9534 8.9301 0.9971 Constraint 22 359 4.9299 6.1623 9.2435 0.9971 Constraint 22 352 8.1286 10.1607 15.2411 0.9971 Constraint 22 341 8.9907 11.2383 16.8575 0.9971 Constraint 22 330 12.7277 15.9096 23.8644 0.9971 Constraint 22 323 14.3220 17.9025 26.8537 0.9971 Constraint 22 239 16.8114 21.0142 31.5214 0.9971 Constraint 22 230 16.4495 20.5619 30.8429 0.9971 Constraint 22 222 12.9204 16.1505 24.2258 0.9971 Constraint 22 214 14.5288 18.1610 27.2414 0.9971 Constraint 22 177 9.4260 11.7826 17.6738 0.9971 Constraint 22 169 13.9080 17.3850 26.0775 0.9971 Constraint 22 164 13.6633 17.0791 25.6187 0.9971 Constraint 22 152 13.2570 16.5713 24.8569 0.9971 Constraint 22 144 10.2797 12.8496 19.2744 0.9971 Constraint 22 136 13.7873 17.2341 25.8511 0.9971 Constraint 22 131 15.4920 19.3651 29.0476 0.9971 Constraint 22 120 11.6346 14.5432 21.8148 0.9971 Constraint 22 115 15.8829 19.8537 29.7805 0.9971 Constraint 22 109 15.8687 19.8359 29.7538 0.9971 Constraint 22 101 12.7297 15.9121 23.8682 0.9971 Constraint 22 93 15.1738 18.9673 28.4509 0.9971 Constraint 11 550 22.2018 27.7523 41.6284 0.9971 Constraint 11 516 21.4446 26.8058 40.2087 0.9971 Constraint 11 506 18.9369 23.6711 35.5066 0.9971 Constraint 11 501 15.0896 18.8621 28.2931 0.9971 Constraint 11 493 15.1845 18.9806 28.4709 0.9971 Constraint 11 484 17.4936 21.8670 32.8005 0.9971 Constraint 11 476 17.7074 22.1343 33.2014 0.9971 Constraint 11 469 16.1483 20.1853 30.2780 0.9971 Constraint 11 461 13.1735 16.4669 24.7004 0.9971 Constraint 11 453 14.0231 17.5289 26.2934 0.9971 Constraint 11 442 14.5984 18.2481 27.3721 0.9971 Constraint 11 431 11.7105 14.6381 21.9571 0.9971 Constraint 11 426 9.3446 11.6808 17.5212 0.9971 Constraint 11 417 11.9264 14.9080 22.3621 0.9971 Constraint 11 409 7.8513 9.8141 14.7211 0.9971 Constraint 11 401 7.8896 9.8621 14.7931 0.9971 Constraint 11 393 8.2495 10.3118 15.4677 0.9971 Constraint 11 384 5.2698 6.5872 9.8808 0.9971 Constraint 11 374 5.1853 6.4816 9.7224 0.9971 Constraint 11 367 5.8044 7.2555 10.8833 0.9971 Constraint 11 359 3.9379 4.9223 7.3835 0.9971 Constraint 11 352 8.5100 10.6375 15.9563 0.9971 Constraint 11 341 8.5653 10.7066 16.0600 0.9971 Constraint 11 330 12.1966 15.2457 22.8685 0.9971 Constraint 11 323 14.1950 17.7437 26.6155 0.9971 Constraint 11 239 16.3315 20.4143 30.6215 0.9971 Constraint 11 230 14.9783 18.7229 28.0843 0.9971 Constraint 11 222 11.9287 14.9109 22.3663 0.9971 Constraint 11 214 12.7098 15.8872 23.8308 0.9971 Constraint 11 177 10.3641 12.9552 19.4328 0.9971 Constraint 11 169 14.3385 17.9231 26.8846 0.9971 Constraint 11 164 14.9565 18.6956 28.0434 0.9971 Constraint 11 152 12.7793 15.9741 23.9612 0.9971 Constraint 11 144 11.1190 13.8987 20.8480 0.9971 Constraint 11 136 14.9919 18.7399 28.1098 0.9971 Constraint 11 131 15.4521 19.3152 28.9727 0.9971 Constraint 11 120 12.7799 15.9748 23.9623 0.9971 Constraint 11 115 16.6902 20.8628 31.2942 0.9971 Constraint 11 109 15.5231 19.4038 29.1058 0.9971 Constraint 11 101 12.7090 15.8862 23.8293 0.9971 Constraint 11 93 16.1588 20.1986 30.2978 0.9971 Constraint 11 86 18.6252 23.2815 34.9223 0.9971 Constraint 3 506 22.0649 27.5811 41.3717 0.9971 Constraint 3 501 18.0217 22.5271 33.7906 0.9971 Constraint 3 493 17.9749 22.4686 33.7030 0.9971 Constraint 3 484 19.8313 24.7891 37.1837 0.9971 Constraint 3 476 19.1173 23.8967 35.8450 0.9971 Constraint 3 469 17.4411 21.8014 32.7021 0.9971 Constraint 3 461 15.3903 19.2378 28.8568 0.9971 Constraint 3 453 15.7081 19.6351 29.4526 0.9971 Constraint 3 442 15.1735 18.9668 28.4503 0.9971 Constraint 3 431 12.6625 15.8281 23.7421 0.9971 Constraint 3 426 10.9701 13.7126 20.5689 0.9971 Constraint 3 417 11.2450 14.0563 21.0844 0.9971 Constraint 3 409 7.7865 9.7331 14.5997 0.9971 Constraint 3 401 8.4234 10.5293 15.7939 0.9971 Constraint 3 393 6.4457 8.0571 12.0857 0.9971 Constraint 3 384 3.2998 4.1248 6.1872 0.9971 Constraint 3 374 5.8224 7.2780 10.9170 0.9971 Constraint 3 367 8.0727 10.0909 15.1363 0.9971 Constraint 3 359 8.0888 10.1110 15.1665 0.9971 Constraint 3 352 12.3978 15.4972 23.2458 0.9971 Constraint 3 341 12.6844 15.8554 23.7832 0.9971 