# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0349/ # command:# Making conformation for sequence T0349 numbered 1 through 75 Created new target T0349 from T0349.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0349/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0349//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0349//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0349/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f06A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f06A expands to /projects/compbio/data/pdb/2f06.pdb.gz 2f06A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 22, because occupancy 0.5 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 26, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 28, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 30, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 32, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 308, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 312, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 314, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 316, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 318, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 320, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 344, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 348, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 350, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 352, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 354, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 356, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 358, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 360, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 746, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 750, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 752, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 754, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 756, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 758, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 760, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 762, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 773, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 777, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 779, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 781, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 783, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 785, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 850, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 854, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 856, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 858, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 860, because occupancy 0.500 <= existing 0.500 in 2f06A Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 1051, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1055, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1057, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1059, because occupancy 0.500 <= existing 0.500 in 2f06A Skipped atom 1061, because occupancy 0.500 <= existing 0.500 in 2f06A # T0349 read from 2f06A/merged-good-all-a2m # 2f06A read from 2f06A/merged-good-all-a2m # adding 2f06A to template set # found chain 2f06A in template set Warning: unaligning (T0349)R47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)G47 Warning: unaligning (T0349)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G47 T0349 13 :LSAVGALLDGADIGHLVLD 2f06A 17 :LTEVTEVLAKENINLSALC # choosing archetypes in rotamer library T0349 43 :VIP 2f06A 36 :IAE T0349 46 :R 2f06A 45 :L T0349 49 :LVH 2f06A 48 :IVS T0349 54 :DLAGARRLLTDAGLA 2f06A 51 :DPDKAYKALKDNHFA Number of specific fragments extracted= 5 number of extra gaps= 1 total=5 Number of alignments=1 # 2f06A read from 2f06A/merged-good-all-a2m # found chain 2f06A in template set Warning: unaligning (T0349)L12 because of BadResidue code BAD_PEPTIDE at template residue (2f06A)R16 Warning: unaligning (T0349)S35 because of BadResidue code BAD_PEPTIDE in next template residue (2f06A)I44 Warning: unaligning (T0349)I36 because of BadResidue code BAD_PEPTIDE at template residue (2f06A)I44 Warning: unaligning (T0349)R47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)G47 Warning: unaligning (T0349)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G47 T0349 13 :LSAVGALLDGADIGHLVLD 2f06A 17 :LTEVTEVLAKENINLSALC T0349 32 :QNM 2f06A 40 :ADF T0349 37 :L 2f06A 45 :L T0349 49 :LVH 2f06A 48 :IVS T0349 54 :DLAGARRLLTDAGLAHE 2f06A 51 :DPDKAYKALKDNHFAVN Number of specific fragments extracted= 5 number of extra gaps= 3 total=10 Number of alignments=2 # 2f06A read from 2f06A/merged-good-all-a2m # found chain 2f06A in template set Warning: unaligning (T0349)D9 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)S14 Warning: unaligning (T0349)A10 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)S14 Warning: unaligning (T0349)V11 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G15 Warning: unaligning (T0349)L12 because of BadResidue code BAD_PEPTIDE at template residue (2f06A)R16 Warning: unaligning (T0349)R47 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f06A)G47 Warning: unaligning (T0349)V48 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f06A)G47 T0349 8 :N 2f06A 12 :N T0349 13 :LSAVGALLDGADIGH 2f06A 17 :LTEVTEVLAKENINL T0349 32 :QNMSILEGSL 2f06A 32 :SALCIAENAD T0349 46 :R 2f06A 45 :L T0349 49 :LVHE 2f06A 48 :IVSD T0349 55 :LAGARRLLTDAGLA 2f06A 52 :PDKAYKALKDNHFA Number of specific fragments extracted= 6 number of extra gaps= 2 total=16 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ve1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ve1A expands to /projects/compbio/data/pdb/1ve1.pdb.gz 1ve1A:# T0349 read from 1ve1A/merged-good-all-a2m # 1ve1A read from 1ve1A/merged-good-all-a2m # adding 1ve1A to template set # found chain 1ve1A in template set T0349 9 :DAVLLSAVGALLDG 1ve1A 177 :GGTITGVGRYLKER T0349 23 :ADIGHLVLD 1ve1A 192 :PHVKVIAVE T0349 32 :QNMSILEGS 1ve1A 202 :ARSNVLSGG T0349 41 :LGVIPRRVLVHEDD 1ve1A 231 :LSLLDGVIQVWEED T0349 55 :LAGARRLLTDAGLA 1ve1A 246 :FPLARRLAREEGLF Number of specific fragments extracted= 5 number of extra gaps= 0 total=21 Number of alignments=4 # 1ve1A read from 1ve1A/merged-good-all-a2m # found chain 1ve1A in template set T0349 8 :NDAVLLSAVGALLDG 1ve1A 176 :TGGTITGVGRYLKER T0349 23 :ADIGHLVLD 1ve1A 192 :PHVKVIAVE T0349 32 :QNMSILEGS 1ve1A 202 :ARSNVLSGG T0349 41 :LGVIPRRVLVHEDD 1ve1A 231 :LSLLDGVIQVWEED T0349 55 :LAGARRLLTDAGLA 1ve1A 246 :FPLARRLAREEGLF Number of specific fragments extracted= 5 number of extra gaps= 0 total=26 Number of alignments=5 # 1ve1A read from 1ve1A/merged-good-all-a2m # found chain 1ve1A in template set T0349 7 :TNDAVLLSAVGALLDGA 1ve1A 174 :SGTGGTITGVGRYLKER T0349 24 :DIGHLVLD 1ve1A 193 :HVKVIAVE T0349 32 :QNMSILEGS 1ve1A 202 :ARSNVLSGG T0349 41 :LGVIPRRVLVHEDD 1ve1A 231 :LSLLDGVIQVWEED T0349 55 :LAGARRLLTDAGLA 1ve1A 246 :FPLARRLAREEGLF Number of specific fragments extracted= 5 number of extra gaps= 0 total=31 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gt1A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gt1A expands to /projects/compbio/data/pdb/1gt1.pdb.gz 1gt1A:# T0349 read from 1gt1A/merged-good-all-a2m # 1gt1A read from 1gt1A/merged-good-all-a2m # adding 1gt1A to template set # found chain 1gt1A in template set T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1gt1A 124 :VEDEDLEKFWKLTEDKGIDKKN Number of specific fragments extracted= 1 number of extra gaps= 0 total=32 Number of alignments=7 # 1gt1A read from 1gt1A/merged-good-all-a2m # found chain 1gt1A in template set T0349 31 :DQNMSILEGSLGV 1gt1A 107 :DKHGQTTELTELF T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHEL 1gt1A 120 :VKLNVEDEDLEKFWKLTEDKGIDKKN Number of specific fragments extracted= 2 number of extra gaps= 0 total=34 Number of alignments=8 # 1gt1A read from 1gt1A/merged-good-all-a2m # found chain 1gt1A in template set T0349 50 :VHEDDLAGARRLLTDAGLAHE 1gt1A 124 :VEDEDLEKFWKLTEDKGIDKK Number of specific fragments extracted= 1 number of extra gaps= 0 total=35 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gnkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1gnkA expands to /projects/compbio/data/pdb/1gnk.pdb.gz 1gnkA:# T0349 read from 1gnkA/merged-good-all-a2m # 1gnkA read from 1gnkA/merged-good-all-a2m # adding 1gnkA to template set # found chain 1gnkA in template set T0349 48 :VLVHEDDLAGARRLLTDAGLA 1gnkA 6 :VIIKPFKLEDVREALSSIGIQ Number of specific fragments extracted= 1 number of extra gaps= 0 total=36 Number of alignments=10 # 1gnkA read from 1gnkA/merged-good-all-a2m # found chain 1gnkA in template set Warning: unaligning (T0349)L41 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1gnkA)V53 T0349 16 :VGALLDGADIGHLVLD 1gnkA 16 :VREALSSIGIQGLTVT T0349 42 :GVIPR 1gnkA 54 :NFLPK T0349 47 :RVLVHEDDLAGARRLLTDAG 1gnkA 62 :DVAIADDQLDEVIDIVSKAA Number of specific fragments extracted= 3 number of extra gaps= 0 total=39 Number of alignments=11 # 1gnkA read from 1gnkA/merged-good-all-a2m # found chain 1gnkA in template set T0349 48 :VLVHEDDLAGARRLLTDAGLAH 1gnkA 6 :VIIKPFKLEDVREALSSIGIQG Number of specific fragments extracted= 1 number of extra gaps= 0 total=40 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1yj7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1yj7A expands to /projects/compbio/data/pdb/1yj7.pdb.gz 1yj7A:Skipped atom 32, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 34, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 36, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 38, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 40, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 132, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 134, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 136, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 138, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 140, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 805, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 807, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 1136, because occupancy 0.500 <= existing 0.500 in 1yj7A Skipped atom 1138, because occupancy 0.500 <= existing 0.500 in 1yj7A # T0349 read from 1yj7A/merged-good-all-a2m # 1yj7A read from 1yj7A/merged-good-all-a2m # adding 1yj7A to template set # found chain 1yj7A in template set T0349 13 :LSAVGALLDGADIGH 1yj7A 33 :ANQMQALLLSNDVNV T0349 28 :LVLDQNMS 1yj7A 49 :KEMDKSGN T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHEL 1yj7A 57 :MTLSVAAADFVRAITILNNNGFPKKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=43 Number of alignments=13 # 1yj7A read from 1yj7A/merged-good-all-a2m # found chain 1yj7A in template set T0349 10 :AVLLSAVGALLDGADIGHL 1yj7A 30 :EKEANQMQALLLSNDVNVS T0349 29 :VLDQNMS 1yj7A 50 :EMDKSGN T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHEL 1yj7A 57 :MTLSVAAADFVRAITILNNNGFPKKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=46 Number of alignments=14 # 1yj7A read from 1yj7A/merged-good-all-a2m # found chain 1yj7A in template set T0349 1 :MRELLRTN 1yj7A 20 :MKEQLYTG T0349 9 :DAVLLSAVGALLDGADIG 1yj7A 29 :TEKEANQMQALLLSNDVN T0349 30 :LDQN 1yj7A 51 :MDKS T0349 39 :G 1yj7A 55 :G T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 1yj7A 56 :NMTLSVAAADFVRAITILNNNGFPKK T0349 74 :D 1yj7A 82 :K Number of specific fragments extracted= 6 number of extra gaps= 0 total=52 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nm2A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nm2A expands to /projects/compbio/data/pdb/1nm2.pdb.gz 1nm2A:# T0349 read from 1nm2A/merged-good-all-a2m # 1nm2A read from 1nm2A/merged-good-all-a2m # adding 1nm2A to template set # found chain 1nm2A in template set T0349 13 :LSAVGALLDGADIGHLVLDQNMSILEG 1nm2A 257 :WDLCMETFKELGVTAIIEVCPGGTLTG T0349 40 :SLGVIPRRVLVHEDDLAGARRLLTDA 1nm2A 288 :ALPGVKTLALKTPDDLDAARELVAEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=54 Number of alignments=16 # 1nm2A read from 1nm2A/merged-good-all-a2m # found chain 1nm2A in template set T0349 13 :LSAVGALLDGADIGHLVLDQNMSILEG 1nm2A 257 :WDLCMETFKELGVTAIIEVCPGGTLTG T0349 40 :SLGVIPRRVLVHEDDLAGARRLLTDA 1nm2A 288 :ALPGVKTLALKTPDDLDAARELVAEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=56 Number of alignments=17 # 1nm2A read from 1nm2A/merged-good-all-a2m # found chain 1nm2A in template set T0349 8 :NDAVLLSAVGALLDGADIGHLVLDQNMSILEG 1nm2A 252 :ANPVRWDLCMETFKELGVTAIIEVCPGGTLTG T0349 40 :SLGVIPRRVLVHEDDLAGARRLLTDA 1nm2A 288 :ALPGVKTLALKTPDDLDAARELVAEH Number of specific fragments extracted= 2 number of extra gaps= 0 total=58 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ipd/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ipd expands to /projects/compbio/data/pdb/1ipd.pdb.gz 1ipd:Warning: there is no chain 1ipd will retry with 1ipdA # T0349 read from 1ipd/merged-good-all-a2m # 1ipd read from 1ipd/merged-good-all-a2m # adding 1ipd to template set # found chain 1ipd in template set T0349 11 :VLLSAVGALLDGADIGHLVLDQNMS 1ipd 164 :RVARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1ipd 189 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=60 Number of alignments=19 # 1ipd read from 1ipd/merged-good-all-a2m # found chain 1ipd in template set T0349 11 :VLLSAVGALLDGADIGHLVLDQNMSI 1ipd 164 :RVARVAFEAARKRRKHVVSVDKANVL T0349 53 :DDLAGARRLLTDA 1ipd 190 :EVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=62 Number of alignments=20 # 1ipd read from 1ipd/merged-good-all-a2m # found chain 1ipd in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1ipd 165 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1ipd 189 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=64 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1a3yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1a3yA expands to /projects/compbio/data/pdb/1a3y.pdb.gz 1a3yA:# T0349 read from 1a3yA/merged-good-all-a2m # 1a3yA read from 1a3yA/merged-good-all-a2m # adding 1a3yA to template set # found chain 1a3yA in template set T0349 44 :IPRRVL 1a3yA 114 :MTGLLG T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1a3yA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=22 # 1a3yA read from 1a3yA/merged-good-all-a2m # found chain 1a3yA in template set T0349 35 :SILEGSLGV 1a3yA 112 :TIMTGLLGK T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1a3yA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=68 Number of alignments=23 # 1a3yA read from 1a3yA/merged-good-all-a2m # found chain 1a3yA in template set T0349 50 :VHEDDLAGARRLLTDAGLAHE 1a3yA 124 :IEDQDLEKFKEVTRENGIPEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=69 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qd9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qd9A expands to /projects/compbio/data/pdb/1qd9.pdb.gz 1qd9A:Skipped atom 598, because occupancy 0.230 <= existing 0.770 in 1qd9A Skipped atom 600, because occupancy 0.230 <= existing 0.770 in 1qd9A Skipped atom 602, because occupancy 0.230 <= existing 0.770 in 1qd9A # T0349 read from 1qd9A/merged-good-all-a2m # 1qd9A read from 1qd9A/merged-good-all-a2m # adding 1qd9A to template set # found chain 1qd9A in template set T0349 6 :RTNDAVLLSAVGALLDGADIGH 1qd9A 47 :KEQTHQVFSNLKAVLEEAGASF T0349 42 :GVIPRRVLV 1qd9A 70 :TVVKATVFI T0349 51 :HEDDLAGARRLLTDA 1qd9A 80 :DMEQFAEVNEVYGQY Number of specific fragments extracted= 3 number of extra gaps= 0 total=72 Number of alignments=25 # 1qd9A read from 1qd9A/merged-good-all-a2m # found chain 1qd9A in template set T0349 9 :DAVLLSAVGALLDGADIGHL 1qd9A 50 :THQVFSNLKAVLEEAGASFE T0349 35 :SILEG 1qd9A 70 :TVVKA T0349 46 :RRVLVHEDDLAGARRLLTDA 1qd9A 75 :TVFIADMEQFAEVNEVYGQY Number of specific fragments extracted= 3 number of extra gaps= 0 total=75 Number of alignments=26 # 1qd9A read from 1qd9A/merged-good-all-a2m # found chain 1qd9A in template set T0349 11 :VLLSAVGALLDGADIG 1qd9A 52 :QVFSNLKAVLEEAGAS T0349 37 :LEGSLGV 1qd9A 68 :FETVVKA T0349 46 :RRVLVHEDDLAGARRLLTDA 1qd9A 75 :TVFIADMEQFAEVNEVYGQY Number of specific fragments extracted= 3 number of extra gaps= 0 total=78 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1oo0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1oo0A expands to /projects/compbio/data/pdb/1oo0.pdb.gz 1oo0A:# T0349 read from 1oo0A/merged-good-all-a2m # 1oo0A read from 1oo0A/merged-good-all-a2m # adding 1oo0A to template set # found chain 1oo0A in template set T0349 43 :VIPRRVLVHEDDLAGARRLLTDAGLAHE 1oo0A 46 :MIRKEAFVHQSVMEELKRIIIDSEIMQE Number of specific fragments extracted= 1 number of extra gaps= 0 total=79 Number of alignments=28 # 1oo0A read from 1oo0A/merged-good-all-a2m # found chain 1oo0A in template set T0349 43 :VIPRRVLVHEDDLAGARRLLTDAGLAHE 1oo0A 46 :MIRKEAFVHQSVMEELKRIIIDSEIMQE Number of specific fragments extracted= 1 number of extra gaps= 0 total=80 Number of alignments=29 # 1oo0A read from 1oo0A/merged-good-all-a2m # found chain 1oo0A in template set T0349 43 :VIPRRVLVHEDDLAGARRLLTDAGLAHE 1oo0A 46 :MIRKEAFVHQSVMEELKRIIIDSEIMQE Number of specific fragments extracted= 1 number of extra gaps= 0 total=81 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwmA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwmA expands to /projects/compbio/data/pdb/1kwm.pdb.gz 1kwmA:Skipped atom 268, because occupancy 0.470 <= existing 0.530 in 1kwmA Skipped atom 270, because occupancy 0.470 <= existing 0.530 in 1kwmA Skipped atom 272, because occupancy 0.470 <= existing 0.530 in 1kwmA WARNING: atom 790 has residue number 4 < previous residue 95A in 1kwmA Skipped atom 1086, because occupancy 0.330 <= existing 0.670 in 1kwmA Skipped atom 1088, because occupancy 0.330 <= existing 0.670 in 1kwmA Skipped atom 1090, because occupancy 0.330 <= existing 0.670 in 1kwmA Skipped atom 1311, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1313, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1315, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1317, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1319, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1321, because occupancy 0.470 <= existing 0.520 in 1kwmA Skipped atom 1961, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1963, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1965, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1967, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1969, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1971, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 1973, because occupancy 0.430 <= existing 0.570 in 1kwmA Skipped atom 2225, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2227, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2229, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2231, because occupancy 0.350 <= existing 0.650 in 1kwmA Skipped atom 2315, because occupancy 0.340 <= existing 0.660 in 1kwmA Skipped atom 2317, because occupancy 0.340 <= existing 0.660 in 1kwmA # T0349 read from 1kwmA/merged-good-all-a2m # 1kwmA read from 1kwmA/merged-good-all-a2m # adding 1kwmA to template set # found chain 1kwmA in template set T0349 9 :DAVLLSAVGALLDGADIGHLVLDQNMSI 1kwmA 19A:DENHINIIRELASTTQIDFWKPDSVTQI T0349 41 :LGVIPRRVLVHEDDLAGARRLLTDAGLA 1kwmA 47A:KPHSTVDFRVKAEDTVTVENVLKQNELQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=83 Number of alignments=31 # 1kwmA read from 1kwmA/merged-good-all-a2m # found chain 1kwmA in template set T0349 5 :LRTNDAVLLSAVGALLDGADIGHLVLDQNMSI 1kwmA 15A:VNVEDENHINIIRELASTTQIDFWKPDSVTQI T0349 41 :LGVIPRRVLVHEDDLAGARRLLTDAGLAHE 1kwmA 47A:KPHSTVDFRVKAEDTVTVENVLKQNELQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=85 Number of alignments=32 # 1kwmA read from 1kwmA/merged-good-all-a2m # found chain 1kwmA in template set T0349 5 :LRTNDAVLLSAVGALLDGADIGHLV 1kwmA 15A:VNVEDENHINIIRELASTTQIDFWK T0349 34 :MSILEGSLGVIPRRVLVHEDDLAGARRLLTDAGLA 1kwmA 40A:PDSVTQIKPHSTVDFRVKAEDTVTVENVLKQNELQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=87 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2cvlA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2cvlA expands to /projects/compbio/data/pdb/2cvl.pdb.gz 2cvlA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0349 read from 2cvlA/merged-good-all-a2m # 2cvlA read from 2cvlA/merged-good-all-a2m # adding 2cvlA to template set # found chain 2cvlA in template set T0349 5 :LRTNDAVLLSAVGALLDGADIGH 2cvlA 45 :IRVQTERVMENLKAVLEAAGSGL T0349 42 :GVIP 2cvlA 69 :RVVQ T0349 46 :RRVLVHEDDLAGARRLLTDA 2cvlA 74 :TCFLADMEDFPGFNEVYARY T0349 67 :LAHE 2cvlA 94 :FTPP Number of specific fragments extracted= 4 number of extra gaps= 0 total=91 Number of alignments=34 # 2cvlA read from 2cvlA/merged-good-all-a2m # found chain 2cvlA in template set T0349 6 :RTNDAVLLSAVGALLDGADIGH 2cvlA 46 :RVQTERVMENLKAVLEAAGSGL T0349 28 :LVLD 2cvlA 70 :VVQT T0349 46 :RRVLVHEDDLAGARRLLTDA 2cvlA 74 :TCFLADMEDFPGFNEVYARY T0349 67 :LAH 2cvlA 94 :FTP Number of specific fragments extracted= 4 number of extra gaps= 0 total=95 Number of alignments=35 # 2cvlA read from 2cvlA/merged-good-all-a2m # found chain 2cvlA in template set T0349 11 :VLLSAVGALLDGADIG 2cvlA 51 :RVMENLKAVLEAAGSG T0349 37 :LEGSLG 2cvlA 67 :LSRVVQ T0349 45 :PRRVLVHEDDLAGARRLLTDA 2cvlA 73 :TTCFLADMEDFPGFNEVYARY Number of specific fragments extracted= 3 number of extra gaps= 0 total=98 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g61A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1g61A/merged-good-all-a2m # 1g61A read from 1g61A/merged-good-all-a2m # found chain 1g61A in training set Warning: unaligning (T0349)N33 because of BadResidue code BAD_PEPTIDE in next template residue (1g61A)S2056 Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE at template residue (1g61A)S2056 T0349 13 :LSAVGALLD 1g61A 2037 :VNEVSEVLE T0349 25 :IGHLVLD 1g61A 2046 :TKCLQTN T0349 32 :Q 1g61A 2054 :G T0349 35 :SILEGSLGVIPRRVL 1g61A 2057 :SLVGSLSVANKYGLL T0349 50 :VHEDDLAGARRLLTDAGLAH 1g61A 2076 :VEDEELDRIKNFLKENNLDL Number of specific fragments extracted= 5 number of extra gaps= 1 total=103 Number of alignments=37 # 1g61A read from 1g61A/merged-good-all-a2m # found chain 1g61A in training set Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE in next template residue (1g61A)S2056 Warning: unaligning (T0349)S35 because of BadResidue code BAD_PEPTIDE at template residue (1g61A)S2056 T0349 9 :DAVLLSAVGALLD 1g61A 2033 :DKDDVNEVSEVLE T0349 25 :IGHLVLDQN 1g61A 2046 :TKCLQTNIG T0349 36 :ILEGSLGVI 1g61A 2057 :SLVGSLSVA T0349 45 :PRRVL 1g61A 2067 :KYGLL T0349 50 :VHEDDLAGARRLLTDAGLAHE 1g61A 2076 :VEDEELDRIKNFLKENNLDLN Number of specific fragments extracted= 5 number of extra gaps= 1 total=108 Number of alignments=38 # 1g61A read from 1g61A/merged-good-all-a2m # found chain 1g61A in training set Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE in next template residue (1g61A)S2056 Warning: unaligning (T0349)S35 because of BadResidue code BAD_PEPTIDE at template residue (1g61A)S2056 T0349 12 :LLSAVGALLD 1g61A 2036 :DVNEVSEVLE T0349 25 :IGHLVLDQN 1g61A 2046 :TKCLQTNIG T0349 36 :ILEGSLG 1g61A 2057 :SLVGSLS T0349 43 :VIPRRVL 1g61A 2065 :ANKYGLL T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1g61A 2076 :VEDEELDRIKNFLKENNLDLNV Number of specific fragments extracted= 5 number of extra gaps= 1 total=113 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1vjqA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1vjqA expands to /projects/compbio/data/pdb/1vjq.pdb.gz 1vjqA:Skipped atom 292, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 294, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 296, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 298, because occupancy 0.500 <= existing 0.500 in 1vjqA Skipped atom 300, because occupancy 0.500 <= existing 0.500 in 1vjqA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0349 read from 1vjqA/merged-good-all-a2m # 1vjqA read from 1vjqA/merged-good-all-a2m # adding 1vjqA to template set # found chain 1vjqA in template set Warning: unaligning (T0349)G26 because of BadResidue code BAD_PEPTIDE in next template residue (1vjqA)F28 Warning: unaligning (T0349)L28 because of BadResidue code BAD_PEPTIDE at template residue (1vjqA)F28 Warning: unaligning (T0349)V29 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vjqA)D29 T0349 9 :DAVLLSAVGALLDGADI 1vjqA 10 :NEEQVAFLEALAKQDEL T0349 30 :LDQNMS 1vjqA 30 :WQNPPT T0349 38 :EGS 1vjqA 37 :PGQ T0349 45 :PRRVLVHEDDLAGARRLLTDAGLA 1vjqA 40 :PVVILIPSDMVEWFLEMLKAKGIP Number of specific fragments extracted= 4 number of extra gaps= 1 total=117 Number of alignments=40 # 1vjqA read from 1vjqA/merged-good-all-a2m # found chain 1vjqA in template set Warning: unaligning (T0349)G26 because of BadResidue code BAD_PEPTIDE in next template residue (1vjqA)F28 Warning: unaligning (T0349)H27 because of BadResidue code BAD_PEPTIDE at template residue (1vjqA)F28 Warning: unaligning (T0349)L28 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vjqA)D29 T0349 5 :LRTNDAVLLSAVGALLDGADI 1vjqA 6 :IVPTNEEQVAFLEALAKQDEL T0349 30 :L 1vjqA 30 :W T0349 32 :QNMSILEGS 1vjqA 31 :QNPPTEPGQ T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 1vjqA 40 :PVVILIPSDMVEWFLEMLKAKGIPFT Number of specific fragments extracted= 4 number of extra gaps= 1 total=121 Number of alignments=41 # 1vjqA read from 1vjqA/merged-good-all-a2m # found chain 1vjqA in template set Warning: unaligning (T0349)N33 because of BadResidue code BAD_PEPTIDE in next template residue (1vjqA)F28 Warning: unaligning (T0349)M34 because of BadResidue code BAD_PEPTIDE at template residue (1vjqA)F28 Warning: unaligning (T0349)S35 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1vjqA)D29 T0349 4 :LLRTNDAVLLSAVGALLDGAD 1vjqA 5 :VIVPTNEEQVAFLEALAKQDE T0349 32 :Q 1vjqA 26 :L T0349 36 :ILEGS 1vjqA 30 :WQNPP T0349 41 :LGVIPRRVLVHEDDLAGARRLLTDAGLA 1vjqA 36 :EPGQPVVILIPSDMVEWFLEMLKAKGIP Number of specific fragments extracted= 4 number of extra gaps= 1 total=125 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pba/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pba expands to /projects/compbio/data/pdb/1pba.pdb.gz 1pba:Warning: there is no chain 1pba will retry with 1pbaA # T0349 read from 1pba/merged-good-all-a2m # 1pba read from 1pba/merged-good-all-a2m # adding 1pba to template set # found chain 1pba in template set Warning: unaligning (T0349)Q32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1pba)P40 Warning: unaligning (T0349)N33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1pba)P40 T0349 9 :DAVLLSAVGALLDGADIGH 1pba 19 :DENDISELHELASTRQIDF T0349 31 :D 1pba 38 :W T0349 34 :MSILE 1pba 41 :DSVTQ T0349 39 :GS 1pba 49 :HS T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 1pba 51 :TVDFRVKAEDILAVEDFLEQNELQYE Number of specific fragments extracted= 5 number of extra gaps= 1 total=130 Number of alignments=43 # 1pba read from 1pba/merged-good-all-a2m # found chain 1pba in template set Warning: unaligning (T0349)Q32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1pba)P40 Warning: unaligning (T0349)N33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1pba)P40 T0349 5 :LRTNDAVLLSAVGALLDGADIGHL 1pba 15 :VNVEDENDISELHELASTRQIDFW T0349 34 :MSILE 1pba 41 :DSVTQ T0349 39 :GS 1pba 49 :HS T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHELR 1pba 51 :TVDFRVKAEDILAVEDFLEQNELQYEVL Number of specific fragments extracted= 4 number of extra gaps= 1 total=134 Number of alignments=44 # 1pba read from 1pba/merged-good-all-a2m # found chain 1pba in template set Warning: unaligning (T0349)Q32 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1pba)P40 Warning: unaligning (T0349)N33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1pba)P40 T0349 5 :LRTNDAVLLSAVGALLDGADIG 1pba 15 :VNVEDENDISELHELASTRQID T0349 30 :LD 1pba 37 :FW T0349 34 :MSILE 1pba 41 :DSVTQ T0349 39 :GSL 1pba 49 :HST T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHE 1pba 52 :VDFRVKAEDILAVEDFLEQNELQYE Number of specific fragments extracted= 5 number of extra gaps= 1 total=139 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2gukA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2gukA expands to /projects/compbio/data/pdb/2guk.pdb.gz 2gukA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 271, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 273, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 275, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 277, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 279, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 2gukA Skipped atom 376, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 378, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 380, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 382, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 384, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 386, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 388, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 390, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 392, because occupancy 0.500 <= existing 0.500 in 2gukA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 589, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 591, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 593, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 595, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 597, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 599, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 601, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 603, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 605, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2gukA Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Skipped atom 930, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 932, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 934, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 936, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 938, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 940, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 942, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 944, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 946, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 948, because occupancy 0.500 <= existing 0.500 in 2gukA Skipped atom 950, because occupancy 0.500 <= existing 0.500 in 2gukA # T0349 read from 2gukA/merged-good-all-a2m # 2gukA read from 2gukA/merged-good-all-a2m # adding 2gukA to template set # found chain 2gukA in template set T0349 10 :AVLLSAVGALLDGAD 2gukA 11 :RVFMHHIYEFEKGVR T0349 40 :SL 2gukA 26 :SM T0349 46 :RRVLVHEDDLAGARRLLTDAGLA 2gukA 28 :VLATLANDDIPYAEERLRSRQIP Number of specific fragments extracted= 3 number of extra gaps= 0 total=142 Number of alignments=46 # 2gukA read from 2gukA/merged-good-all-a2m # found chain 2gukA in template set T0349 9 :DAVLLSAVGALLDGAD 2gukA 10 :LRVFMHHIYEFEKGVR T0349 40 :S 2gukA 26 :S T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHE 2gukA 27 :MVLATLANDDIPYAEERLRSRQIPYF Number of specific fragments extracted= 3 number of extra gaps= 0 total=145 Number of alignments=47 # 2gukA read from 2gukA/merged-good-all-a2m # found chain 2gukA in template set T0349 48 :VLVHEDDLAGARRLLTDAGLA 2gukA 30 :ATLANDDIPYAEERLRSRQIP Number of specific fragments extracted= 1 number of extra gaps= 0 total=146 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zvpA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zvpA expands to /projects/compbio/data/pdb/1zvp.pdb.gz 1zvpA:# T0349 read from 1zvpA/merged-good-all-a2m # 1zvpA read from 1zvpA/merged-good-all-a2m # adding 1zvpA to template set # found chain 1zvpA in template set T0349 15 :AVGALLDGADIGH 1zvpA 89 :AFATKLAEHGISA T0349 35 :SILEG 1zvpA 102 :NVIAG T0349 43 :VIPRRVLVHEDDLAGARRLLTD 1zvpA 107 :YYHDHIFVQKEKAQQALQALGE Number of specific fragments extracted= 3 number of extra gaps= 0 total=149 Number of alignments=49 # 1zvpA read from 1zvpA/merged-good-all-a2m # found chain 1zvpA in template set T0349 13 :LSAVGALLDGADIGHLVL 1zvpA 87 :TAAFATKLAEHGISANVI T0349 38 :E 1zvpA 105 :A T0349 42 :GVIPRRVLVHEDDLAGARRLLT 1zvpA 106 :GYYHDHIFVQKEKAQQALQALG Number of specific fragments extracted= 3 number of extra gaps= 0 total=152 Number of alignments=50 # 1zvpA read from 1zvpA/merged-good-all-a2m # found chain 1zvpA in template set T0349 14 :SAVGALLDGADIG 1zvpA 88 :AAFATKLAEHGIS T0349 34 :MSILEG 1zvpA 101 :ANVIAG T0349 43 :VIPRRVLVHEDDLAGARRLLT 1zvpA 107 :YYHDHIFVQKEKAQQALQALG Number of specific fragments extracted= 3 number of extra gaps= 0 total=155 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v6sA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1v6sA/merged-good-all-a2m # 1v6sA read from 1v6sA/merged-good-all-a2m # found chain 1v6sA in training set T0349 13 :LSAVGALLD 1v6sA 199 :IGVIESLLP T0349 24 :DIGHLVLDQNMS 1v6sA 208 :RIDRLLIGGAMA T0349 36 :ILEGSLGVI 1v6sA 225 :ALGGEVGRS T0349 49 :LVHEDDLAGARRLLTDA 1v6sA 234 :LVEEDRLDLAKDLLGRA Number of specific fragments extracted= 4 number of extra gaps= 0 total=159 Number of alignments=52 # 1v6sA read from 1v6sA/merged-good-all-a2m # found chain 1v6sA in training set T0349 13 :LSAVGALL 1v6sA 199 :IGVIESLL T0349 23 :ADIGHLVLDQNMS 1v6sA 207 :PRIDRLLIGGAMA T0349 36 :ILEGSLGVI 1v6sA 225 :ALGGEVGRS T0349 49 :LVHEDDLAGARRLLTDA 1v6sA 234 :LVEEDRLDLAKDLLGRA Number of specific fragments extracted= 4 number of extra gaps= 0 total=163 Number of alignments=53 # 1v6sA read from 1v6sA/merged-good-all-a2m # found chain 1v6sA in training set T0349 13 :LSAVGALLD 1v6sA 199 :IGVIESLLP T0349 24 :DIGHLVLDQNMS 1v6sA 208 :RIDRLLIGGAMA T0349 36 :ILEGSLG 1v6sA 225 :ALGGEVG T0349 47 :RVLVHEDDLAGARRLLTDA 1v6sA 232 :RSLVEEDRLDLAKDLLGRA Number of specific fragments extracted= 4 number of extra gaps= 0 total=167 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1hdoA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1hdoA/merged-good-all-a2m # 1hdoA read from 1hdoA/merged-good-all-a2m # found chain 1hdoA in training set Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)V121 Warning: unaligning (T0349)V50 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)V121 Warning: unaligning (T0349)A65 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)G143 Warning: unaligning (T0349)G66 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)G143 T0349 11 :VLLSAVGALLDGADIGHLVLDQNMSILEGSL 1hdoA 89 :EGARNIVAAMKAHGVDKVVACTSAFLLWDPT T0349 51 :HEDDLA 1hdoA 122 :PPRLQA T0349 57 :GARRLLTD 1hdoA 134 :RMHKVLRE T0349 67 :L 1hdoA 144 :L Number of specific fragments extracted= 4 number of extra gaps= 2 total=171 Number of alignments=55 # 1hdoA read from 1hdoA/merged-good-all-a2m # found chain 1hdoA in training set T0349 4 :LLRTNDAVLLSAVGALLD 1hdoA 8 :IFGATGQTGLTTLAQAVQ T0349 23 :ADIGHLVLDQNMSILEGSL 1hdoA 26 :AGYEVTVLVRDSSRLPSEG T0349 43 :VIPRRVLVHE 1hdoA 45 :PRPAHVVVGD T0349 53 :DDLAGARRLL 1hdoA 56 :LQAADVDKTV Number of specific fragments extracted= 4 number of extra gaps= 0 total=175 Number of alignments=56 # 1hdoA read from 1hdoA/merged-good-all-a2m # found chain 1hdoA in training set Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)V121 Warning: unaligning (T0349)V43 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)V121 Warning: unaligning (T0349)A65 because of BadResidue code BAD_PEPTIDE in next template residue (1hdoA)G143 Warning: unaligning (T0349)G66 because of BadResidue code BAD_PEPTIDE at template residue (1hdoA)G143 T0349 12 :LLSAVGALLDGADIGHLVLDQNMSILEGSL 1hdoA 90 :GARNIVAAMKAHGVDKVVACTSAFLLWDPT T0349 44 :IPRR 1hdoA 122 :PPRL T0349 49 :LVHEDDLAGARRLLTD 1hdoA 126 :QAVTDDHIRMHKVLRE T0349 67 :LA 1hdoA 144 :LK Number of specific fragments extracted= 4 number of extra gaps= 2 total=179 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1dzkA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1dzkA/merged-good-all-a2m # 1dzkA read from 1dzkA/merged-good-all-a2m # found chain 1dzkA in training set T0349 42 :GVIPRRVL 1dzkA 112 :TIMTGLLG T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1dzkA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=181 Number of alignments=58 # 1dzkA read from 1dzkA/merged-good-all-a2m # found chain 1dzkA in training set T0349 35 :SILEGSLGV 1dzkA 112 :TIMTGLLGK T0349 50 :VHEDDLAGARRLLTDAGLAHEL 1dzkA 124 :IEDQDLEKFKEVTRENGIPEEN Number of specific fragments extracted= 2 number of extra gaps= 0 total=183 Number of alignments=59 # 1dzkA read from 1dzkA/merged-good-all-a2m # found chain 1dzkA in training set T0349 50 :VHEDDLAGARRLLTDAGLAHE 1dzkA 124 :IEDQDLEKFKEVTRENGIPEE Number of specific fragments extracted= 1 number of extra gaps= 0 total=184 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zhvA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1zhvA expands to /projects/compbio/data/pdb/1zhv.pdb.gz 1zhvA:# T0349 read from 1zhvA/merged-good-all-a2m # 1zhvA read from 1zhvA/merged-good-all-a2m # adding 1zhvA to template set # found chain 1zhvA in template set T0349 13 :LSAVGALLDGADIGHLVLDQNM 1zhvA 80 :VLSVISPLSTNGIGIFVVSTFD T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAH 1zhvA 102 :GDHLLVRSNDLEKTADLLANAGHSL Number of specific fragments extracted= 2 number of extra gaps= 0 total=186 Number of alignments=61 # 1zhvA read from 1zhvA/merged-good-all-a2m # found chain 1zhvA in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNM 1zhvA 79 :IVLSVISPLSTNGIGIFVVSTFD T0349 45 :PRRVLVHEDDLAGARRLLTDAGLAHELRSD 1zhvA 102 :GDHLLVRSNDLEKTADLLANAGHSLLLEHH Number of specific fragments extracted= 2 number of extra gaps= 0 total=188 Number of alignments=62 # 1zhvA read from 1zhvA/merged-good-all-a2m # found chain 1zhvA in template set T0349 9 :DAVLLSAVGALLDGADIGHLVLDQ 1zhvA 76 :ETGIVLSVISPLSTNGIGIFVVST T0349 37 :LEG 1zhvA 100 :FDG T0349 46 :RRVLVHEDDLAGARRLLTDAGLAHELRS 1zhvA 103 :DHLLVRSNDLEKTADLLANAGHSLLLEH Number of specific fragments extracted= 3 number of extra gaps= 0 total=191 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1xaa/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1xaa expands to /projects/compbio/data/pdb/1xaa.pdb.gz 1xaa:Warning: there is no chain 1xaa will retry with 1xaaA # T0349 read from 1xaa/merged-good-all-a2m # 1xaa read from 1xaa/merged-good-all-a2m # adding 1xaa to template set # found chain 1xaa in template set T0349 10 :AVLLSAVGALLDGADIGHLVLDQNMS 1xaa 17 :EAALKVLRALDEAEGLGLAYEVFPFG T0349 36 :ILEGSLGVI 1xaa 45 :AIDAFGEPF T0349 55 :LAGARRLLTD 1xaa 54 :PEPTRKGVEE T0349 65 :AGLAHELR 1xaa 78 :DGLPRKIR Number of specific fragments extracted= 4 number of extra gaps= 0 total=195 Number of alignments=64 # 1xaa read from 1xaa/merged-good-all-a2m # found chain 1xaa in template set T0349 11 :VLLSAVGALLD 1xaa 18 :AALKVLRALDE T0349 22 :GADIGHLVLDQNMSILEGSLGVI 1xaa 31 :GLGLAYEVFPFGGAAIDAFGEPF T0349 51 :HEDDLAGARR 1xaa 54 :PEPTRKGVEE T0349 65 :AGLAHELR 1xaa 78 :DGLPRKIR Number of specific fragments extracted= 4 number of extra gaps= 0 total=199 Number of alignments=65 # 1xaa read from 1xaa/merged-good-all-a2m # found chain 1xaa in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1xaa 165 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1xaa 189 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=201 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1jbeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0349 read from 1jbeA/merged-good-all-a2m # 1jbeA read from 1jbeA/merged-good-all-a2m # found chain 1jbeA in training set Warning: unaligning (T0349)S40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbeA)A77 Warning: unaligning (T0349)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1jbeA)S79 Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE at template residue (1jbeA)S79 T0349 16 :VGALLDGADIGHLVLDQNMS 1jbeA 42 :ALNKLQAGGYGFVISDWNMP T0349 43 :VIPRRVLV 1jbeA 80 :ALPVLMVT T0349 51 :HEDDLAGARR 1jbeA 91 :KKENIIAAAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=204 Number of alignments=67 # 1jbeA read from 1jbeA/merged-good-all-a2m # found chain 1jbeA in training set Warning: unaligning (T0349)S40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbeA)A77 Warning: unaligning (T0349)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1jbeA)S79 Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE at template residue (1jbeA)S79 T0349 5 :LRTNDAV 1jbeA 34 :EEAEDGV T0349 15 :AVGALLDGADIGHLVLDQNMS 1jbeA 41 :DALNKLQAGGYGFVISDWNMP T0349 43 :VIPRRVLV 1jbeA 80 :ALPVLMVT T0349 51 :HEDDLAGARR 1jbeA 91 :KKENIIAAAQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=208 