Constraint 3 330 16.5536 20.6920 31.0381 0.9971 Constraint 3 323 18.2429 22.8036 34.2054 0.9971 Constraint 3 239 20.1766 25.2207 37.8311 0.9971 Constraint 3 230 18.7096 23.3870 35.0805 0.9971 Constraint 3 222 15.8903 19.8628 29.7942 0.9971 Constraint 3 214 17.1810 21.4763 32.2144 0.9971 Constraint 3 177 11.9434 14.9292 22.3938 0.9971 Constraint 3 169 15.6154 19.5193 29.2789 0.9971 Constraint 3 164 16.8026 21.0032 31.5048 0.9971 Constraint 3 152 15.7494 19.6867 29.5301 0.9971 Constraint 3 144 13.8640 17.3300 25.9951 0.9971 Constraint 3 136 17.8759 22.3449 33.5174 0.9971 Constraint 3 131 18.9561 23.6951 35.5427 0.9971 Constraint 3 120 16.2296 20.2870 30.4305 0.9971 Constraint 3 115 20.3138 25.3922 38.0884 0.9971 Constraint 3 109 19.6535 24.5668 36.8503 0.9971 Constraint 3 101 16.8852 21.1064 31.6597 0.9971 Constraint 3 93 19.9579 24.9474 37.4211 0.9971 Constraint 3 86 22.7577 28.4471 42.6706 0.9971 Constraint 3 81 20.8548 26.0686 39.1028 0.9971 Constraint 31 255 13.8934 17.3667 26.0501 0.9749 Constraint 31 247 11.4457 14.3071 21.4606 0.9749 Constraint 31 207 4.2247 5.2809 7.9213 0.9749 Constraint 31 199 5.8302 7.2878 10.9316 0.9749 Constraint 31 189 4.8989 6.1237 9.1855 0.9749 Constraint 73 533 19.0460 23.8075 35.7112 0.9547 Constraint 73 525 17.3765 21.7206 32.5810 0.9547 Constraint 65 533 15.6391 19.5489 29.3234 0.9547 Constraint 65 525 14.0628 17.5785 26.3677 0.9547 Constraint 58 533 14.3964 17.9955 26.9933 0.9547 Constraint 58 525 12.8761 16.0951 24.1427 0.9547 Constraint 47 533 10.0888 12.6110 18.9165 0.9547 Constraint 47 525 9.1485 11.4356 17.1534 0.9547 Constraint 39 533 10.4553 13.0691 19.6036 0.9547 Constraint 39 525 8.5838 10.7298 16.0947 0.9547 Constraint 550 558 0.8000 1.0000 1.5000 0.0000 Constraint 544 558 0.8000 1.0000 1.5000 0.0000 Constraint 544 550 0.8000 1.0000 1.5000 0.0000 Constraint 533 558 0.8000 1.0000 1.5000 0.0000 Constraint 533 550 0.8000 1.0000 1.5000 0.0000 Constraint 533 544 0.8000 1.0000 1.5000 0.0000 Constraint 525 558 0.8000 1.0000 1.5000 0.0000 Constraint 525 550 0.8000 1.0000 1.5000 0.0000 Constraint 525 544 0.8000 1.0000 1.5000 0.0000 Constraint 525 533 0.8000 1.0000 1.5000 0.0000 Constraint 516 558 0.8000 1.0000 1.5000 0.0000 Constraint 516 550 0.8000 1.0000 1.5000 0.0000 Constraint 516 544 0.8000 1.0000 1.5000 0.0000 Constraint 516 533 0.8000 1.0000 1.5000 0.0000 Constraint 516 525 0.8000 1.0000 1.5000 0.0000 Constraint 506 558 0.8000 1.0000 1.5000 0.0000 Constraint 506 550 0.8000 1.0000 1.5000 0.0000 Constraint 506 544 0.8000 1.0000 1.5000 0.0000 Constraint 506 533 0.8000 1.0000 1.5000 0.0000 Constraint 506 525 0.8000 1.0000 1.5000 0.0000 Constraint 506 516 0.8000 1.0000 1.5000 0.0000 Constraint 501 558 0.8000 1.0000 1.5000 0.0000 Constraint 501 550 0.8000 1.0000 1.5000 0.0000 Constraint 501 544 0.8000 1.0000 1.5000 0.0000 Constraint 501 533 0.8000 1.0000 1.5000 0.0000 Constraint 501 525 0.8000 1.0000 1.5000 0.0000 Constraint 501 516 0.8000 1.0000 1.5000 0.0000 Constraint 501 506 0.8000 1.0000 1.5000 0.0000 Constraint 493 558 0.8000 1.0000 1.5000 0.0000 Constraint 493 550 0.8000 1.0000 1.5000 0.0000 Constraint 493 544 0.8000 1.0000 1.5000 0.0000 Constraint 493 533 0.8000 1.0000 1.5000 0.0000 Constraint 493 525 0.8000 1.0000 1.5000 0.0000 Constraint 493 516 0.8000 1.0000 1.5000 0.0000 Constraint 493 506 0.8000 1.0000 1.5000 0.0000 Constraint 493 501 0.8000 1.0000 1.5000 0.0000 Constraint 484 558 0.8000 1.0000 1.5000 0.0000 Constraint 484 544 0.8000 1.0000 1.5000 0.0000 Constraint 484 533 0.8000 1.0000 1.5000 0.0000 Constraint 484 525 0.8000 1.0000 1.5000 0.0000 Constraint 484 516 0.8000 1.0000 1.5000 0.0000 Constraint 484 506 0.8000 1.0000 1.5000 0.0000 Constraint 484 501 0.8000 1.0000 1.5000 0.0000 Constraint 484 493 0.8000 1.0000 1.5000 0.0000 Constraint 476 558 0.8000 1.0000 1.5000 0.0000 Constraint 476 533 0.8000 1.0000 1.5000 0.0000 Constraint 476 525 0.8000 1.0000 1.5000 0.0000 Constraint 476 516 0.8000 1.0000 1.5000 0.0000 Constraint 476 506 0.8000 1.0000 1.5000 0.0000 Constraint 476 501 0.8000 1.0000 1.5000 0.0000 Constraint 476 493 0.8000 1.0000 1.5000 0.0000 Constraint 476 484 0.8000 1.0000 1.5000 0.0000 Constraint 469 558 0.8000 1.0000 1.5000 0.0000 Constraint 469 525 0.8000 1.0000 1.5000 0.0000 Constraint 469 516 0.8000 1.0000 1.5000 0.0000 Constraint 469 506 0.8000 1.0000 1.5000 0.0000 Constraint 469 501 0.8000 1.0000 1.5000 0.0000 Constraint 469 493 0.8000 1.0000 1.5000 0.0000 Constraint 469 484 0.8000 1.0000 1.5000 0.0000 Constraint 469 476 0.8000 1.0000 1.5000 0.0000 Constraint 461 558 0.8000 1.0000 1.5000 0.0000 Constraint 461 516 0.8000 1.0000 1.5000 0.0000 Constraint 461 506 0.8000 1.0000 1.5000 0.0000 Constraint 461 501 0.8000 1.0000 1.5000 0.0000 Constraint 461 493 0.8000 1.0000 1.5000 0.0000 Constraint 461 484 0.8000 1.0000 1.5000 0.0000 Constraint 461 476 0.8000 1.0000 1.5000 0.0000 Constraint 461 469 0.8000 1.0000 1.5000 0.0000 Constraint 453 558 0.8000 1.0000 1.5000 0.0000 Constraint 453 506 0.8000 1.0000 1.5000 0.0000 Constraint 453 501 0.8000 1.0000 1.5000 0.0000 Constraint 453 493 0.8000 1.0000 1.5000 0.0000 Constraint 453 484 0.8000 1.0000 1.5000 0.0000 Constraint 453 476 0.8000 1.0000 1.5000 0.0000 Constraint 453 469 0.8000 1.0000 1.5000 0.0000 Constraint 453 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 558 0.8000 1.0000 1.5000 0.0000 Constraint 442 501 0.8000 1.0000 1.5000 0.0000 Constraint 442 493 0.8000 1.0000 1.5000 0.0000 Constraint 442 484 0.8000 1.0000 1.5000 0.0000 Constraint 442 476 0.8000 1.0000 1.5000 0.0000 Constraint 442 469 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 453 0.8000 1.0000 1.5000 0.0000 Constraint 431 558 0.8000 1.0000 1.5000 0.0000 Constraint 431 493 0.8000 1.0000 1.5000 0.0000 Constraint 431 484 0.8000 1.0000 1.5000 0.0000 Constraint 431 476 0.8000 1.0000 1.5000 0.0000 Constraint 431 469 0.8000 1.0000 1.5000 0.0000 Constraint 431 461 0.8000 1.0000 1.5000 0.0000 Constraint 431 453 0.8000 1.0000 1.5000 0.0000 Constraint 431 442 0.8000 1.0000 1.5000 0.0000 Constraint 426 558 0.8000 1.0000 1.5000 0.0000 Constraint 426 484 0.8000 1.0000 1.5000 0.0000 Constraint 426 476 0.8000 1.0000 1.5000 0.0000 Constraint 426 469 0.8000 1.0000 1.5000 0.0000 Constraint 426 461 0.8000 1.0000 1.5000 0.0000 Constraint 426 453 0.8000 1.0000 1.5000 0.0000 Constraint 426 442 0.8000 1.0000 1.5000 0.0000 Constraint 426 431 0.8000 1.0000 1.5000 0.0000 Constraint 417 558 0.8000 1.0000 1.5000 0.0000 Constraint 417 476 0.8000 1.0000 1.5000 0.0000 Constraint 417 469 0.8000 1.0000 1.5000 0.0000 Constraint 417 461 0.8000 1.0000 1.5000 0.0000 Constraint 417 453 0.8000 1.0000 1.5000 0.0000 Constraint 417 442 0.8000 1.0000 1.5000 0.0000 Constraint 417 431 0.8000 1.0000 1.5000 0.0000 Constraint 417 426 0.8000 1.0000 1.5000 0.0000 Constraint 409 558 0.8000 1.0000 1.5000 0.0000 Constraint 409 469 0.8000 1.0000 1.5000 0.0000 Constraint 409 461 0.8000 1.0000 1.5000 0.0000 Constraint 409 453 0.8000 1.0000 1.5000 0.0000 Constraint 409 442 0.8000 1.0000 1.5000 0.0000 Constraint 409 431 0.8000 1.0000 1.5000 0.0000 Constraint 409 426 0.8000 1.0000 1.5000 0.0000 Constraint 409 417 0.8000 1.0000 1.5000 0.0000 Constraint 401 558 0.8000 1.0000 1.5000 0.0000 Constraint 401 461 0.8000 1.0000 1.5000 0.0000 Constraint 401 453 0.8000 1.0000 1.5000 0.0000 Constraint 401 442 0.8000 1.0000 1.5000 0.0000 Constraint 401 431 0.8000 1.0000 1.5000 0.0000 Constraint 401 426 0.8000 1.0000 1.5000 0.0000 Constraint 401 417 0.8000 1.0000 1.5000 0.0000 Constraint 401 409 0.8000 1.0000 1.5000 0.0000 Constraint 393 558 0.8000 1.0000 1.5000 0.0000 Constraint 393 453 0.8000 1.0000 1.5000 0.0000 Constraint 393 442 0.8000 1.0000 1.5000 0.0000 Constraint 393 431 0.8000 1.0000 1.5000 0.0000 Constraint 393 426 0.8000 1.0000 1.5000 0.0000 Constraint 393 417 0.8000 1.0000 1.5000 0.0000 Constraint 393 409 0.8000 1.0000 1.5000 0.0000 Constraint 393 401 0.8000 1.0000 1.5000 0.0000 Constraint 384 558 0.8000 1.0000 1.5000 0.0000 Constraint 384 442 0.8000 1.0000 1.5000 0.0000 Constraint 384 431 0.8000 1.0000 1.5000 0.0000 Constraint 384 426 0.8000 1.0000 1.5000 0.0000 Constraint 384 417 0.8000 1.0000 1.5000 0.0000 Constraint 384 409 0.8000 1.0000 1.5000 0.0000 Constraint 384 