Number of alignments=68 # 1jbeA read from 1jbeA/merged-good-all-a2m # found chain 1jbeA in training set Warning: unaligning (T0349)S40 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1jbeA)A77 Warning: unaligning (T0349)L41 because of BadResidue code BAD_PEPTIDE in next template residue (1jbeA)S79 Warning: unaligning (T0349)G42 because of BadResidue code BAD_PEPTIDE at template residue (1jbeA)S79 T0349 16 :VGALLDGADIGHLVLDQNMSIL 1jbeA 42 :ALNKLQAGGYGFVISDWNMPNM T0349 43 :VIPRRVLVH 1jbeA 80 :ALPVLMVTA T0349 52 :EDDLAGARR 1jbeA 92 :KENIIAAAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=211 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1idm/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1idm expands to /projects/compbio/data/pdb/1idm.pdb.gz 1idm:Warning: there is no chain 1idm will retry with 1idmA # T0349 read from 1idm/merged-good-all-a2m # 1idm read from 1idm/merged-good-all-a2m # adding 1idm to template set # found chain 1idm in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1idm 163 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1idm 187 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=213 Number of alignments=70 # 1idm read from 1idm/merged-good-all-a2m # found chain 1idm in template set T0349 11 :VLLSAVGALLDGADIGHLVLDQNMSI 1idm 162 :RVARVAFEAARKRRKHVVSVDKANVL T0349 53 :DDLAGARRLLTDA 1idm 188 :EVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=215 Number of alignments=71 # 1idm read from 1idm/merged-good-all-a2m # found chain 1idm in template set T0349 12 :LLSAVGALLDGADIGHLVLDQNMS 1idm 163 :VARVAFEAARKRRKHVVSVDKANV T0349 52 :EDDLAGARRLLTDA 1idm 187 :LEVGEFWRKTVEEV Number of specific fragments extracted= 2 number of extra gaps= 0 total=217 Number of alignments=72 # command:Using radius: 24.0000 NUMB_ALIGNS: 72 evalue: 0 0.8723, weight 0.9884 evalue: 1 0.8723, weight 0.9884 evalue: 2 0.8723, weight 0.9884 evalue: 3 2.4278, weight 0.9674 evalue: 4 2.4278, weight 0.9674 evalue: 5 2.4278, weight 0.9674 evalue: 6 3.5066, weight 0.9528 evalue: 7 3.5066, weight 0.9528 evalue: 8 3.5066, weight 0.9528 evalue: 9 2.4397, weight 0.9672 evalue: 10 2.4397, weight 0.9672 evalue: 11 2.4397, weight 0.9672 evalue: 12 0.2267, weight 0.9971 evalue: 13 0.2267, weight 0.9971 evalue: 14 0.2267, weight 0.9971 evalue: 15 1.5778, weight 0.9789 evalue: 16 1.5778, weight 0.9789 evalue: 17 1.5778, weight 0.9789 evalue: 18 1.6700, weight 0.9776 evalue: 19 1.6700, weight 0.9776 evalue: 20 1.6700, weight 0.9776 evalue: 21 66.7000, weight 0.1000 evalue: 22 66.7000, weight 0.1000 evalue: 23 66.7000, weight 0.1000 evalue: 24 3.7561, weight 0.9495 evalue: 25 3.7561, weight 0.9495 evalue: 26 3.7561, weight 0.9495 evalue: 27 4.1579, weight 0.9440 evalue: 28 4.1579, weight 0.9440 evalue: 29 4.1579, weight 0.9440 evalue: 30 0.2685, weight 0.9965 evalue: 31 0.2685, weight 0.9965 evalue: 32 0.2685, weight 0.9965 evalue: 33 3.4511, weight 0.9536 evalue: 34 3.4511, weight 0.9536 evalue: 35 3.4511, weight 0.9536 evalue: 36 0.2452, weight 0.9969 evalue: 37 0.2452, weight 0.9969 evalue: 38 0.2452, weight 0.9969 evalue: 39 0.1717, weight 0.9978 evalue: 40 0.1717, weight 0.9978 evalue: 41 0.1717, weight 0.9978 evalue: 42 3.3717, weight 0.9547 evalue: 43 3.3717, weight 0.9547 evalue: 44 3.3717, weight 0.9547 evalue: 45 3.6706, weight 0.9506 evalue: 46 3.6706, weight 0.9506 evalue: 47 3.6706, weight 0.9506 evalue: 48 1.4213, weight 0.9810 evalue: 49 1.4213, weight 0.9810 evalue: 50 1.4213, weight 0.9810 evalue: 51 2.0152, weight 0.9730 evalue: 52 2.0152, weight 0.9730 evalue: 53 2.0152, weight 0.9730 evalue: 54 1.8689, weight 0.9749 evalue: 55 1.8689, weight 0.9749 evalue: 56 1.8689, weight 0.9749 evalue: 57 0.2922, weight 0.9962 evalue: 58 0.2922, weight 0.9962 evalue: 59 0.2922, weight 0.9962 evalue: 60 0.0121, weight 1.0000 evalue: 61 0.0121, weight 1.0000 evalue: 62 0.0121, weight 1.0000 evalue: 63 1.6700, weight 0.9776 evalue: 64 1.6700, weight 0.9776 evalue: 65 1.6700, weight 0.9776 evalue: 66 2.4979, weight 0.9665 evalue: 67 2.4979, weight 0.9665 evalue: 68 2.4979, weight 0.9665 evalue: 69 1.6200, weight 0.9783 evalue: 70 1.6200, weight 0.9783 evalue: 71 1.6200, weight 0.9783 RES2ATOM 0 2 RES2ATOM 1 10 RES2ATOM 2 21 RES2ATOM 3 30 RES2ATOM 4 38 RES2ATOM 5 46 RES2ATOM 6 57 RES2ATOM 7 64 RES2ATOM 8 72 RES2ATOM 9 80 RES2ATOM 10 85 RES2ATOM 11 92 RES2ATOM 12 100 RES2ATOM 13 108 RES2ATOM 14 114 RES2ATOM 15 119 RES2ATOM 17 130 RES2ATOM 18 135 RES2ATOM 19 143 RES2ATOM 20 151 RES2ATOM 22 163 RES2ATOM 23 168 RES2ATOM 24 176 RES2ATOM 26 188 RES2ATOM 27 198 RES2ATOM 28 206 RES2ATOM 29 213 RES2ATOM 30 221 RES2ATOM 31 229 RES2ATOM 32 238 RES2ATOM 33 246 RES2ATOM 34 254 RES2ATOM 35 260 RES2ATOM 36 268 RES2ATOM 37 276 RES2ATOM 39 289 RES2ATOM 40 295 RES2ATOM 42 307 RES2ATOM 43 314 RES2ATOM 44 322 RES2ATOM 45 329 RES2ATOM 46 340 RES2ATOM 47 351 RES2ATOM 48 358 RES2ATOM 49 366 RES2ATOM 50 373 RES2ATOM 51 383 RES2ATOM 52 392 RES2ATOM 53 400 RES2ATOM 54 408 RES2ATOM 55 416 RES2ATOM 57 425 RES2ATOM 58 430 RES2ATOM 59 441 RES2ATOM 60 452 RES2ATOM 61 460 RES2ATOM 62 468 RES2ATOM 63 475 RES2ATOM 64 483 RES2ATOM 66 492 RES2ATOM 67 500 RES2ATOM 68 505 RES2ATOM 69 515 RES2ATOM 70 524 RES2ATOM 71 532 RES2ATOM 72 543 RES2ATOM 73 549 RES2ATOM 74 557 Constraint 409 476 12.0502 15.0627 22.5941 60.7479 Constraint 401 469 11.9200 14.9000 22.3500 60.7438 Constraint 374 442 11.8847 14.8558 22.2837 59.7388 Constraint 409 484 12.8937 16.1172 24.1757 58.7947 Constraint 393 461 12.7134 15.8918 23.8377 58.7671 Constraint 401 476 12.3962 15.4952 23.2428 57.8069 Constraint 384 461 12.3596 15.4495 23.1743 57.7995 Constraint 384 453 12.1735 15.2169 22.8253 57.7995 Constraint 393 469 13.7449 17.1811 25.7717 57.7921 Constraint 367 442 11.3087 14.1358 21.2037 57.7862 Constraint 367 431 9.2518 11.5648 17.3472 57.7862 Constraint 417 484 12.2049 15.2561 22.8842 56.8394 Constraint 401 484 13.2222 16.5277 24.7916 56.8286 Constraint 384 469 13.8342 17.2928 25.9392 56.8246 Constraint 374 461 12.6317 15.7896 23.6844 55.8618 Constraint 374 453 11.6238 14.5297 21.7946 55.8618 Constraint 393 476 14.6291 18.2863 27.4295 55.8302 Constraint 120 426 10.3851 12.9814 19.4721 55.6974 Constraint 367 461 10.5912 13.2390 19.8585 54.8868 Constraint 367 453 10.3518 12.9398 19.4097 54.8868 Constraint 384 476 15.6755 19.5943 29.3915 54.8626 Constraint 374 469 14.8150 18.5187 27.7780 53.9119 Constraint 367 469 13.3991 16.7488 25.1233 53.9119 Constraint 393 484 16.1805 20.2256 30.3384 53.8742 Constraint 359 442 13.6441 17.0551 25.5826 53.6881 Constraint 359 431 11.1628 13.9535 20.9303 53.6881 Constraint 359 426 8.4858 10.6073 15.9109 53.6881 Constraint 384 484 16.5684 20.7105 31.0658 52.9067 Constraint 120 177 8.1627 10.2034 15.3050 52.7983 Constraint 144 442 13.3801 16.7252 25.0878 52.7952 Constraint 144 426 10.9781 13.7226 20.5839 52.7952 Constraint 374 476 15.7326 19.6658 29.4987 51.9499 Constraint 367 476 14.6213 18.2766 27.4150 51.9499 Constraint 120 453 9.2785 11.5982 17.3973 51.8204 Constraint 144 431 13.0379 16.2974 24.4461 51.8175 Constraint 136 426 11.5956 14.4945 21.7417 51.8175 Constraint 374 484 16.2430 20.3037 30.4556 50.9716 Constraint 136 453 9.9410 12.4263 18.6395 50.8530 Constraint 120 401 13.2928 16.6160 24.9240 50.8291 Constraint 359 461 11.8523 14.8154 22.2230 50.7887 Constraint 359 453 12.3146 15.3932 23.0899 50.7887 Constraint 367 484 14.3532 17.9416 26.9123 49.9940 Constraint 115 177 10.8299 13.5374 20.3061 49.8981 Constraint 177 442 13.7424 17.1779 25.7669 49.8961 Constraint 177 426 11.2248 14.0311 21.0466 49.8961 Constraint 144 453 9.8357 12.2947 18.4420 49.8856 Constraint 120 442 12.1694 15.2117 22.8176 49.8585 Constraint 120 431 11.5832 14.4790 21.7185 49.8585 Constraint 115 169 12.6514 15.8142 23.7213 49.8066 Constraint 177 431 13.2177 16.5221 24.7831 48.9184 Constraint 144 461 9.6086 12.0107 18.0161 48.9182 Constraint 136 461 9.8214 12.2767 18.4151 48.9182 Constraint 131 453 10.9249 13.6561 20.4842 48.9182 Constraint 120 461 7.9404 9.9255 14.8883 48.9182 Constraint 115 426 12.0182 15.0228 22.5341 48.8932 Constraint 152 426 13.6458 17.0573 25.5859 48.8920 Constraint 144 409 14.4911 18.1139 27.1708 48.8900 Constraint 120 417 14.6738 18.3422 27.5133 48.8809 Constraint 120 409 13.5111 16.8889 25.3334 48.8809 Constraint 109 177 11.9769 14.9711 22.4567 47.9507 Constraint 152 453 11.9283 14.9104 22.3656 47.9452 Constraint 144 469 12.4925 15.6156 23.4234 47.9432 Constraint 131 461 11.5405 14.4256 21.6383 47.9405 Constraint 101 426 10.7725 13.4656 20.1984 47.9340 Constraint 131 426 12.9018 16.1272 24.1909 47.9033 Constraint 109 169 13.9732 17.4665 26.1998 47.8592 Constraint 352 442 12.3429 15.4286 23.1429 47.8020 Constraint 352 431 10.1868 12.7336 19.1003 47.8020 Constraint 352 426 7.4727 9.3409 14.0113 47.8020 Constraint 101 177 11.5649 14.4561 21.6842 46.9697 Constraint 152 461 12.3956 15.4945 23.2418 46.9676 Constraint 101 453 9.5493 11.9366 17.9049 46.9564 Constraint 115 453 10.0631 12.5788 18.8683 46.9491 Constraint 359 469 14.8574 18.5718 27.8577 46.9116 Constraint 330 426 11.2933 14.1167 21.1750 46.8957 Constraint 330 409 13.3271 16.6589 24.9883 46.8957 Constraint 164 426 12.7132 15.8915 23.8373 46.8810 Constraint 101 169 14.3710 17.9637 26.9455 46.8782 Constraint 144 401 13.3941 16.7426 25.1139 46.0308 Constraint 177 461 10.7191 13.3988 20.0982 46.0191 Constraint 177 453 10.7096 13.3870 20.0806 46.0191 Constraint 152 469 14.8518 18.5647 27.8471 45.9926 Constraint 152 442 15.2392 19.0490 28.5734 45.9926 Constraint 101 461 9.3628 11.7036 17.5553 45.9890 Constraint 144 476 11.6563 14.5703 21.8555 45.9813 Constraint 136 476 11.6570 14.5713 21.8569 45.9813 Constraint 120 476 10.8773 13.5966 20.3949 45.9813 Constraint 101 401 13.6251 17.0314 25.5471 45.9680 Constraint 189 426 10.7988 13.4985 20.2478 45.9668 Constraint 131 189 9.8438 12.3048 18.4572 45.9668 Constraint 120 189 7.0088 8.7610 13.1415 45.9668 Constraint 330 417 15.6590 19.5737 29.3606 45.9284 Constraint 120 367 12.3899 15.4874 23.2311 45.9218 Constraint 120 359 12.2899 15.3623 23.0435 45.9218 Constraint 109 164 12.1258 15.1573 22.7359 45.9133 Constraint 341 426 10.0184 12.5230 18.7845 45.8919 Constraint 341 417 14.0209 17.5262 26.2893 45.8919 Constraint 115 461 9.7958 12.2448 18.3671 45.0143 Constraint 109 426 12.6667 15.8333 23.7500 45.0110 Constraint 120 469 10.8282 13.5353 20.3030 45.0066 Constraint 131 442 14.1940 17.7425 26.6137 45.0039 Constraint 169 461 13.2797 16.5996 24.8994 44.9500 Constraint 144 359 12.9174 16.1467 24.2201 44.9468 Constraint 120 393 16.5658 20.7072 31.0609 44.9408 Constraint 101 164 12.6647 15.8309 23.7464 44.9323 Constraint 352 461 9.6666 12.0832 18.1248 44.9027 Constraint 352 453 10.4480 13.0600 19.5900 44.9027 Constraint 109 461 11.0875 13.8593 20.7890 44.0333 Constraint 109 453 10.4078 13.0098 19.5146 44.0333 Constraint 152 476 13.1891 16.4863 24.7295 44.0307 Constraint 101 442 12.4507 15.5633 23.3450 44.0300 Constraint 131 469 13.7105 17.1381 25.7072 44.0290 Constraint 101 409 14.1390 17.6737 26.5105 44.0224 Constraint 341 442 14.1404 17.6755 26.5132 43.9660 Constraint 426 493 8.8845 11.1057 16.6585 43.2744 Constraint 177 476 12.7347 15.9184 23.8776 43.0822 Constraint 115 189 10.3096 12.8870 19.3305 43.0666 Constraint 189 442 13.0233 16.2791 24.4186 43.0646 Constraint 189 431 12.1100 15.1375 22.7063 43.0646 Constraint 109 442 14.0550 17.5688 26.3531 43.0584 Constraint 152 431 15.3333 19.1666 28.7499 43.0560 Constraint 101 431 12.1639 15.2049 22.8073 43.0550 Constraint 177 469 12.8892 16.1114 24.1672 43.0484 Constraint 330 453 12.7080 15.8850 23.8274 43.0435 Constraint 330 442 14.5241 18.1551 27.2326 43.0406 Constraint 330 431 12.3913 15.4891 23.2336 43.0406 Constraint 115 484 9.1434 11.4293 17.1439 43.0403 Constraint 120 484 7.9959 9.9949 14.9924 43.0402 Constraint 189 401 13.2964 16.6205 24.9308 43.0258 Constraint 164 461 11.8693 14.8366 22.2549 43.0040 Constraint 164 453 11.2203 14.0254 21.0381 43.0040 Constraint 136 442 12.4107 15.5134 23.2701 42.9910 Constraint 169 476 14.5879 18.2349 27.3523 42.9907 Constraint 341 431 11.2858 14.1072 21.1608 42.9897 Constraint 352 469 13.1582 16.4477 24.6716 42.9749 Constraint 426 501 11.0594 13.8243 20.7364 42.2994 Constraint 417 501 13.8862 17.3578 26.0367 42.2994 Constraint 417 493 12.5489 15.6861 23.5292 42.2994 Constraint 409 501 13.0505 16.3131 24.4696 42.2994 Constraint 409 493 11.9472 14.9340 22.4010 42.2994 Constraint 214 431 11.7601 14.7001 22.0502 42.1864 Constraint 214 426 9.2968 11.6210 17.4315 42.1864 Constraint 214 409 11.4745 14.3431 21.5146 42.1864 Constraint 144 214 10.8090 13.5113 20.2669 42.1864 Constraint 136 214 12.3785 15.4731 23.2097 42.1864 Constraint 131 214 13.5642 16.9552 25.4328 42.1864 Constraint 120 214 9.0407 11.3009 16.9514 42.1864 Constraint 359 484 15.2092 19.0114 28.5172 42.1109 Constraint 189 453 10.4936 13.1170 19.6756 42.0898 Constraint 144 367 12.4810 15.6013 23.4019 42.0860 Constraint 109 469 13.5683 16.9603 25.4405 42.0808 Constraint 109 431 14.4982 18.1228 27.1842 42.0808 Constraint 115 476 11.3271 14.1589 21.2384 42.0774 Constraint 101 469 11.7737 14.7171 22.0756 42.0774 Constraint 101 484 8.9530 11.1912 16.7869 42.0729 Constraint 144 484 9.0497 11.3121 16.9682 42.0728 Constraint 136 484 8.7697 10.9622 16.4432 42.0728 Constraint 131 484 9.5408 11.9260 17.8890 42.0728 Constraint 109 401 15.2937 19.1171 28.6757 42.0700 Constraint 131 476 11.6697 14.5871 21.8807 42.0670 Constraint 341 453 12.5810 15.7262 23.5893 