401 0.8000 1.0000 1.5000 0.0000 Constraint 384 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 558 0.8000 1.0000 1.5000 0.0000 Constraint 374 431 0.8000 1.0000 1.5000 0.0000 Constraint 374 426 0.8000 1.0000 1.5000 0.0000 Constraint 374 417 0.8000 1.0000 1.5000 0.0000 Constraint 374 409 0.8000 1.0000 1.5000 0.0000 Constraint 374 401 0.8000 1.0000 1.5000 0.0000 Constraint 374 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 384 0.8000 1.0000 1.5000 0.0000 Constraint 367 558 0.8000 1.0000 1.5000 0.0000 Constraint 367 426 0.8000 1.0000 1.5000 0.0000 Constraint 367 417 0.8000 1.0000 1.5000 0.0000 Constraint 367 409 0.8000 1.0000 1.5000 0.0000 Constraint 367 401 0.8000 1.0000 1.5000 0.0000 Constraint 367 393 0.8000 1.0000 1.5000 0.0000 Constraint 367 384 0.8000 1.0000 1.5000 0.0000 Constraint 367 374 0.8000 1.0000 1.5000 0.0000 Constraint 359 558 0.8000 1.0000 1.5000 0.0000 Constraint 359 417 0.8000 1.0000 1.5000 0.0000 Constraint 359 409 0.8000 1.0000 1.5000 0.0000 Constraint 359 401 0.8000 1.0000 1.5000 0.0000 Constraint 359 393 0.8000 1.0000 1.5000 0.0000 Constraint 359 384 0.8000 1.0000 1.5000 0.0000 Constraint 359 374 0.8000 1.0000 1.5000 0.0000 Constraint 359 367 0.8000 1.0000 1.5000 0.0000 Constraint 352 558 0.8000 1.0000 1.5000 0.0000 Constraint 352 417 0.8000 1.0000 1.5000 0.0000 Constraint 352 409 0.8000 1.0000 1.5000 0.0000 Constraint 352 401 0.8000 1.0000 1.5000 0.0000 Constraint 352 393 0.8000 1.0000 1.5000 0.0000 Constraint 352 384 0.8000 1.0000 1.5000 0.0000 Constraint 352 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 367 0.8000 1.0000 1.5000 0.0000 Constraint 352 359 0.8000 1.0000 1.5000 0.0000 Constraint 341 558 0.8000 1.0000 1.5000 0.0000 Constraint 341 409 0.8000 1.0000 1.5000 0.0000 Constraint 341 401 0.8000 1.0000 1.5000 0.0000 Constraint 341 393 0.8000 1.0000 1.5000 0.0000 Constraint 341 384 0.8000 1.0000 1.5000 0.0000 Constraint 341 374 0.8000 1.0000 1.5000 0.0000 Constraint 341 367 0.8000 1.0000 1.5000 0.0000 Constraint 341 359 0.8000 1.0000 1.5000 0.0000 Constraint 341 352 0.8000 1.0000 1.5000 0.0000 Constraint 330 558 0.8000 1.0000 1.5000 0.0000 Constraint 330 401 0.8000 1.0000 1.5000 0.0000 Constraint 330 393 0.8000 1.0000 1.5000 0.0000 Constraint 330 384 0.8000 1.0000 1.5000 0.0000 Constraint 330 374 0.8000 1.0000 1.5000 0.0000 Constraint 330 367 0.8000 1.0000 1.5000 0.0000 Constraint 330 359 0.8000 1.0000 1.5000 0.0000 Constraint 330 352 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 323 558 0.8000 1.0000 1.5000 0.0000 Constraint 323 393 0.8000 1.0000 1.5000 0.0000 Constraint 323 384 0.8000 1.0000 1.5000 0.0000 Constraint 323 374 0.8000 1.0000 1.5000 0.0000 Constraint 323 367 0.8000 1.0000 1.5000 0.0000 Constraint 323 359 0.8000 1.0000 1.5000 0.0000 Constraint 323 352 0.8000 1.0000 1.5000 0.0000 Constraint 323 341 0.8000 1.0000 1.5000 0.0000 Constraint 323 330 0.8000 1.0000 1.5000 0.0000 Constraint 315 558 0.8000 1.0000 1.5000 0.0000 Constraint 315 550 0.8000 1.0000 1.5000 0.0000 Constraint 315 544 0.8000 1.0000 1.5000 0.0000 Constraint 315 384 0.8000 1.0000 1.5000 0.0000 Constraint 315 374 0.8000 1.0000 1.5000 0.0000 Constraint 315 367 0.8000 1.0000 1.5000 0.0000 Constraint 315 359 0.8000 1.0000 1.5000 0.0000 Constraint 315 352 0.8000 1.0000 1.5000 0.0000 Constraint 315 341 0.8000 1.0000 1.5000 0.0000 Constraint 315 330 0.8000 1.0000 1.5000 0.0000 Constraint 315 323 0.8000 1.0000 1.5000 0.0000 Constraint 308 558 0.8000 1.0000 1.5000 0.0000 Constraint 308 550 0.8000 1.0000 1.5000 0.0000 Constraint 308 544 0.8000 1.0000 1.5000 0.0000 Constraint 308 374 0.8000 1.0000 1.5000 0.0000 Constraint 308 367 0.8000 1.0000 1.5000 0.0000 Constraint 308 359 0.8000 1.0000 1.5000 0.0000 Constraint 308 352 0.8000 1.0000 1.5000 0.0000 Constraint 308 341 0.8000 1.0000 1.5000 0.0000 Constraint 308 330 0.8000 1.0000 1.5000 0.0000 Constraint 308 323 0.8000 1.0000 1.5000 0.0000 Constraint 308 315 0.8000 1.0000 1.5000 0.0000 Constraint 296 558 0.8000 1.0000 1.5000 0.0000 Constraint 296 550 0.8000 1.0000 1.5000 0.0000 Constraint 296 544 0.8000 1.0000 1.5000 0.0000 Constraint 296 359 0.8000 1.0000 1.5000 0.0000 Constraint 296 352 0.8000 1.0000 1.5000 0.0000 Constraint 296 341 0.8000 1.0000 1.5000 0.0000 Constraint 296 330 0.8000 1.0000 1.5000 0.0000 Constraint 296 323 0.8000 1.0000 1.5000 0.0000 Constraint 296 315 0.8000 1.0000 1.5000 0.0000 Constraint 296 308 0.8000 1.0000 1.5000 0.0000 Constraint 290 558 0.8000 1.0000 1.5000 0.0000 Constraint 290 550 0.8000 1.0000 1.5000 0.0000 Constraint 290 544 0.8000 1.0000 1.5000 0.0000 Constraint 290 352 0.8000 1.0000 1.5000 0.0000 Constraint 290 341 0.8000 1.0000 1.5000 0.0000 Constraint 290 330 0.8000 1.0000 1.5000 0.0000 Constraint 290 323 0.8000 1.0000 1.5000 0.0000 Constraint 290 315 0.8000 1.0000 1.5000 0.0000 Constraint 290 308 0.8000 1.0000 1.5000 0.0000 Constraint 290 296 0.8000 1.0000 1.5000 0.0000 Constraint 277 558 0.8000 1.0000 1.5000 0.0000 Constraint 277 550 0.8000 1.0000 1.5000 0.0000 Constraint 277 330 0.8000 1.0000 1.5000 0.0000 Constraint 277 323 0.8000 1.0000 1.5000 0.0000 Constraint 277 315 0.8000 1.0000 1.5000 0.0000 Constraint 277 308 0.8000 1.0000 1.5000 0.0000 Constraint 277 296 0.8000 1.0000 1.5000 0.0000 Constraint 277 290 0.8000 1.0000 1.5000 0.0000 Constraint 269 558 0.8000 1.0000 1.5000 0.0000 Constraint 269 550 0.8000 1.0000 1.5000 0.0000 Constraint 269 323 0.8000 1.0000 1.5000 0.0000 Constraint 269 315 0.8000 1.0000 1.5000 0.0000 Constraint 269 308 0.8000 1.0000 1.5000 0.0000 Constraint 269 296 0.8000 1.0000 1.5000 0.0000 Constraint 269 290 0.8000 1.0000 1.5000 0.0000 Constraint 269 277 0.8000 1.0000 1.5000 0.0000 Constraint 261 558 0.8000 1.0000 1.5000 0.0000 Constraint 261 550 0.8000 1.0000 1.5000 0.0000 Constraint 261 544 0.8000 1.0000 1.5000 0.0000 Constraint 261 315 0.8000 1.0000 1.5000 0.0000 Constraint 261 308 0.8000 1.0000 1.5000 0.0000 Constraint 261 296 0.8000 1.0000 1.5000 0.0000 Constraint 261 290 0.8000 1.0000 1.5000 0.0000 Constraint 261 277 0.8000 1.0000 1.5000 0.0000 Constraint 261 269 0.8000 1.0000 1.5000 0.0000 Constraint 255 558 0.8000 1.0000 1.5000 0.0000 Constraint 255 550 0.8000 1.0000 1.5000 0.0000 Constraint 255 544 0.8000 1.0000 1.5000 0.0000 Constraint 255 308 0.8000 1.0000 1.5000 0.0000 Constraint 255 296 0.8000 1.0000 1.5000 0.0000 Constraint 255 290 0.8000 1.0000 1.5000 0.0000 Constraint 255 277 0.8000 1.0000 1.5000 0.0000 Constraint 255 269 0.8000 1.0000 1.5000 0.0000 Constraint 255 261 0.8000 1.0000 1.5000 0.0000 Constraint 247 558 0.8000 1.0000 1.5000 0.0000 Constraint 247 296 0.8000 1.0000 1.5000 0.0000 Constraint 247 290 0.8000 1.0000 1.5000 0.0000 Constraint 247 277 0.8000 1.0000 1.5000 0.0000 Constraint 247 269 0.8000 1.0000 1.5000 0.0000 Constraint 247 261 0.8000 1.0000 1.5000 0.0000 Constraint 247 255 0.8000 1.0000 1.5000 0.0000 Constraint 239 558 0.8000 1.0000 1.5000 0.0000 Constraint 239 296 0.8000 1.0000 1.5000 0.0000 Constraint 239 290 0.8000 1.0000 1.5000 0.0000 Constraint 239 277 0.8000 1.0000 1.5000 0.0000 Constraint 239 269 0.8000 1.0000 1.5000 0.0000 Constraint 239 261 0.8000 1.0000 1.5000 0.0000 Constraint 239 255 0.8000 1.0000 1.5000 0.0000 Constraint 239 247 0.8000 1.0000 1.5000 0.0000 Constraint 230 558 0.8000 1.0000 1.5000 0.0000 Constraint 230 290 0.8000 1.0000 1.5000 0.0000 Constraint 230 277 0.8000 1.0000 1.5000 0.0000 Constraint 230 269 0.8000 1.0000 1.5000 0.0000 Constraint 230 261 0.8000 1.0000 1.5000 0.0000 Constraint 230 255 0.8000 1.0000 1.5000 0.0000 Constraint 230 247 0.8000 1.0000 1.5000 0.0000 Constraint 230 239 0.8000 1.0000 1.5000 0.0000 Constraint 222 558 0.8000 1.0000 1.5000 0.0000 Constraint 222 277 0.8000 1.0000 1.5000 0.0000 Constraint 222 269 0.8000 1.0000 1.5000 0.0000 Constraint 222 261 0.8000 1.0000 1.5000 0.0000 Constraint 222 255 0.8000 1.0000 1.5000 0.0000 Constraint 222 247 0.8000 1.0000 1.5000 0.0000 Constraint 222 239 0.8000 1.0000 1.5000 0.0000 Constraint 222 230 0.8000 1.0000 1.5000 0.0000 Constraint 214 558 0.8000 1.0000 1.5000 0.0000 Constraint 214 277 0.8000 1.0000 1.5000 0.0000 Constraint 214 269 0.8000 1.0000 1.5000 0.0000 Constraint 214 261 0.8000 1.0000 1.5000 0.0000 Constraint 214 255 0.8000 1.0000 1.5000 0.0000 