42.0397 Constraint 115 442 13.1239 16.4048 24.6073 42.0238 Constraint 136 431 12.2761 15.3451 23.0176 42.0134 Constraint 431 501 9.2936 11.6170 17.4255 41.3218 Constraint 374 493 15.8183 19.7728 29.6592 41.3218 Constraint 152 214 13.8808 17.3510 26.0265 41.2135 Constraint 214 401 11.0598 13.8248 20.7371 41.2088 Constraint 359 476 16.0191 20.0239 30.0359 41.1646 Constraint 222 431 12.3133 15.3916 23.0875 41.1623 Constraint 222 426 10.0306 12.5382 18.8073 41.1623 Constraint 222 409 11.2487 14.0609 21.0914 41.1623 Constraint 120 222 10.9075 13.6344 20.4516 41.1623 Constraint 199 442 13.1366 16.4207 24.6310 41.1397 Constraint 199 431 11.9546 14.9432 22.4148 41.1397 Constraint 199 426 10.1047 12.6309 18.9464 41.1397 Constraint 136 199 10.3674 12.9592 19.4389 41.1397 Constraint 131 199 11.9795 14.9744 22.4615 41.1397 Constraint 120 199 8.2522 10.3153 15.4729 41.1397 Constraint 109 189 10.4375 13.0469 19.5704 41.1192 Constraint 101 189 8.5911 10.7389 16.1084 41.1192 Constraint 189 417 14.7712 18.4640 27.6960 41.1120 Constraint 189 409 13.2711 16.5888 24.8832 41.1120 Constraint 109 484 9.5593 11.9491 17.9237 41.1055 Constraint 152 484 10.8473 13.5592 20.3387 41.0998 Constraint 109 476 11.6906 14.6133 21.9199 41.0964 Constraint 101 476 10.7741 13.4676 20.2014 41.0964 Constraint 115 431 13.0107 16.2634 24.3951 41.0461 Constraint 164 476 13.6512 17.0640 25.5960 41.0448 Constraint 152 330 12.8253 16.0316 24.0474 41.0395 Constraint 144 330 9.9629 12.4537 18.6805 41.0395 Constraint 136 330 11.1466 13.9333 20.9000 41.0395 Constraint 120 330 8.3077 10.3846 15.5769 41.0395 Constraint 136 469 11.6334 14.5418 21.8127 41.0384 Constraint 131 431 14.3038 17.8798 26.8197 41.0384 Constraint 115 401 14.3928 17.9911 26.9866 41.0269 Constraint 352 476 14.2620 17.8275 26.7412 41.0129 Constraint 136 359 13.7609 17.2011 25.8017 40.9888 Constraint 401 501 15.6104 19.5130 29.2694 40.3334 Constraint 401 493 13.3718 16.7147 25.0721 40.3334 Constraint 169 453 11.8933 14.8667 22.3000 40.2184 Constraint 199 417 14.2247 17.7809 26.6713 40.1902 Constraint 222 401 11.0401 13.8001 20.7002 40.1847 Constraint 144 222 13.2226 16.5283 24.7924 40.1847 Constraint 136 222 14.4276 18.0345 27.0517 40.1847 Constraint 131 222 15.4937 19.3671 29.0507 40.1847 Constraint 101 367 13.6191 17.0238 25.5358 40.0932 Constraint 101 359 13.3638 16.7047 25.0571 40.0932 Constraint 115 469 12.0133 15.0166 22.5249 40.0712 Constraint 115 417 15.9971 19.9964 29.9946 40.0712 Constraint 115 409 15.1364 18.9205 28.3807 40.0712 Constraint 101 417 14.6736 18.3420 27.5131 40.0615 Constraint 136 401 13.4010 16.7512 25.1268 40.0500 Constraint 120 341 10.6162 13.2702 19.9053 40.0377 Constraint 120 352 9.1581 11.4476 17.1714 40.0357 Constraint 352 484 12.7218 15.9022 23.8534 40.0319 Constraint 367 493 13.1307 16.4133 24.6200 39.3692 Constraint 384 493 15.8419 19.8024 29.7036 39.3450 Constraint 120 230 13.2925 16.6156 24.9234 39.3278 Constraint 115 214 12.4241 15.5301 23.2951 39.2863 Constraint 169 431 14.2022 17.7527 26.6290 39.2435 Constraint 169 426 11.9663 14.9579 22.4369 39.2435 Constraint 207 442 13.5745 16.9682 25.4523 39.2355 Constraint 207 426 10.0019 12.5024 18.7536 39.2355 Constraint 144 207 9.9856 12.4820 18.7230 39.2355 Constraint 136 207 11.7461 14.6826 22.0240 39.2355 Constraint 131 207 12.9188 16.1485 24.2227 39.2355 Constraint 120 207 8.6123 10.7654 16.1481 39.2355 Constraint 255 431 14.4394 18.0492 27.0738 39.2189 Constraint 255 426 12.3671 15.4588 23.1883 39.2189 Constraint 199 409 12.3147 15.3933 23.0900 39.2152 Constraint 199 401 12.0207 15.0259 22.5389 39.2126 Constraint 189 461 9.1233 11.4041 17.1061 39.1876 Constraint 177 484 10.6734 13.3417 20.0126 39.1737 Constraint 330 461 10.2079 12.7599 19.1398 39.1663 Constraint 341 461 10.3752 12.9690 19.4536 39.1375 Constraint 109 409 16.2558 20.3197 30.4796 39.0902 Constraint 169 484 12.9695 16.2119 24.3178 39.0822 Constraint 152 352 13.4796 16.8495 25.2743 39.0627 Constraint 152 341 14.8252 18.5315 27.7972 39.0627 Constraint 144 352 10.2989 12.8736 19.3104 39.0627 Constraint 144 341 11.7256 14.6570 21.9856 39.0627 Constraint 136 352 11.3987 14.2484 21.3726 39.0627 Constraint 136 341 13.0884 16.3605 24.5407 39.0627 Constraint 131 352 13.2319 16.5399 24.8099 39.0627 Constraint 164 469 13.8582 17.3228 25.9841 39.0356 Constraint 393 493 16.4086 20.5107 30.7661 38.3566 Constraint 109 214 12.5170 15.6463 23.4694 38.3198 Constraint 101 214 9.2670 11.5837 17.3756 38.3198 Constraint 214 461 10.6430 13.3037 19.9556 38.3095 Constraint 214 453 11.3776 14.2220 21.3330 38.3095 Constraint 169 469 14.7112 18.3890 27.5835 38.2659 Constraint 115 222 13.9101 17.3877 26.0815 38.2621 Constraint 207 409 12.3401 15.4252 23.1378 38.2606 Constraint 115 199 12.0574 15.0717 22.6076 38.2395 Constraint 189 469 12.0092 15.0115 22.5172 38.2126 Constraint 247 426 11.6517 14.5646 21.8470 38.1838 Constraint 177 330 11.1035 13.8793 20.8190 38.1404 Constraint 120 255 12.7613 15.9516 23.9274 38.1227 Constraint 109 359 15.4841 19.3551 29.0326 38.0836 Constraint 136 367 12.7513 15.9391 23.9087 38.0522 Constraint 93 152 12.2291 15.2864 22.9296 38.0520 Constraint 164 330 13.0263 16.2829 24.4243 38.0490 Constraint 131 330 11.9423 14.9278 22.3917 38.0490 Constraint 367 501 14.4988 18.1235 27.1853 37.4621 Constraint 207 417 14.2074 17.7593 26.6389 37.3070 Constraint 207 401 11.9622 14.9527 22.4290 37.3043 Constraint 164 431 13.4472 16.8090 25.2135 37.2976 Constraint 109 222 13.8383 17.2979 25.9468 37.2957 Constraint 101 222 10.2652 12.8315 19.2473 37.2957 Constraint 255 409 12.4989 15.6236 23.4354 37.2945 Constraint 222 461 11.8936 14.8669 22.3004 37.2853 Constraint 222 453 12.6560 15.8200 23.7300 37.2853 Constraint 109 199 12.3769 15.4711 23.2067 37.2731 Constraint 101 199 9.8262 12.2827 18.4240 37.2731 Constraint 199 461 10.2052 12.7565 19.1348 37.2627 Constraint 199 453 10.8164 13.5206 20.2808 37.2627 Constraint 189 476 11.8833 14.8541 22.2811 37.2317 Constraint 136 409 13.7423 17.1779 25.7668 37.2151 Constraint 120 247 11.7866 14.7332 22.0999 37.2062 Constraint 214 442 12.7153 15.8941 23.8412 37.2021 Constraint 214 417 12.9723 16.2153 24.3230 37.2021 Constraint 164 484 11.6241 14.5302 21.7953 37.1363 Constraint 115 352 11.9973 14.9966 22.4949 37.1356 Constraint 120 384 15.5673 19.4591 29.1886 37.1057 Constraint 131 359 15.1610 18.9512 28.4268 37.1026 Constraint 115 367 13.6490 17.0613 25.5920 37.0944 Constraint 120 374 13.7568 17.1960 25.7940 37.0924 Constraint 131 367 14.7035 18.3794 27.5691 37.0848 Constraint 169 330 13.7885 17.2356 25.8534 37.0817 Constraint 93 426 10.5130 13.1413 19.7119 37.0732 Constraint 384 501 16.5076 20.6345 30.9517 36.4629 Constraint 101 230 12.6605 15.8256 23.7384 36.4285 Constraint 115 207 11.8887 14.8609 22.2914 36.3354 Constraint 207 431 11.4552 14.3189 21.4784 36.3333 Constraint 214 384 13.0954 16.3693 24.5539 36.3012 Constraint 177 359 11.0912 13.8640 20.7960 36.2680 Constraint 222 384 12.6126 15.7657 23.6485 36.2519 Constraint 131 401 14.5694 18.2117 27.3176 36.2267 Constraint 247 431 13.0937 16.3672 24.5507 36.1896 Constraint 247 409 11.9209 14.9012 22.3518 36.1896 Constraint 177 352 10.3998 12.9997 19.4996 36.1636 Constraint 177 341 11.8041 14.7551 22.1326 36.1636 Constraint 115 384 17.7845 22.2306 33.3459 36.1385 Constraint 115 359 14.0974 17.6218 26.4327 36.1195 Constraint 109 417 16.6636 20.8294 31.2442 36.0967 Constraint 93 453 9.8470 12.3088 18.4632 36.0955 Constraint 93 401 13.4794 16.8493 25.2739 36.0955 Constraint 169 341 14.9251 18.6563 27.9845 36.0722 Constraint 164 352 13.0934 16.3667 24.5501 36.0722 Constraint 164 341 14.4710 18.0888 27.1332 36.0722 Constraint 131 341 14.3425 17.9281 26.8921 36.0722 Constraint 93 169 15.4889 19.3611 29.0416 36.0583 Constraint 93 164 13.5359 16.9199 25.3799 36.0583 Constraint 374 501 17.1692 21.4615 32.1923 35.5812 Constraint 109 207 11.7211 14.6514 21.9771 35.3689 Constraint 101 207 8.4836 10.6045 15.9068 35.3689 Constraint 330 469 13.2069 16.5086 24.7629 35.3592 Constraint 207 453 11.0547 13.8183 20.7275 35.3585 Constraint 230 431 11.8496 14.8120 22.2179 35.3481 Constraint 230 426 9.3780 11.7225 17.5837 35.3481 Constraint 230 409 9.5201 11.9002 17.8502 35.3481 Constraint 255 453 14.2680 17.8350 26.7526 35.3420 Constraint 152 359 14.5484 18.1854 27.2782 35.3334 Constraint 144 417 14.0170 17.5212 26.2819 35.3319 Constraint 199 393 14.8754 18.5943 27.8914 35.3073 Constraint 255 401 11.8004 14.7505 22.1258 35.3056 Constraint 323 401 15.6449 19.5561 29.3342 35.2468 Constraint 109 352 13.2037 16.5046 24.7570 35.1881 Constraint 115 330 10.2317 12.7897 19.1845 35.1488 Constraint 93 442 13.0627 16.3283 24.4925 35.1384 Constraint 93 409 14.0229 17.5286 26.2929 35.0795 Constraint 177 409 12.0452 15.0564 22.5847 34.4140 Constraint 214 484 13.3707 16.7134 25.0702 34.4037 Constraint 177 367 10.1621 12.7026 19.0540 34.3691 Constraint 214 374 11.7309 14.6636 21.9954 34.3634 Constraint 222 484 14.7877 18.4847 27.7270 34.3605 Constraint 341 469 13.1255 16.4068 24.6103 34.3574 Constraint 131 409 15.7828 19.7284 29.5927 34.3543 Constraint 207 393 14.8183 18.5229 27.7843 34.3526 Constraint 214 469 13.6705 17.0882 25.6322 34.3432 Constraint 199 384 14.3189 17.8986 26.8479 34.3049 Constraint 101 247 11.4169 14.2711 21.4066 34.3035 Constraint 323 426 12.8709 16.0887 24.1330 34.3002 Constraint 152 222 15.7739 19.7174 29.5760 34.2863 Constraint 101 341 11.4263 14.2828 21.4243 34.2091 Constraint 101 352 10.6947 13.3684 20.0526 34.2071 Constraint 101 374 14.7906 18.4883 27.7324 34.1808 Constraint 93 461 9.0767 11.3459 17.0188 34.1607 Constraint 109 230 15.5911 19.4889 29.2334 33.4968 Constraint 101 239 12.1132 15.1415 22.7123 33.4338 Constraint 120 239 12.9121 16.1402 24.2103 33.4309 Constraint 177 401 10.0819 12.6024 18.9036 33.4256 Constraint 330 476 14.3499 17.9373 26.9060 33.3973 Constraint 199 469 12.5129 15.6411 23.4617 33.3855 Constraint 230 401 8.8159 11.0199 16.5298 33.3821 Constraint 169 442 12.9837 16.2297 24.3445 33.3730 Constraint 239 431 12.1526 15.1907 22.7861 33.3447 Constraint 239 426 10.4367 13.0459 19.5689 33.3447 Constraint 222 374 11.5182 14.3977 21.5966 33.3392 Constraint 323 409 14.6769 18.3462 27.5192 33.3330 Constraint 189 484 9.1959 11.4948 17.2423 33.3232 Constraint 101 255 11.9488 14.9360 22.4040 33.2614 Constraint 115 374 15.4422 19.3028 28.9542 33.2258 Constraint 109 330 11.0180 13.7725 20.6588 33.2014 Constraint 101 330 8.4481 10.5602 15.8403 33.1953 Constraint 222 442 13.1293 16.4117 24.6175 33.1779 Constraint 115 341 12.6855 15.8569 23.7853 33.1720 Constraint 93 177 12.6822 15.8528 23.7792 33.1572 Constraint 115 230 15.4748 19.3434 29.0152 32.4941 Constraint 177 417 12.6510 15.8138 23.7207 32.4895 Constraint 393 501 17.6991 22.1239 33.1859 32.4849 Constraint 230 461 12.9571 16.1963 24.2945 32.4595 Constraint 207 461 9.2908 11.6135 17.4203 32.4563 Constraint 239 461 13.5765 16.9706 25.4559 32.4561 Constraint 144 230 14.5773 18.2216 27.3324 32.4459 Constraint 255 461 13.5029 16.8786 25.3179 32.4398 Constraint 330 484 11.5570 14.4462 21.6693 32.4163 Constraint 230 384 10.3173 12.8967 19.3450 32.4146 Constraint 214 367 9.5911 11.9889 17.9834 32.4108 Constraint 214 359 8.1715 10.2144 15.3216 32.4108 Constraint 199 476 12.9891 16.2364 24.3545 32.4046 Constraint 207 384 14.2699 17.8374 26.7561 32.3967 Constraint 261 426 11.3168 14.1460 21.2190 32.3961 Constraint 341 476 14.8402 18.5502 27.8253 32.3954 Constraint 199 484 11.6887 14.6109 21.9163 32.3792 Constraint 255 442 15.2387 19.0483 28.5725 32.3675 Constraint 277 426 13.5488 16.9361 25.4041 32.3625 Constraint 230 442 13.2308 16.5385 24.8077 32.3481 Constraint 214 393 12.9843 16.2304 24.3456 32.3268 Constraint 352 493 11.2529 14.0661 21.0991 32.3060 Constraint 152 323 14.1495 17.6868 26.5303 32.2991 Constraint 144 323 11.3531 14.1914 21.2871 32.2991 Constraint 136 323 12.8476 16.0595 24.0893 32.2991 Constraint 131 323 14.4168 18.0210 27.0315 32.2991 Constraint 120 323 10.3582 12.9477 19.4216 32.2991 Constraint 189 367 10.7024 13.3780 20.0670 32.2973 Constraint 189 359 9.5314 11.9143 17.8715 32.2973 Constraint 109 367 14.4782 18.0977 27.1466 32.2830 Constraint 93 476 11.4888 14.3611 21.5416 32.2184 Constraint 222 417 12.2427 15.3033 22.9550 32.2106 Constraint 101 393 15.3445 19.1806 28.7709 32.2074 Constraint 109 341 13.7198 17.1497 25.7246 32.1995 Constraint 93 484 9.1482 11.4353 17.1529 32.1931 Constraint 93 431 11.9486 14.9358 22.4037 32.1773 Constraint 86 152 12.7369 15.9211 23.8816 32.1348 Constraint 86 144 11.9018 14.8773 22.3159 32.1348 Constraint 359 493 13.6834 17.1042 25.6564 31.4861 Constraint 207 469 12.6304 15.7880 23.6820 31.4814 Constraint 144 239 15.3059 19.1324 28.6986 31.4757 Constraint 230 453 12.8198 16.0247 24.0371 31.4711 Constraint 323 431 13.1310 16.4138 24.6206 31.4681 Constraint 136 230 15.8382 19.7977 29.6966 31.4491 Constraint 164 442 11.9277 14.9096 22.3645 31.4271 Constraint 222 469 14.1699 17.7124 26.5686 31.4151 Constraint 247 461 12.6170 15.7713 23.6569 31.4046 Constraint 261 409 12.4048 15.5059 23.2589 31.3982 Constraint 222 367 9.8942 12.3677 18.5516 31.3867 Constraint 222 359 8.1308 10.1634 15.2452 31.3867 Constraint 164 359 13.1888 16.4860 24.7290 31.3754 Constraint 269 426 12.4139 15.5174 23.2761 31.3385 Constraint 169 352 12.5503 15.6879 23.5318 31.3125 Constraint 189 330 8.4510 10.5638 15.8457 31.3089 Constraint 120 261 10.7619 13.4524 20.1786 31.2998 Constraint 222 393 12.1571 15.1963 22.7945 31.2493 Constraint 247 401 11.0900 13.8625 20.7937 31.2352 Constraint 93 417 14.7911 18.4889 27.7333 31.1996 Constraint 86 426 13.2808 16.6011 24.9016 31.1560 Constraint 86 169 17.1746 21.4683 32.2024 31.1380 Constraint 86 164 15.1552 18.9440 28.4160 31.1380 Constraint 207 484 12.1223 15.1529 22.7294 30.4751 Constraint 189 374 12.3105 15.3881 23.0821 30.4548 Constraint 341 484 12.6723 15.8404 23.7606 30.4395 Constraint 199 374 11.6105 14.5131 21.7696 30.4386 Constraint 189 384 14.7469 18.4336 27.6504 30.4316 Constraint 169 359 12.7506 15.9382 23.9073 30.4260 Constraint 199 367 10.1242 12.6553 18.9830 30.4146 Constraint 199 359 8.3570 10.4462 15.6694 30.3891 Constraint 230 393 10.4570 13.0712 19.6068 30.3821 Constraint 239 442 13.4538 16.8172 25.2259 30.3534 Constraint 239 409 9.4122 11.7653 17.6479 30.3534 Constraint 247 453 12.9137 16.1422 24.2133 30.3126 Constraint 189 352 8.5904 10.7380 16.1070 30.3051 Constraint 115 393 17.6740 22.0924 33.1387 30.2606 Constraint 93 469 11.5419 14.4274 21.6411 30.2247 Constraint 431 506 8.4388 10.5485 15.8228 29.5883 Constraint 426 506 10.1007 12.6259 18.9389 29.5883 Constraint 417 506 12.6597 15.8247 23.7370 29.5883 Constraint 409 506 11.6420 14.5525 21.8288 29.5883 Constraint 109 239 14.7513 18.4392 27.6588 29.5053 Constraint 115 239 15.2777 19.0972 28.6458 29.5043 Constraint 261 431 12.7639 15.9549 23.9323 29.4939 Constraint 207 374 12.5086 15.6358 23.4537 29.4840 Constraint 120 493 7.8326 9.7907 14.6860 29.4547 Constraint 115 493 8.9385 11.1731 16.7597 29.4547 Constraint 144 374 11.7982 14.7478 22.1217 29.4503 Constraint 136 374 13.0994 16.3742 24.5613 29.4503 Constraint 261 401 11.6930 14.6163 21.9244 29.4322 Constraint 255 417 13.1282 16.4102 24.6154 29.4238 Constraint 115 323 13.1763 16.4704 24.7056 29.3990 Constraint 308 426 14.3051 17.8814 26.8221 29.3986 Constraint 177 323 11.4705 14.3381 21.5071 29.3834 Constraint 230 417 10.7603 13.4504 20.1756 29.3572 Constraint 239 417 11.3600 14.2001 21.3001 29.3556 Constraint 109 261 13.1383 16.4229 24.6343 29.3524 Constraint 115 255 14.3194 17.8993 26.8489 29.3444 Constraint 189 341 8.5737 10.7171 16.0757 29.3321 Constraint 101 277 11.3892 14.2365 21.3548 29.3043 Constraint 93 189 10.0534 12.5668 18.8502 29.3024 Constraint 247 442 13.6766 17.0957 25.6435 29.2943 Constraint 120 269 10.3042 12.8802 19.3203 29.2870 Constraint 109 374 16.0651 20.0814 30.1221 29.2513 Constraint 247 417 12.4567 15.5709 23.3563 29.2137 Constraint 442 506 10.6001 13.2502 19.8753 28.6106 Constraint 359 501 14.4860 18.1075 27.1612 28.5839 Constraint 230 367 8.8390 11.0488 16.5732 28.5638 Constraint 230 359 7.8195 9.7744 14.6616 28.5638 Constraint 255 484 15.2901 19.1127 28.6690 28.5306 Constraint 352 501 12.0087 15.0109 22.5163 28.5210 Constraint 323 442 14.6744 18.3430 27.5145 28.5153 Constraint 214 330 7.5109 9.3886 14.0829 28.5036 Constraint 261 442 14.0514 17.5643 26.3464 28.4960 Constraint 214 341 7.3388 9.1735 13.7602 28.4881 Constraint 136 493 9.0828 11.3535 17.0303 28.4873 Constraint 109 493 10.8969 13.6211 20.4317 28.4873 Constraint 207 359 8.4550 10.5688 15.8531 28.4850 Constraint 131 374 14.8894 18.6118 27.9177 28.4838 Constraint 277 461 12.9787 16.2234 24.3351 28.4827 Constraint 109 247 13.2327 16.5409 24.8114 28.4390 Constraint 269 431 13.5691 16.9614 25.4421 28.4363 Constraint 315 426 12.9755 16.2194 24.3290 28.4278 Constraint 247 367 10.7058 13.3822 20.0734 28.4082 Constraint 247 359 9.3703 11.7129 17.5693 28.4082 Constraint 239 401 9.0697 11.3371 17.0057 28.3874 Constraint 115 261 13.3123 16.6403 24.9605 28.3781 Constraint 101 261 9.8857 12.3572 18.5358 28.3714 Constraint 214 476 13.4676 16.8345 25.2517 28.3691 Constraint 255 374 11.8085 14.7606 22.1409 28.3524 Constraint 255 359 9.7356 12.1694 18.2542 28.3471 Constraint 277 359 11.8726 14.8408 22.2612 28.3361 Constraint 101 269 10.4636 13.0795 19.6192 28.3139 Constraint 269 359 11.2581 14.0726 21.1089 28.3121 Constraint 247 384 11.9288 14.9110 22.3665 28.2746 Constraint 86 453 11.2165 14.0206 21.0309 28.2445 Constraint 177 374 9.1870 11.4838 17.2257 27.6004 Constraint 323 461 10.6590 13.3237 19.9856 27.5938 Constraint 323 453 12.9826 16.2283 24.3424 27.5938 Constraint 277 409 13.9213 17.4016 26.1024 27.5741 Constraint 261 461 11.9317 14.9147 22.3720 27.5498 Constraint 261 453 12.0491 15.0614 22.5921 27.5498 Constraint 189 393 14.6975 18.3718 27.5578 27.5475 Constraint 207 367 10.2150 12.7688 19.1532 27.5314 Constraint 230 374 9.0523 11.3154 16.9731 27.5251 Constraint 144 493 9.4523 11.8153 17.7230 27.5199 Constraint 101 493 9.3098 11.6373 17.4560 27.5199 Constraint 214 352 6.6336 8.2919 12.4379 27.5132 Constraint 261 367 11.5111 14.3888 21.5832 27.5099 Constraint 136 417 12.7447 15.9309 23.8964 27.5089 Constraint 131 417 15.4710 19.3387 29.0081 27.5089 Constraint 261 417 13.7322 17.1652 25.7478 27.4995 Constraint 269 461 12.3501 15.4376 23.1564 27.4922 Constraint 93 214 10.4376 13.0470 19.5705 27.4915 Constraint 277 453 13.7769 17.2211 25.8316 27.4827 Constraint 136 239 16.0222 20.0277 30.0416 27.4820 Constraint 222 330 9.0022 11.2527 16.8791 27.4794 Constraint 269 409 13.2203 16.5254 24.7881 27.4767 Constraint 222 341 7.9095 9.8869 14.8303 27.4640 Constraint 315 409 14.7274 18.4093 27.6140 27.4529 Constraint 109 323 13.8419 17.3024 25.9536 27.4515 Constraint 93 222 11.1166 13.8958 20.8437 27.4483 Constraint 269 442 15.0419 18.8024 28.2036 27.4385 Constraint 269 401 13.1904 16.4880 24.7319 27.4252 Constraint 239 384 10.3781 12.9727 19.4590 27.4199 Constraint 290 426 13.5416 16.9270 25.3906 27.4080 Constraint 255 367 10.6847 13.3558 20.0338 27.3977 Constraint 109 255 13.8229 17.2787 25.9180 27.3970 Constraint 120 315 11.2563 14.0704 21.1056 27.3940 Constraint 239 393 10.5473 13.1842 19.7763 27.3896 Constraint 144 261 11.4338 14.2923 21.4384 27.3887 Constraint 144 255 12.2168 15.2710 22.9064 27.3722 Constraint 189 261 12.3533 15.4416 23.1624 27.3685 Constraint 144 277 12.2441 15.3051 22.9576 27.3611 Constraint 120 277 11.1342 13.9178 20.8766 27.3611 Constraint 164 323 14.0933 17.6166 26.4250 27.3529 Constraint 177 255 14.0635 17.5794 26.3690 27.3520 Constraint 109 269 13.0872 16.3590 24.5385 27.3396 Constraint 144 269 10.7795 13.4743 20.2115 27.3372 Constraint 131 269 13.7432 17.1790 25.7685 27.3372 Constraint 93 352 10.3581 12.9477 19.4215 27.3015 Constraint 93 367 12.8685 16.0856 24.1285 27.2976 Constraint 101 384 15.1821 18.9776 28.4665 27.2744 Constraint 93 374 15.2768 19.0960 28.6440 27.2564 Constraint 86 461 11.7105 14.6381 21.9571 27.2476 Constraint 86 177 14.5822 18.2278 27.3417 27.2400 Constraint 86 442 14.6015 18.2519 27.3779 27.2365 Constraint 401 506 13.7514 17.1892 25.7838 26.7035 Constraint 230 484 15.6404 19.5505 29.3257 26.6217 Constraint 323 469 13.4773 16.8467 25.2700 26.6188 Constraint 315 431 13.8963 17.3703 26.0555 26.5629 Constraint 177 493 11.6025 14.5031 21.7546 26.5556 Constraint 152 493 11.4869 14.3586 21.5379 26.5525 Constraint 131 493 10.0567 12.5709 18.8563 26.5525 Constraint 131 239 16.5753 20.7192 31.0787 26.5454 Constraint 120 501 10.2683 12.8353 19.2530 26.5450 Constraint 101 501 11.6698 14.5873 21.8809 26.5450 Constraint 152 409 14.6689 18.3361 27.5042 26.5359 Constraint 269 417 15.1697 18.9621 28.4432 26.5272 Constraint 169 401 8.9998 11.2497 16.8746 26.5232 Constraint 269 374 12.9839 16.2299 24.3448 26.5105 Constraint 269 453 12.9552 16.1940 24.2910 26.4922 Constraint 261 393 13.5589 16.9487 25.4230 26.4897 Constraint 222 352 7.8325 9.7906 14.6860 26.4890 Constraint 144 247 11.6949 14.6187 21.9280 26.4863 Constraint 247 484 14.5252 18.1565 27.2347 26.4822 Constraint 199 330 7.4965 9.3707 14.0560 26.4818 Constraint 115 247 12.8916 16.1146 24.1718 26.4780 Constraint 239 453 12.4354 15.5443 23.3164 26.4764 Constraint 101 323 11.0996 13.8745 20.8118 26.4705 Constraint 199 341 7.2923 9.1153 13.6730 26.4684 Constraint 199 352 7.1511 8.9389 13.4083 26.4664 Constraint 93 199 11.4560 14.3200 21.4801 26.4447 Constraint 247 469 14.2968 17.8710 26.8065 26.4424 Constraint 136 261 13.1518 16.4398 24.6597 26.4213 Constraint 261 374 11.7990 14.7488 22.1232 26.4190 Constraint 261 359 10.8752 13.5940 20.3910 26.4137 Constraint 136 255 13.7592 17.1990 25.7984 26.4048 Constraint 261 384 14.0657 17.5821 26.3731 26.4020 Constraint 115 269 13.1237 16.4046 24.6068 26.3707 Constraint 136 269 12.8384 16.0481 24.0721 26.3372 Constraint 93 341 10.6033 13.2541 19.8811 26.2827 Constraint 93 330 9.0733 11.3416 17.0124 26.2827 Constraint 247 393 11.8414 14.8018 22.2027 26.2499 Constraint 431 516 10.7751 13.4689 20.2033 25.6706 Constraint 426 516 12.3387 15.4234 23.1351 25.6706 Constraint 417 516 14.8138 18.5172 27.7759 25.6706 Constraint 409 516 13.2672 16.5840 24.8760 25.6706 Constraint 230 330 10.4954 13.1192 19.6788 25.6449 Constraint 230 341 9.1684 11.4604 17.1907 25.6295 Constraint 277 431 13.7403 17.1754 25.7631 25.6214 Constraint 255 469 15.2328 19.0409 28.5614 25.6112 Constraint 315 442 15.4669 19.3336 29.0005 25.5957 Constraint 269 367 11.6199 14.5249 21.7874 25.5949 Constraint 308 431 14.7344 18.4180 27.6270 25.5915 Constraint 152 501 15.2131 19.0164 28.5246 25.5776 Constraint 144 501 12.6117 15.7647 23.6470 25.5776 Constraint 239 367 9.4966 11.8707 17.8061 25.5691 Constraint 239 359 8.8372 11.0465 16.5697 25.5691 Constraint 152 367 12.0438 15.0547 22.5821 25.5574 Constraint 152 401 12.0385 15.0481 22.5721 25.5475 Constraint 136 393 15.0984 18.8730 28.3095 25.5187 Constraint 207 476 12.2281 15.2852 22.9278 25.5166 Constraint 136 247 12.8577 16.0722 24.1083 25.5087 Constraint 315 401 15.0376 18.7970 28.1955 25.5064 Constraint 277 374 13.5151 16.8938 25.3407 25.4977 Constraint 255 384 10.9791 13.7238 20.5858 25.4854 Constraint 247 476 15.8285 19.7856 29.6784 25.4545 Constraint 131 261 13.3502 16.6878 25.0317 25.4539 Constraint 93 247 13.4890 16.8612 25.2919 25.4529 Constraint 290 367 13.1485 16.4356 24.6534 25.4527 Constraint 131 255 14.0802 17.6003 26.4005 25.4374 Constraint 222 476 14.4246 18.0307 27.0460 25.4238 Constraint 189 323 8.7007 10.8758 16.3137 25.4233 Constraint 255 341 9.8780 12.3475 18.5213 25.4128 Constraint 93 255 13.7724 17.2155 25.8232 25.4024 Constraint 277 341 9.4615 11.8269 17.7403 25.4018 Constraint 247 374 10.7648 13.4560 20.1840 25.3782 Constraint 255 393 11.1603 13.9504 20.9256 25.3637 Constraint 269 330 10.1928 12.7410 19.1116 25.3576 Constraint 101 290 11.2514 14.0643 21.0964 25.3562 Constraint 86 401 15.1828 18.9786 28.4678 25.3501 Constraint 81 152 13.2372 16.5465 24.8198 25.3457 Constraint 81 144 12.2949 15.3686 23.0529 25.3457 Constraint 81 136 11.9777 14.9722 22.4583 25.3457 Constraint 86 484 9.9487 12.4358 18.6537 25.3170 Constraint 290 359 12.4510 15.5637 23.3456 25.3094 Constraint 93 359 12.4782 15.5977 23.3965 25.3039 Constraint 86 409 16.4582 20.5728 30.8592 25.2951 Constraint 86 352 12.9545 16.1931 24.2897 25.2742 Constraint 86 341 13.8060 17.2575 25.8863 25.2742 Constraint 86 330 12.1110 15.1388 22.7081 25.2742 Constraint 330 501 9.7417 12.1771 18.2657 24.7104 Constraint 330 493 9.0476 11.3095 16.9643 24.7104 Constraint 453 516 12.8757 16.0947 24.1420 24.6929 Constraint 442 516 13.3769 16.7211 25.0817 24.6929 Constraint 277 367 11.8654 14.8317 22.2476 24.6653 Constraint 230 352 8.3532 10.4416 15.6623 24.6546 Constraint 152 417 14.9826 18.7282 28.0924 24.6347 Constraint 255 476 16.4259 20.5324 30.7986 24.6302 Constraint 323 417 15.7657 19.7071 29.5606 24.6060 Constraint 93 230 12.9788 16.2235 24.3352 24.6044 Constraint 169 409 11.3532 14.1915 21.2873 24.5927 Constraint 164 409 11.6859 14.6074 21.9111 24.5880 Constraint 93 239 13.3210 16.6512 24.9768 24.5832 Constraint 207 330 7.7773 9.7216 14.5824 24.5777 Constraint 164 401 9.3022 11.6277 17.4416 24.5773 Constraint 207 341 6.7605 8.4506 12.6759 24.5642 Constraint 207 352 7.4078 9.2598 13.8896 24.5623 Constraint 131 393 16.9910 21.2387 31.8581 24.5437 Constraint 315 461 12.8588 16.0735 24.1102 24.5431 Constraint 93 207 9.4946 11.8682 17.8023 24.5406 Constraint 131 247 13.1209 16.4011 24.6017 24.5311 Constraint 115 501 10.7882 13.4853 20.2280 24.5218 Constraint 290 461 13.4017 16.7522 25.1283 24.5166 Constraint 290 442 16.0809 20.1012 30.1517 24.5058 Constraint 290 453 14.2826 17.8533 26.7800 24.5031 Constraint 247 330 8.2011 10.2514 15.3771 24.5009 Constraint 247 341 8.9521 11.1901 16.7851 24.4855 Constraint 290 409 13.6346 17.0432 25.5648 24.4714 Constraint 152 255 14.3563 17.9454 26.9182 24.4644 Constraint 189 315 10.0212 12.5266 18.7898 24.4479 Constraint 120 308 10.9244 13.6555 20.4833 24.4422 Constraint 115 277 13.3156 16.6445 24.9667 24.4422 Constraint 255 352 9.2156 11.5195 17.2792 24.4379 Constraint 255 330 8.9663 11.2079 16.8118 24.4314 Constraint 189 269 11.7959 14.7448 22.1172 24.4303 Constraint 277 352 10.0131 12.5164 18.7746 24.4268 Constraint 269 341 10.0268 12.5335 18.8002 24.3894 Constraint 81 426 14.5894 18.2368 27.3552 24.3668 Constraint 86 476 12.0594 15.0742 22.6113 24.3571 Constraint 81 164 16.4094 20.5117 30.7675 24.3488 Constraint 109 384 17.9084 22.3854 33.5782 24.3484 Constraint 177 269 12.3800 15.4750 23.2125 24.3415 Constraint 86 431 14.4546 18.0683 27.1024 24.3267 Constraint 374 506 14.6421 18.3027 27.4540 23.8713 Constraint 323 484 11.7543 14.6929 22.0393 23.6759 Constraint 323 476 14.4485 18.0606 27.0909 23.6685 Constraint 164 417 11.5509 14.4387 21.6580 23.6644 Constraint 308 461 13.4785 16.8481 25.2721 23.6567 Constraint 277 469 14.6864 18.3579 27.5369 23.6472 Constraint 261 484 13.6410 17.0512 25.5768 23.6406 Constraint 144 384 13.9998 17.4997 26.2496 23.6309 