Constraint 214 247 0.8000 1.0000 1.5000 0.0000 Constraint 214 239 0.8000 1.0000 1.5000 0.0000 Constraint 214 230 0.8000 1.0000 1.5000 0.0000 Constraint 214 222 0.8000 1.0000 1.5000 0.0000 Constraint 207 558 0.8000 1.0000 1.5000 0.0000 Constraint 207 269 0.8000 1.0000 1.5000 0.0000 Constraint 207 261 0.8000 1.0000 1.5000 0.0000 Constraint 207 255 0.8000 1.0000 1.5000 0.0000 Constraint 207 247 0.8000 1.0000 1.5000 0.0000 Constraint 207 239 0.8000 1.0000 1.5000 0.0000 Constraint 207 230 0.8000 1.0000 1.5000 0.0000 Constraint 207 222 0.8000 1.0000 1.5000 0.0000 Constraint 207 214 0.8000 1.0000 1.5000 0.0000 Constraint 199 558 0.8000 1.0000 1.5000 0.0000 Constraint 199 261 0.8000 1.0000 1.5000 0.0000 Constraint 199 255 0.8000 1.0000 1.5000 0.0000 Constraint 199 247 0.8000 1.0000 1.5000 0.0000 Constraint 199 239 0.8000 1.0000 1.5000 0.0000 Constraint 199 230 0.8000 1.0000 1.5000 0.0000 Constraint 199 222 0.8000 1.0000 1.5000 0.0000 Constraint 199 214 0.8000 1.0000 1.5000 0.0000 Constraint 199 207 0.8000 1.0000 1.5000 0.0000 Constraint 189 558 0.8000 1.0000 1.5000 0.0000 Constraint 189 255 0.8000 1.0000 1.5000 0.0000 Constraint 189 247 0.8000 1.0000 1.5000 0.0000 Constraint 189 239 0.8000 1.0000 1.5000 0.0000 Constraint 189 230 0.8000 1.0000 1.5000 0.0000 Constraint 189 222 0.8000 1.0000 1.5000 0.0000 Constraint 189 214 0.8000 1.0000 1.5000 0.0000 Constraint 189 207 0.8000 1.0000 1.5000 0.0000 Constraint 189 199 0.8000 1.0000 1.5000 0.0000 Constraint 177 558 0.8000 1.0000 1.5000 0.0000 Constraint 177 239 0.8000 1.0000 1.5000 0.0000 Constraint 177 230 0.8000 1.0000 1.5000 0.0000 Constraint 177 222 0.8000 1.0000 1.5000 0.0000 Constraint 177 214 0.8000 1.0000 1.5000 0.0000 Constraint 177 207 0.8000 1.0000 1.5000 0.0000 Constraint 177 199 0.8000 1.0000 1.5000 0.0000 Constraint 177 189 0.8000 1.0000 1.5000 0.0000 Constraint 169 558 0.8000 1.0000 1.5000 0.0000 Constraint 169 550 0.8000 1.0000 1.5000 0.0000 Constraint 169 230 0.8000 1.0000 1.5000 0.0000 Constraint 169 222 0.8000 1.0000 1.5000 0.0000 Constraint 169 214 0.8000 1.0000 1.5000 0.0000 Constraint 169 207 0.8000 1.0000 1.5000 0.0000 Constraint 169 199 0.8000 1.0000 1.5000 0.0000 Constraint 169 189 0.8000 1.0000 1.5000 0.0000 Constraint 169 177 0.8000 1.0000 1.5000 0.0000 Constraint 164 558 0.8000 1.0000 1.5000 0.0000 Constraint 164 222 0.8000 1.0000 1.5000 0.0000 Constraint 164 214 0.8000 1.0000 1.5000 0.0000 Constraint 164 207 0.8000 1.0000 1.5000 0.0000 Constraint 164 199 0.8000 1.0000 1.5000 0.0000 Constraint 164 189 0.8000 1.0000 1.5000 0.0000 Constraint 164 177 0.8000 1.0000 1.5000 0.0000 Constraint 164 169 0.8000 1.0000 1.5000 0.0000 Constraint 152 558 0.8000 1.0000 1.5000 0.0000 Constraint 152 207 0.8000 1.0000 1.5000 0.0000 Constraint 152 199 0.8000 1.0000 1.5000 0.0000 Constraint 152 189 0.8000 1.0000 1.5000 0.0000 Constraint 152 177 0.8000 1.0000 1.5000 0.0000 Constraint 152 169 0.8000 1.0000 1.5000 0.0000 Constraint 152 164 0.8000 1.0000 1.5000 0.0000 Constraint 144 558 0.8000 1.0000 1.5000 0.0000 Constraint 144 199 0.8000 1.0000 1.5000 0.0000 Constraint 144 189 0.8000 1.0000 1.5000 0.0000 Constraint 144 177 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 164 0.8000 1.0000 1.5000 0.0000 Constraint 144 152 0.8000 1.0000 1.5000 0.0000 Constraint 136 558 0.8000 1.0000 1.5000 0.0000 Constraint 136 189 0.8000 1.0000 1.5000 0.0000 Constraint 136 177 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 164 0.8000 1.0000 1.5000 0.0000 Constraint 136 152 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 131 558 0.8000 1.0000 1.5000 0.0000 Constraint 131 177 0.8000 1.0000 1.5000 0.0000 Constraint 131 169 0.8000 1.0000 1.5000 0.0000 Constraint 131 164 0.8000 1.0000 1.5000 0.0000 Constraint 131 152 0.8000 1.0000 1.5000 0.0000 Constraint 131 144 0.8000 1.0000 1.5000 0.0000 Constraint 131 136 0.8000 1.0000 1.5000 0.0000 Constraint 120 558 0.8000 1.0000 1.5000 0.0000 Constraint 120 169 0.8000 1.0000 1.5000 0.0000 Constraint 120 164 0.8000 1.0000 1.5000 0.0000 Constraint 120 152 0.8000 1.0000 1.5000 0.0000 Constraint 120 144 0.8000 1.0000 1.5000 