Constraint 222 493 14.6169 18.2712 27.4067 23.6198 Constraint 169 374 8.4267 10.5334 15.8000 23.6151 Constraint 169 367 9.1138 11.3922 17.0883 23.6151 Constraint 164 367 9.5782 11.9727 17.9591 23.6151 Constraint 277 484 13.0977 16.3721 24.5581 23.5925 Constraint 239 469 14.2187 17.7733 26.6600 23.5877 Constraint 315 453 14.0038 17.5048 26.2572 23.5759 Constraint 290 401 14.1491 17.6864 26.5295 23.5664 Constraint 169 493 13.1746 16.4682 24.7024 23.5619 Constraint 164 493 11.6881 14.6102 21.9153 23.5619 Constraint 152 247 13.8724 17.3405 26.0108 23.5581 Constraint 247 352 8.2876 10.3595 15.5392 23.5106 Constraint 93 493 9.0818 11.3522 17.0283 23.4956 Constraint 144 315 10.4664 13.0830 19.6245 23.4928 Constraint 136 315 12.7346 15.9182 23.8774 23.4928 Constraint 131 315 14.0038 17.5048 26.2571 23.4928 Constraint 152 261 13.4747 16.8434 25.2651 23.4840 Constraint 261 341 10.6552 13.3190 19.9786 23.4794 Constraint 144 308 10.8457 13.5571 20.3356 23.4750 Constraint 136 308 13.1225 16.4031 24.6047 23.4750 Constraint 136 277 13.5795 16.9743 25.4615 23.4748 Constraint 177 261 13.2489 16.5611 24.8417 23.4684 Constraint 109 277 12.6665 15.8331 23.7497 23.4613 Constraint 269 352 10.1408 12.6760 19.0140 23.4144 Constraint 81 352 13.6969 17.1211 25.6816 23.3892 Constraint 86 189 12.7524 15.9405 23.9108 23.3852 Constraint 152 269 12.8028 16.0035 24.0052 23.3705 Constraint 86 469 13.4722 16.8402 25.2604 23.3603 Constraint 367 506 11.7841 14.7302 22.0953 22.8937 Constraint 230 493 15.7071 19.6339 29.4509 22.7526 Constraint 341 501 10.9331 13.6663 20.4995 22.7337 Constraint 341 493 10.7500 13.4375 20.1563 22.7337 Constraint 169 417 11.3746 14.2183 21.3275 22.6914 Constraint 214 493 12.6731 15.8414 23.7621 22.6854 Constraint 269 384 14.2214 17.7767 26.6650 22.6581 Constraint 239 330 10.9967 13.7459 20.6188 22.6502 Constraint 144 393 13.7626 17.2033 25.8049 22.6425 Constraint 239 341 10.3086 12.8857 19.3286 22.6348 Constraint 277 442 14.9734 18.7168 28.0752 22.6338 Constraint 214 323 9.6177 12.0222 18.0332 22.6262 Constraint 239 484 14.5901 18.2376 27.3565 22.6154 Constraint 136 384 14.7053 18.3816 27.5724 22.6132 Constraint 131 384 17.5282 21.9102 32.8653 22.6132 Constraint 189 493 11.1011 13.8763 20.8145 22.6081 Constraint 230 476 15.4664 19.3331 28.9996 22.6009 Constraint 169 501 16.3626 20.4532 30.6799 22.5870 Constraint 136 501 11.1220 13.9025 20.8538 22.5870 Constraint 131 501 13.0830 16.3537 24.5306 22.5870 Constraint 109 501 12.4673 15.5841 23.3762 22.5870 Constraint 269 484 12.4604 15.5755 23.3632 22.5831 Constraint 222 323 11.4767 14.3459 21.5189 22.5769 Constraint 290 484 14.0864 17.6080 26.4121 22.5559 Constraint 101 315 11.8664 14.8329 22.2494 22.5403 Constraint 115 315 13.8118 17.2648 25.8972 22.5386 Constraint 207 315 10.1547 12.6933 19.0400 22.5311 Constraint 199 315 9.8276 12.2845 18.4268 22.5311 Constraint 239 374 8.6999 10.8748 16.3122 22.5304 Constraint 214 315 10.2293 12.7866 19.1799 22.5095 Constraint 152 277 13.6549 17.0686 25.6028 22.5074 Constraint 131 277 13.7666 17.2082 25.8123 22.5074 Constraint 177 315 10.4489 13.0611 19.5917 22.5053 Constraint 261 352 9.5838 11.9797 17.9695 22.5045 Constraint 73 152 15.2291 19.0364 28.5546 22.4203 Constraint 73 144 13.4917 16.8646 25.2969 22.4203 Constraint 73 136 12.7159 15.8949 23.8424 22.4203 Constraint 73 131 11.8016 14.7520 22.1279 22.4203 Constraint 86 367 14.3380 17.9225 26.8837 22.4103 Constraint 81 341 13.7716 17.2145 25.8218 22.3923 Constraint 81 330 11.7141 14.6427 21.9640 22.3923 Constraint 81 169 18.0259 22.5324 33.7986 22.3699 Constraint 93 393 15.0442 18.8052 28.2078 22.2868 Constraint 177 393 10.7477 13.4346 20.1519 21.7190 Constraint 164 374 9.4242 11.7802 17.6703 21.7138 Constraint 152 374 11.7835 14.7294 22.0941 21.7138 Constraint 214 501 14.3446 17.9308 26.8962 21.7104 Constraint 269 393 14.8836 18.6045 27.9067 21.6697 Constraint 222 501 15.4525 19.3156 28.9734 21.6673 Constraint 239 352 9.4799 11.8498 17.7747 21.6599 Constraint 277 401 12.4928 15.6160 23.4239 21.6588 Constraint 296 469 16.2886 20.3607 30.5411 21.6540 Constraint 296 461 13.7453 17.1817 25.7725 21.6540 Constraint 261 469 13.4908 16.8635 25.2952 21.6448 Constraint 296 431 14.6070 18.2588 27.3881 21.6432 Constraint 296 426 13.0263 16.2829 24.4243 21.6432 Constraint 296 453 14.3849 17.9811 26.9716 21.6406 Constraint 296 367 12.6391 15.7989 23.6983 21.6400 Constraint 277 417 14.8270 18.5337 27.8005 21.6399 Constraint 277 384 14.0677 17.5847 26.3770 21.6372 Constraint 230 469 13.9643 17.4554 26.1831 21.6031 Constraint 199 323 8.7161 10.8952 16.3427 21.5846 Constraint 86 214 13.0448 16.3060 24.4591 21.5743 Constraint 290 431 13.5653 16.9566 25.4349 21.5692 Constraint 115 308 13.1217 16.4021 24.6031 21.5421 Constraint 214 308 12.0377 15.0471 22.5706 21.5345 Constraint 86 222 13.8212 17.2765 25.9148 21.5311 Constraint 222 315 11.5100 14.3876 21.5813 21.5285 Constraint 189 308 9.8267 12.2833 18.4250 21.5243 Constraint 177 247 12.5448 15.6809 23.5214 21.5145 Constraint 93 261 11.4771 14.3464 21.5196 21.5095 Constraint 144 296 12.2106 15.2633 22.8950 21.5074 Constraint 120 296 11.1174 13.8967 20.8451 21.5074 Constraint 115 296 13.5552 16.9440 25.4161 21.5074 Constraint 101 296 10.7215 13.4019 20.1029 21.5074 Constraint 189 277 11.8684 14.8355 22.2533 21.5065 Constraint 222 308 13.7618 17.2023 25.8035 21.5064 Constraint 199 269 10.6016 13.2520 19.8780 21.5062 Constraint 261 330 9.0045 11.2556 16.8834 21.5011 Constraint 109 393 17.2724 21.5905 32.3857 21.4822 Constraint 308 401 15.3509 19.1886 28.7829 21.4684 Constraint 109 290 12.3447 15.4309 23.1464 21.4662 Constraint 93 277 12.7440 15.9300 23.8951 21.4614 Constraint 93 290 12.4909 15.6137 23.4205 21.4132 Constraint 169 323 12.7882 15.9852 23.9778 21.4129 Constraint 93 384 14.7303 18.4129 27.6193 21.3462 Constraint 401 516 15.6412 19.5515 29.3273 20.7480 Constraint 315 469 14.6091 18.2614 27.3921 20.7361 Constraint 359 506 12.5592 15.6990 23.5485 20.7027 Constraint 177 501 13.1153 16.3941 24.5912 20.6828 Constraint 296 484 13.9717 17.4647 26.1970 20.6818 Constraint 296 476 16.7384 20.9230 31.3844 20.6656 Constraint 230 323 12.2201 15.2751 22.9126 20.6655 Constraint 261 476 14.3107 17.8884 26.8325 20.6639 Constraint 269 469 13.7023 17.1278 25.6917 20.6596 Constraint 207 323 9.0976 11.3720 17.0579 20.6299 Constraint 207 308 11.9090 14.8862 22.3293 20.5852 Constraint 101 308 10.6964 13.3704 20.0557 20.5689 Constraint 247 323 11.0397 13.7996 20.6994 20.5637 Constraint 255 315 11.5294 14.4118 21.6177 20.5377 Constraint 199 277 11.5558 14.4448 21.6672 20.5324 Constraint 152 308 11.8073 14.7591 22.1387 20.5321 Constraint 131 308 12.9069 16.1337 24.2005 20.5321 Constraint 222 296 11.6938 14.6173 21.9259 20.5289 Constraint 86 199 14.3573 17.9466 26.9199 20.5275 Constraint 93 501 9.9514 12.4392 18.6589 20.5269 Constraint 81 461 12.9080 16.1349 24.2024 20.4981 Constraint 81 453 12.2514 15.3143 22.9715 20.4981 Constraint 81 431 15.9422 19.9278 29.8917 20.4897 Constraint 222 290 11.5892 14.4866 21.7298 20.4884 Constraint 120 290 10.0664 12.5830 18.8744 20.4837 Constraint 93 269 12.4129 15.5162 23.2742 20.4636 Constraint 81 177 15.1538 18.9423 28.4134 20.4509 Constraint 177 277 12.6550 15.8188 23.7282 20.4487 Constraint 73 352 12.9961 16.2451 24.3677 20.4446 Constraint 73 341 12.9272 16.1590 24.2384 20.4446 Constraint 73 330 11.4323 14.2904 21.4356 20.4446 Constraint 73 426 13.4928 16.8660 25.2990 20.4414 Constraint 367 516 13.6678 17.0848 25.6271 19.9296 Constraint 393 506 14.9241 18.6551 27.9827 19.8916 Constraint 384 506 13.3467 16.6834 25.0251 19.8916 Constraint 308 453 13.6022 17.0027 25.5041 19.7465 Constraint 169 384 11.1913 13.9891 20.9837 19.7370 Constraint 164 384 12.6417 15.8021 23.7031 19.7370 Constraint 152 384 15.5321 19.4151 29.1227 19.7370 Constraint 207 493 13.5322 16.9152 25.3728 19.7345 Constraint 169 393 9.8508 12.3136 18.4703 19.7263 Constraint 277 476 14.9438 18.6797 28.0196 19.7158 Constraint 177 384 10.1205 12.6506 18.9760 19.7141 Constraint 199 493 11.9434 14.9293 22.3939 19.7115 Constraint 269 476 14.6005 18.2507 27.3760 19.6786 Constraint 86 230 15.5007 19.3759 29.0638 19.6660 Constraint 239 476 14.7691 18.4614 27.6920 19.6627 Constraint 308 409 14.1478 17.6847 26.5270 19.6203 Constraint 199 308 11.2128 14.0160 21.0239 19.6075 Constraint 207 277 10.8834 13.6043 20.4064 19.6059 Constraint 164 501 14.2658 17.8322 26.7483 19.5935 Constraint 152 315 11.7277 14.6596 21.9895 19.5826 Constraint 214 290 11.8586 14.8233 22.2349 19.5787 Constraint 214 296 11.3950 14.2438 21.3656 19.5761 Constraint 230 296 12.2729 15.3411 23.0116 19.5743 Constraint 230 315 12.2555 15.3194 22.9791 19.5729 Constraint 169 247 14.9553 18.6941 28.0412 19.5485 Constraint 255 323 12.2291 15.2864 22.9296 19.5446 Constraint 86 261 13.4757 16.8446 25.2669 19.5377 Constraint 177 308 9.9034 12.3792 18.5688 19.5342 Constraint 81 367 15.1167 18.8958 28.3438 19.5283 Constraint 86 493 10.6702 13.3377 20.0066 19.5269 Constraint 81 476 13.6809 17.1012 25.6518 19.5232 Constraint 81 469 15.2098 19.0122 28.5184 19.5232 Constraint 169 277 16.0757 20.0946 30.1420 19.4633 Constraint 169 269 14.7688 18.4611 27.6916 19.4393 Constraint 86 359 14.0098 17.5123 26.2684 19.4167 Constraint 315 476 15.0676 18.8345 28.2518 18.7741 Constraint 315 484 12.2809 15.3511 23.0266 18.7707 Constraint 164 393 11.4175 14.2719 21.4078 18.7486 Constraint 152 393 14.6279 18.2849 27.4274 18.7486 Constraint 152 230 15.5075 19.3844 29.0766 18.7415 Constraint 189 501 12.6135 15.7668 23.6503 18.7310 Constraint 131 230 15.1092 18.8865 28.3297 18.6957 Constraint 308 442 14.5384 18.1731 27.2596 18.6879 Constraint 296 374 13.5098 16.8873 25.3309 18.6522 Constraint 86 207 12.6182 15.7727 23.6590 18.6234 Constraint 290 476 15.6154 19.5193 29.2789 18.6156 Constraint 261 323 11.9197 14.8996 22.3494 18.6086 Constraint 290 469 14.6652 18.3315 27.4972 18.5979 Constraint 109 308 12.1051 15.1313 22.6970 18.5978 Constraint 109 315 13.3621 16.7026 25.0540 18.5974 Constraint 164 247 13.9377 17.4221 26.1331 18.5909 Constraint 136 296 12.9205 16.1507 24.2260 18.5885 Constraint 109 296 12.3530 15.4413 23.1619 18.5885 Constraint 81 493 12.1445 15.1806 22.7709 18.5814 Constraint 199 290 13.7837 17.2296 25.8445 18.5795 Constraint 239 315 12.5226 15.6533 23.4799 18.5760 Constraint 169 261 14.9883 18.7354 28.1030 18.5711 Constraint 247 315 10.9627 13.7034 20.5552 18.5598 Constraint 93 323 10.1339 12.6674 19.0011 18.5529 Constraint 115 290 11.6724 14.5904 21.8857 18.5489 Constraint 86 255 13.9277 17.4096 26.1144 18.5485 Constraint 81 484 11.0351 13.7939 20.6908 18.5456 Constraint 86 277 14.2840 17.8549 26.7824 18.5147 Constraint 164 269 13.0846 16.3558 24.5337 18.4985 Constraint 81 442 15.1920 18.9900 28.4850 18.4954 Constraint 323 501 8.9930 11.2412 16.8618 17.8690 Constraint 323 493 9.4930 11.8663 17.7994 17.8690 Constraint 352 506 8.8596 11.0746 16.6118 17.8072 Constraint 341 506 9.8123 12.2654 18.3981 17.7943 Constraint 330 506 9.7563 12.1954 18.2932 17.7943 Constraint 247 493 13.1073 16.3842 24.5762 17.7254 Constraint 290 417 14.4679 18.0849 27.1273 17.7105 Constraint 290 374 12.2131 15.2663 22.8995 17.6938 Constraint 152 506 14.6628 18.3285 27.4927 17.6864 Constraint 144 506 11.9664 14.9580 22.4370 17.6864 Constraint 136 506 11.7159 14.6448 21.9673 17.6864 Constraint 131 506 13.7901 17.2377 25.8565 17.6864 Constraint 120 506 9.8548 12.3184 18.4777 17.6864 Constraint 109 506 13.9497 17.4371 26.1556 17.6864 Constraint 101 506 12.0742 15.0927 22.6391 17.6864 Constraint 239 323 12.5169 15.6461 23.4691 17.6739 Constraint 86 239 14.4241 18.0302 27.0453 17.6692 Constraint 296 442 15.3609 19.2012 28.8017 17.6558 Constraint 296 409 12.3499 15.4373 23.1560 17.6558 Constraint 164 255 14.4381 18.0476 27.0715 17.6529 Constraint 207 290 13.5580 16.9474 25.4212 17.6249 Constraint 152 296 12.8981 16.1226 24.1839 17.6001 Constraint 164 261 13.0814 16.3518 24.5276 17.6001 Constraint 86 247 13.4667 16.8334 25.2501 17.5990 Constraint 247 308 13.9739 17.4673 26.2010 17.5849 Constraint 86 501 12.0879 15.1098 22.6647 17.5846 Constraint 73 461 11.4643 14.3303 21.4955 17.5728 Constraint 152 290 12.3655 15.4569 23.1853 17.5605 Constraint 144 290 9.8747 12.3433 18.5150 17.5605 Constraint 136 290 11.3031 14.1288 21.1932 17.5605 Constraint 86 323 13.5063 16.8829 25.3244 17.5404 Constraint 73 442 14.4134 18.0168 27.0252 17.5392 Constraint 81 189 12.0692 15.0865 22.6298 17.5202 Constraint 73 177 15.6740 19.5925 29.3887 17.4761 Constraint 73 164 16.9795 21.2244 31.8366 17.4299 Constraint 86 417 15.8628 19.8285 29.7428 17.3725 Constraint 384 516 14.9789 18.7236 28.0854 16.9275 Constraint 230 501 15.6687 19.5859 29.3789 16.8808 Constraint 239 493 14.6980 18.3725 27.5587 16.8557 Constraint 255 493 13.4310 16.7888 25.1832 16.8301 Constraint 261 493 12.3618 15.4522 23.1783 16.8296 Constraint 269 493 12.7434 15.9293 23.8939 16.8249 Constraint 277 393 13.6763 17.0954 25.6431 16.7698 Constraint 247 501 13.3480 16.6850 25.0275 16.7505 Constraint 177 506 12.0785 15.0981 22.6471 16.7358 Constraint 290 384 13.2860 16.6075 24.9112 16.7328 Constraint 308 484 10.7692 13.4615 20.1923 16.7070 Constraint 189 296 12.0873 15.1091 22.6636 16.7012 Constraint 207 296 10.8264 13.5330 20.2995 16.6905 Constraint 199 296 11.3709 14.2136 21.3205 16.6905 Constraint 81 214 12.3114 15.3892 23.0838 16.6882 Constraint 81 222 12.8760 16.0950 24.1426 16.6450 Constraint 73 484 10.3874 12.9842 19.4763 16.5978 Constraint 81 255 12.3327 15.4159 23.1239 16.5960 Constraint 131 296 12.5202 15.6503 23.4754 16.5948 Constraint 164 315 12.1806 15.2258 22.8387 16.5920 Constraint 81 323 13.1817 16.4772 24.7157 16.5869 Constraint 73 323 12.0874 15.1093 22.6639 16.5869 Constraint 73 367 13.8221 17.2776 25.9164 16.5806 Constraint 73 453 11.0722 13.8402 20.7604 16.5728 Constraint 73 431 14.1289 17.6611 26.4916 16.5424 Constraint 86 269 13.4899 16.8623 25.2935 16.5365 Constraint 81 359 14.4225 18.0281 27.0422 16.5348 Constraint 86 290 13.3050 16.6312 24.9469 16.4893 Constraint 199 501 13.5001 16.8751 25.3127 15.8344 Constraint 359 516 13.0076 16.2595 24.3892 15.8322 Constraint 315 417 14.7205 18.4007 27.6010 15.7873 Constraint 290 493 11.7150 14.6438 21.9657 15.7857 Constraint 308 476 13.9940 17.4925 26.2387 15.7294 Constraint 308 469 14.0561 17.5701 26.3551 15.7294 Constraint 308 417 15.2516 19.0645 28.5968 15.7245 Constraint 230 308 13.6207 17.0259 25.5389 15.6613 Constraint 177 296 11.2258 14.0323 21.0484 15.6517 Constraint 81 501 12.4984 15.6230 23.4345 15.6498 Constraint 81 247 11.5852 14.4815 21.7223 15.6465 Constraint 93 308 11.0494 13.8118 20.7176 15.6450 Constraint 81 199 14.3501 17.9376 26.9064 15.6414 Constraint 81 277 12.3805 15.4756 23.2134 15.6340 Constraint 81 261 11.4453 14.3066 21.4599 15.6293 Constraint 169 315 11.8839 14.8548 22.2822 15.6036 Constraint 73 476 12.4639 15.5799 23.3698 15.5978 Constraint 65 136 13.3594 16.6993 25.0489 15.5953 Constraint 65 131 13.2018 16.5023 24.7534 15.5953 Constraint 81 290 13.0221 16.2776 24.4164 15.5858 Constraint 73 189 12.7720 15.9651 23.9476 15.5455 Constraint 374 516 15.1145 18.8931 28.3396 15.0574 Constraint 277 501 13.2154 16.5192 24.7788 14.8845 Constraint 277 493 11.8602 14.8253 22.2379 14.8845 Constraint 207 501 14.2611 17.8264 26.7396 14.8797 Constraint 255 501 13.5231 16.9039 25.3559 14.8583 Constraint 214 506 13.3139 16.6423 24.9635 14.8505 Constraint 352 516 10.8654 13.5818 20.3727 14.8438 Constraint 341 516 10.0736 12.5920 18.8879 14.8438 Constraint 330 516 10.6034 13.2543 19.8814 14.8438 Constraint 222 506 14.3457 17.9321 26.8982 14.8073 Constraint 296 417 13.9072 17.3840 26.0760 14.7981 Constraint 296 401 11.9331 14.9164 22.3746 14.7751 Constraint 152 516 17.9608 22.4510 33.6765 14.7360 Constraint 144 516 14.9138 18.6423 27.9634 14.7360 Constraint 73 214 12.8781 16.0976 24.1464 14.7134 Constraint 169 506 15.0136 18.7670 28.1505 14.6959 Constraint 164 506 13.6420 17.0525 25.5787 14.6959 Constraint 115 506 10.2502 12.8128 19.2192 14.6959 Constraint 93 315 11.6430 14.5537 21.8305 14.6736 Constraint 73 222 12.8991 16.1238 24.1857 14.6703 Constraint 73 493 10.2958 12.8697 19.3045 14.6694 Constraint 169 255 14.1921 17.7402 26.6102 14.6680 Constraint 86 315 14.1611 17.7014 26.5522 14.6651 Constraint 73 261 11.4594 14.3242 21.4864 14.6516 Constraint 93 296 11.1354 13.9193 20.8789 14.6455 Constraint 81 269 12.6005 15.7506 23.6259 14.6362 Constraint 65 426 13.4347 16.7933 25.1900 14.6164 Constraint 65 359 14.0958 17.6197 26.4296 14.6164 Constraint 65 330 11.3701 14.2127 21.3190 14.6164 Constraint 65 152 16.2244 20.2805 30.4207 14.6164 Constraint 65 144 14.1617 17.7021 26.5532 14.6164 Constraint 169 296 13.7391 17.1739 25.7609 14.6096 Constraint 164 296 13.4641 16.8302 25.2452 14.6096 Constraint 73 469 12.7326 15.9158 23.8737 14.6010 Constraint 81 401 14.7832 18.4790 27.7185 14.5968 Constraint 169 290 12.8585 16.0732 24.1098 14.5699 Constraint 164 290 12.2079 15.2599 22.8899 14.5699 Constraint 131 290 10.3299 12.9124 19.3685 14.5699 Constraint 164 277 13.6648 17.0810 25.6215 14.5654 Constraint 393 516 16.8591 21.0738 31.6108 14.0690 Constraint 230 506 15.5065 19.3831 29.0746 13.9199 Constraint 239 501 14.4877 18.1096 27.1644 13.8871 Constraint 269 501 12.9791 16.2239 24.3358 13.8563 Constraint 315 393 16.1680 20.2100 30.3150 13.8213 Constraint 81 230 13.9625 17.4531 26.1797 13.8011 Constraint 290 501 10.7946 13.4932 20.2398 13.7920 Constraint 189 506 11.7639 14.7049 22.0574 13.7862 Constraint 73 501 10.4984 13.1230 19.6845 13.7020 Constraint 189 290 12.8144 16.0180 24.0271 13.6878 Constraint 73 277 11.6654 14.5818 21.8727 13.6775 Constraint 73 269 12.4237 15.5296 23.2944 13.6585 Constraint 73 290 12.0528 15.0661 22.5991 13.6575 Constraint 73 255 12.4453 15.5566 23.3350 13.6424 Constraint 86 308 12.6028 15.7535 23.6303 13.6388 Constraint 65 352 12.1553 15.1942 22.7912 13.6280 Constraint 65 341 12.0092 15.0114 22.5172 13.6280 Constraint 73 359 12.7617 15.9521 23.9281 13.5871 Constraint 169 308 11.2415 14.0519 21.0778 13.5540 Constraint 164 308 10.7916 13.4895 20.2343 13.5540 Constraint 86 384 16.2829 20.3537 30.5305 13.4401 Constraint 296 501 12.4564 15.5705 23.3558 12.9232 Constraint 296 493 11.9689 14.9611 22.4416 12.9232 Constraint 323 506 9.1325 11.4156 17.1234 12.8918 Constraint 261 501 12.3867 15.4833 23.2250 12.8641 Constraint 290 393 12.8364 16.0455 24.0683 12.8354 Constraint 164 230 15.1921 18.9901 28.4852 12.8121 Constraint 177 516 14.4702 18.0877 27.1316 12.7875 Constraint 81 239 12.7591 15.9489 23.9233 12.7831 Constraint 81 207 11.6617 14.5772 21.8657 12.7584 Constraint 136 516 13.3015 16.6268 24.9402 12.7423 Constraint 131 516 15.9619 19.9523 29.9285 12.7423 Constraint 120 516 11.3353 14.1691 21.2537 12.7423 Constraint 115 516 12.9496 16.1870 24.2806 12.7423 Constraint 109 516 15.7884 19.7355 29.6033 12.7423 Constraint 101 516 13.6147 17.0184 25.5276 12.7423 Constraint 81 315 12.4702 15.5878 23.3817 12.7086 Constraint 65 367 13.2102 16.5127 24.7691 12.7071 Constraint 73 247 11.5842 14.4803 21.7204 12.6929 Constraint 65 461 11.4007 14.2509 21.3763 12.6826 Constraint 65 453 12.1994 15.2493 22.8740 12.6826 Constraint 65 442 14.8178 18.5222 27.7834 12.6826 Constraint 65 431 14.1829 17.7287 26.5930 12.6826 Constraint 73 199 14.2988 17.8736 26.8103 12.6667 Constraint 177 290 11.2764 14.0955 21.1433 12.6657 Constraint 65 409 15.7772 19.7215 29.5822 12.6616 Constraint 58 442 13.8570 17.3213 25.9820 12.6606 Constraint 58 431 13.5000 16.8750 25.3125 12.6606 Constraint 58 426 11.6804 14.6005 21.9007 12.6606 Constraint 58 409 14.8434 18.5542 27.8313 12.6606 Constraint 58 401 14.2638 17.8298 26.7447 12.6606 Constraint 58 367 12.7253 15.9067 23.8600 12.6606 Constraint 58 359 12.1285 15.1607 22.7410 12.6606 Constraint 58 352 10.4324 13.0405 19.5607 12.6606 Constraint 58 341 10.1628 12.7036 19.0553 12.6606 Constraint 58 330 9.1097 11.3872 17.0807 12.6606 Constraint 58 152 13.6880 17.1100 25.6650 12.6606 Constraint 58 144 11.4692 14.3364 21.5047 12.6606 Constraint 58 136 10.9178 13.6472 20.4708 12.6606 Constraint 58 131 10.9654 13.7068 20.5602 12.6606 Constraint 58 120 7.2032 9.0041 13.5061 12.6606 Constraint 86 296 12.7519 15.9399 23.9099 12.6518 Constraint 65 177 16.3021 20.3776 30.5665 12.6207 Constraint 86 374 14.7645 18.4556 27.6835 12.4951 Constraint 86 393 15.6050 19.5062 29.2594 12.4939 Constraint 431 525 10.1090 12.6362 18.9543 11.9991 Constraint 426 525 11.1962 13.9953 20.9930 11.9991 Constraint 315 501 10.2303 12.7879 19.1818 11.9715 Constraint 315 493 9.5183 11.8979 17.8469 11.9715 Constraint 239 506 14.9825 18.7281 28.0922 11.9231 Constraint 214 516 15.1868 18.9835 28.4753 11.9001 Constraint 269 506 13.5595 16.9494 25.4241 11.8923 Constraint 199 506 12.1144 15.1430 22.7145 11.8780 Constraint 308 501 9.9018 12.3773 18.5660 11.8715 Constraint 308 493 8.9784 11.2230 16.8345 11.8715 Constraint 222 516 15.3617 19.2021 28.8031 11.8569 Constraint 296 384 11.7033 14.6291 21.9436 11.8385 Constraint 73 230 14.3194 17.8993 26.8489 11.8263 Constraint 73 239 13.4215 16.7768 25.1652 11.8052 Constraint 247 506 13.1218 16.4023 24.6034 11.7962 Constraint 239 308 12.6402 15.8002 23.7003 11.7651 Constraint 81 296 11.3556 14.1945 21.2917 11.7456 Constraint 164 516 15.8043 19.7554 29.6331 11.7444 Constraint 73 315 11.5760 14.4700 21.7049 11.7310 Constraint 65 323 11.4166 14.2707 21.4061 11.7198 Constraint 81 308 10.9989 13.7486 20.6229 11.7117 Constraint 93 506 9.7359 12.1699 18.2549 11.7104 Constraint 65 484 11.2396 14.0495 21.0742 11.7076 Constraint 58 461 10.5041 13.1301 19.6952 11.6942 Constraint 58 453 10.4818 13.1023 19.6534 11.6942 Constraint 58 417 15.6519 19.5649 29.3473 11.6942 Constraint 58 374 14.6130 18.2662 27.3994 11.6942 Constraint 47 426 10.6192 13.2740 19.9111 11.6932 Constraint 47 401 13.6607 17.0759 25.6138 11.6932 Constraint 47 367 12.4612 15.5765 23.3648 11.6932 Constraint 47 359 11.7596 14.6995 22.0493 11.6932 Constraint 47 352 10.4084 13.0104 19.5157 11.6932 Constraint 47 341 9.7998 12.2497 18.3745 11.6932 Constraint 47 330 9.5787 11.9734 17.9601 11.6932 Constraint 47 152 15.9372 19.9215 29.8823 11.6932 Constraint 47 144 13.1774 16.4718 24.7077 11.6932 Constraint 47 136 12.3615 15.4518 23.1777 11.6932 Constraint 47 131 13.3524 16.6904 25.0357 11.6932 Constraint 47 120 8.9932 11.2416 16.8623 11.6932 Constraint 47 115 10.0032 12.5040 18.7560 11.6932 Constraint 73 374 14.0601 17.5752 26.3627 11.5943 Constraint 461 525 8.8108 11.0135 16.5202 11.0215 Constraint 453 525 12.1540 15.1925 22.7887 11.0215 Constraint 442 525 12.5896 15.7370 23.6055 11.0215 Constraint 207 506 13.6804 17.1005 25.6507 10.9233 Constraint 239 516 15.4521 19.3151 28.9726 10.9231 Constraint 277 506 13.3315 16.6644 24.9967 10.9039 Constraint 255 506 13.5122 16.8902 25.3354 10.9009 Constraint 261 506 13.4804 16.8505 25.2758 10.9004 Constraint 269 516 14.4332 18.0415 27.0623 10.8954 Constraint 323 516 9.1402 11.4253 17.1379 10.8950 Constraint 290 506 12.2724 15.3405 23.0107 10.8545 Constraint 169 239 15.8152 19.7690 29.6535 10.8449 Constraint 189 516 14.2745 17.8431 26.7647 10.8358 Constraint 308 384 14.4243 18.0303 27.0455 10.8157 Constraint 247 516 14.0259 17.5324 26.2986 10.7962 Constraint 73 296 10.7798 13.4747 20.2121 10.7950 Constraint 73 207 11.6937 14.6172 21.9257 10.7837 Constraint 65 261 11.5839 14.4799 21.7199 10.7751 Constraint 65 501 9.1975 11.4969 17.2454 10.7582 Constraint 65 493 9.6823 12.1029 18.1543 10.7582 Constraint 93 516 11.5783 14.4729 21.7094 10.7568 Constraint 65 401 14.6084 18.2605 27.3908 10.7513 Constraint 65 476 13.0803 16.3503 24.5255 10.7402 Constraint 65 469 12.8321 16.0401 24.0601 10.7402 Constraint 73 308 9.7085 12.1356 18.2034 10.7341 Constraint 47 461 8.4862 10.6077 15.9115 10.7268 Constraint 47 453 9.5455 11.9318 17.8978 10.7268 Constraint 47 442 11.5860 14.4825 21.7237 10.7268 Constraint 47 431 10.7009 13.3762 20.0643 10.7268 Constraint 47 417 13.7671 17.2089 25.8133 10.7268 Constraint 47 409 12.7098 15.8872 23.8309 10.7268 Constraint 47 384 15.2395 19.0494 28.5741 10.7268 Constraint 47 374 14.1313 17.6642 26.4962 10.7268 Constraint 58 484 10.9412 13.6766 20.5148 10.7192 Constraint 81 506 14.0044 17.5054 26.2582 10.7104 Constraint 65 164 17.3156 21.6445 32.4668 10.6859 Constraint 65 189 13.8916 17.3645 26.0467 10.6690 Constraint 73 401 12.2962 15.3703 23.0554 10.6269 Constraint 81 374 14.8758 18.5947 27.8920 10.6104 Constraint 73 409 13.8578 17.3223 25.9835 10.5974 Constraint 81 384 16.4560 20.5700 30.8550 10.5510 Constraint 417 525 12.1167 15.1459 22.7188 10.0049 Constraint 409 525 10.2417 12.8021 19.2032 10.0049 Constraint 296 393 11.8206 14.7758 22.1637 9.9332 Constraint 277 516 14.0585 17.5731 26.3597 9.9070 Constraint 255 516 14.2502 17.8127 26.7190 9.9040 Constraint 290 516 12.1404 15.1755 22.7632 9.8576 Constraint 58 169 15.3921 19.2401 28.8601 9.8040 Constraint 58 164 14.3176 17.8970 26.8455 9.8040 Constraint 39 426 8.1459 10.1823 15.2735 9.7902 Constraint 39 367 9.8147 12.2683 18.4025 9.7902 Constraint 39 359 8.9602 11.2002 16.8004 9.7902 Constraint 39 352 7.3951 9.2438 13.8658 9.7902 Constraint 39 341 7.4773 9.3466 14.0200 9.7902 Constraint 39 330 6.9971 8.7464 13.1196 9.7902 Constraint 39 144 9.9340 12.4176 18.6263 9.7902 Constraint 39 136 8.8742 11.0928 16.6391 9.7902 Constraint 39 131 11.2831 14.1039 21.1558 9.7902 Constraint 39 120 6.6839 8.3549 12.5324 9.7902 Constraint 39 115 8.7168 10.8960 16.3440 9.7902 Constraint 47 323 8.8751 11.0939 16.6408 9.7850 Constraint 65 269 12.1500 15.1875 22.7812 9.7786 Constraint 58 501 9.7154 12.1442 18.2163 9.7698 Constraint 58 493 9.2062 11.5078 17.2617 9.7698 Constraint 65 255 12.2485 15.3106 22.9660 9.7648 Constraint 65 247 11.3554 14.1943 21.2915 9.7648 Constraint 81 516 16.3166 20.3958 30.5936 9.7568 Constraint 58 476 12.2209 15.2761 22.9142 9.7518 Constraint 58 469 12.4020 15.5025 23.2537 9.7518 Constraint 47 484 10.1564 12.6955 19.0433 9.7518 Constraint 47 476 11.4732 14.3415 21.5123 9.7518 Constraint 47 469 10.4660 13.0824 19.6237 9.7518 Constraint 81 409 14.4983 18.1228 27.1843 9.6457 Constraint 401 525 13.1473 16.4342 24.6512 9.0273 Constraint 393 525 15.1572 18.9465 28.4198 9.0273 Constraint 384 525 13.5260 16.9074 25.3612 9.0273 Constraint 374 525 14.3281 17.9101 26.8651 9.0273 Constraint 308 393 14.7176 18.3970 27.5955 8.9560 Constraint 230 516 14.5460 18.1825 27.2737 8.9317 Constraint 152 239 13.2638 16.5798 24.8696 8.8515 Constraint 58 323 7.4335 9.2918 13.9377 8.8493 Constraint 47 169 16.1034 20.1292 30.1938 8.8366 Constraint 47 164 15.3015 19.1269 28.6903 8.8366 Constraint 39 169 12.3215 15.4019 23.1028 8.8366 Constraint 39 164 11.8011 14.7514 22.1271 8.8366 Constraint 39 152 12.5472 15.6841 23.5261 8.8366 Constraint 39 323 8.6074 10.7593 16.1389 8.8355 Constraint 39 461 6.1157 7.6446 11.4669 8.8237 Constraint 39 453 8.0099 10.0124 15.0186 8.8237 Constraint 39 442 10.4079 13.0099 19.5149 8.8237 Constraint 39 431 8.4221 10.5276 15.7914 8.8237 Constraint 39 417 11.8270 14.7838 22.1757 8.8237