0.0000 Constraint 120 136 0.8000 1.0000 1.5000 0.0000 Constraint 120 131 0.8000 1.0000 1.5000 0.0000 Constraint 115 558 0.8000 1.0000 1.5000 0.0000 Constraint 115 164 0.8000 1.0000 1.5000 0.0000 Constraint 115 152 0.8000 1.0000 1.5000 0.0000 Constraint 115 144 0.8000 1.0000 1.5000 0.0000 Constraint 115 136 0.8000 1.0000 1.5000 0.0000 Constraint 115 131 0.8000 1.0000 1.5000 0.0000 Constraint 115 120 0.8000 1.0000 1.5000 0.0000 Constraint 109 558 0.8000 1.0000 1.5000 0.0000 Constraint 109 152 0.8000 1.0000 1.5000 0.0000 Constraint 109 144 0.8000 1.0000 1.5000 0.0000 Constraint 109 136 0.8000 1.0000 1.5000 0.0000 Constraint 109 131 0.8000 1.0000 1.5000 0.0000 Constraint 109 120 0.8000 1.0000 1.5000 0.0000 Constraint 109 115 0.8000 1.0000 1.5000 0.0000 Constraint 101 558 0.8000 1.0000 1.5000 0.0000 Constraint 101 152 0.8000 1.0000 1.5000 0.0000 Constraint 101 144 0.8000 1.0000 1.5000 0.0000 Constraint 101 136 0.8000 1.0000 1.5000 0.0000 Constraint 101 131 0.8000 1.0000 1.5000 0.0000 Constraint 101 120 0.8000 1.0000 1.5000 0.0000 Constraint 101 115 0.8000 1.0000 1.5000 0.0000 Constraint 101 109 0.8000 1.0000 1.5000 0.0000 Constraint 93 558 0.8000 1.0000 1.5000 0.0000 Constraint 93 144 0.8000 1.0000 1.5000 0.0000 Constraint 93 136 0.8000 1.0000 1.5000 0.0000 Constraint 93 131 0.8000 1.0000 1.5000 0.0000 Constraint 93 120 0.8000 1.0000 1.5000 0.0000 Constraint 93 115 0.8000 1.0000 1.5000 0.0000 Constraint 93 109 0.8000 1.0000 1.5000 0.0000 Constraint 93 101 0.8000 1.0000 1.5000 0.0000 Constraint 86 558 0.8000 1.0000 1.5000 0.0000 Constraint 86 136 0.8000 1.0000 1.5000 0.0000 Constraint 86 131 0.8000 1.0000 1.5000 0.0000 Constraint 86 120 0.8000 1.0000 1.5000 0.0000 Constraint 86 115 0.8000 1.0000 1.5000 0.0000 Constraint 86 109 0.8000 1.0000 1.5000 0.0000 Constraint 86 101 0.8000 1.0000 1.5000 0.0000 Constraint 86 93 0.8000 1.0000 1.5000 0.0000 Constraint 81 558 0.8000 1.0000 1.5000 0.0000 Constraint 81 131 0.8000 1.0000 1.5000 0.0000 Constraint 81 120 0.8000 1.0000 1.5000 0.0000 Constraint 81 115 0.8000 1.0000 1.5000 0.0000 Constraint 81 109 0.8000 1.0000 1.5000 0.0000 Constraint 81 101 0.8000 1.0000 1.5000 0.0000 Constraint 81 93 0.8000 1.0000 1.5000 0.0000 Constraint 81 86 0.8000 1.0000 1.5000 0.0000 Constraint 73 558 0.8000 1.0000 1.5000 0.0000 Constraint 73 544 0.8000 1.0000 1.5000 0.0000 Constraint 73 120 0.8000 1.0000 1.5000 0.0000 Constraint 73 115 0.8000 1.0000 1.5000 0.0000 Constraint 73 109 0.8000 1.0000 1.5000 0.0000 Constraint 73 101 0.8000 1.0000 1.5000 0.0000 Constraint 73 93 0.8000 1.0000 1.5000 0.0000 Constraint 73 86 0.8000 1.0000 1.5000 0.0000 Constraint 73 81 0.8000 1.0000 1.5000 0.0000 Constraint 65 558 0.8000 1.0000 1.5000 0.0000 Constraint 65 544 0.8000 1.0000 1.5000 0.0000 Constraint 65 120 0.8000 1.0000 1.5000 0.0000 Constraint 65 115 0.8000 1.0000 1.5000 0.0000 Constraint 65 109 0.8000 1.0000 1.5000 0.0000 Constraint 65 101 0.8000 1.0000 1.5000 0.0000 Constraint 65 93 0.8000 1.0000 1.5000 0.0000 Constraint 65 86 0.8000 1.0000 1.5000 0.0000 Constraint 65 81 0.8000 1.0000 1.5000 0.0000 Constraint 65 73 0.8000 1.0000 1.5000 0.0000 Constraint 58 558 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 115 0.8000 1.0000 1.5000 0.0000 Constraint 58 109 0.8000 1.0000 1.5000 0.0000 Constraint 58 101 0.8000 1.0000 1.5000 0.0000 Constraint 58 93 0.8000 1.0000 1.5000 0.0000 Constraint 58 86 0.8000 1.0000 1.5000 0.0000 Constraint 58 81 0.8000 1.0000 1.5000 0.0000 Constraint 58 73 0.8000 1.0000 1.5000 0.0000 Constraint 58 65 0.8000 1.0000 1.5000 0.0000 Constraint 47 558 0.8000 1.0000 1.5000 0.0000 Constraint 47 544 0.8000 1.0000 1.5000 0.0000 Constraint 47 109 0.8000 1.0000 1.5000 0.0000 Constraint 47 101 0.8000 1.0000 1.5000 0.0000 Constraint 47 93 0.8000 1.0000 1.5000 0.0000 Constraint 47 86 0.8000 1.0000 1.5000 0.0000 Constraint 47 81 0.8000 1.0000 1.5000 0.0000 Constraint 47 73 0.8000 1.0000 1.5000 0.0000 Constraint 47 65 0.8000 1.0000 1.5000 0.0000 Constraint 47 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 558 0.8000 1.0000 1.5000 0.0000 Constraint 39 544 0.8000 1.0000 1.5000 0.0000 Constraint 39 101 0.8000 1.0000 1.5000 0.0000 Constraint 39 93 0.8000 1.0000 1.5000 0.0000 Constraint 39 86 0.8000 1.0000 1.5000 0.0000 Constraint 39 81 0.8000 1.0000 1.5000 0.0000 Constraint 39 73 0.8000 1.0000 1.5000 0.0000 Constraint 39 65 0.8000 1.0000 1.5000 0.0000 Constraint 39 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 47 0.8000 1.0000 1.5000 0.0000 Constraint 31 558 0.8000 1.0000 1.5000 0.0000 Constraint 31 544 0.8000 1.0000 1.5000 0.0000 Constraint 31 533 0.8000 1.0000 1.5000 0.0000 Constraint 31 525 0.8000 1.0000 1.5000 0.0000 Constraint 31 93 0.8000 1.0000 1.5000 0.0000 Constraint 31 86 0.8000 1.0000 1.5000 0.0000 Constraint 31 81 0.8000 1.0000 1.5000 0.0000 Constraint 31 73 0.8000 1.0000 1.5000 0.0000 Constraint 31 65 0.8000 1.0000 1.5000 0.0000 Constraint 31 58 0.8000 1.0000 1.5000 0.0000 Constraint 31 47 0.8000 1.0000 1.5000 0.0000 Constraint 31 39 0.8000 1.0000 1.5000 0.0000 Constraint 22 558 0.8000 1.0000 1.5000 0.0000 Constraint 22 544 0.8000 1.0000 1.5000 0.0000 Constraint 22 533 0.8000 1.0000 1.5000 0.0000 Constraint 22 525 0.8000 1.0000 1.5000 0.0000 Constraint 22 315 0.8000 1.0000 1.5000 0.0000 Constraint 22 308 0.8000 1.0000 1.5000 0.0000 Constraint 22 296 0.8000 1.0000 1.5000 0.0000 Constraint 22 290 0.8000 1.0000 1.5000 0.0000 Constraint 22 277 0.8000 1.0000 1.5000 0.0000 Constraint 22 269 0.8000 1.0000 1.5000 0.0000 Constraint 22 261 0.8000 1.0000 1.5000 0.0000 Constraint 22 255 0.8000 1.0000 1.5000 0.0000 Constraint 22 247 0.8000 1.0000 1.5000 0.0000 Constraint 22 207 0.8000 1.0000 1.5000 0.0000 Constraint 22 199 0.8000 1.0000 1.5000 0.0000 Constraint 22 189 0.8000 1.0000 1.5000 0.0000 Constraint 22 86 0.8000 1.0000 1.5000 0.0000 Constraint 22 81 0.8000 1.0000 1.5000 0.0000 Constraint 22 73 0.8000 1.0000 1.5000 0.0000 Constraint 22 65 0.8000 1.0000 1.5000 0.0000 Constraint 22 58 0.8000 1.0000 1.5000 0.0000 Constraint 22 47 0.8000 1.0000 1.5000 0.0000 Constraint 22 39 0.8000 1.0000 1.5000 0.0000 Constraint 22 31 0.8000 1.0000 1.5000 0.0000 Constraint 11 558 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 533 0.8000 1.0000 1.5000 0.0000 Constraint 11 525 0.8000 1.0000 1.5000 0.0000 Constraint 11 315 0.8000 1.0000 1.5000 0.0000 Constraint 11 308 0.8000 1.0000 1.5000 0.0000 Constraint 11 296 0.8000 1.0000 1.5000 0.0000 Constraint 11 290 0.8000 1.0000 1.5000 0.0000 Constraint 11 277 0.8000 1.0000 1.5000 0.0000 Constraint 11 269 0.8000 1.0000 1.5000 0.0000 Constraint 11 261 0.8000 1.0000 1.5000 0.0000 Constraint 11 255 0.8000 1.0000 1.5000 0.0000 Constraint 11 247 0.8000 1.0000 1.5000 0.0000 Constraint 11 207 0.8000 1.0000 1.5000 0.0000 Constraint 11 199 0.8000 1.0000 1.5000 0.0000 Constraint 11 189 0.8000 1.0000 1.5000 0.0000 Constraint 11 81 0.8000 1.0000 1.5000 0.0000 Constraint 11 73 0.8000 1.0000 1.5000 0.0000 Constraint 11 65 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 47 0.8000 1.0000 1.5000 0.0000 Constraint 11 39 0.8000 1.0000 1.5000 0.0000 Constraint 11 31 0.8000 1.0000 1.5000 0.0000 Constraint 11 22 0.8000 1.0000 1.5000 0.0000 Constraint 3 558 0.8000 1.0000 1.5000 0.0000 Constraint 3 550 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 525 0.8000 1.0000 1.5000 0.0000 Constraint 3 516 0.8000 1.0000 1.5000 0.0000 Constraint 3 315 0.8000 1.0000 1.5000 0.0000 Constraint 3 308 0.8000 1.0000 1.5000 0.0000 Constraint 3 296 0.8000 1.0000 1.5000 0.0000 Constraint 3 290 0.8000 1.0000 1.5000 0.0000 Constraint 3 277 0.8000 1.0000 1.5000 0.0000 Constraint 3 269 0.8000 1.0000 1.5000 0.0000 Constraint 3 261 0.8000 1.0000 1.5000 0.0000 Constraint 3 255 0.8000 1.0000 1.5000 0.0000 Constraint 3 247 0.8000 1.0000 1.5000 0.0000 Constraint 3 207 0.8000 1.0000 1.5000 0.0000 Constraint 3 199 0.8000 1.0000 1.5000 0.0000 Constraint 3 189 0.8000 1.0000 1.5000 0.0000 Constraint 3 73 0.8000 1.0000 1.5000 0.0000 Constraint 3 65 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 47 0.8000 1.0000 1.5000 0.0000 Constraint 3 39 0.8000 1.0000 1.5000 0.0000 Constraint 3 31 0.8000 1.0000 1.5000 0.0000 Constraint 3 22 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: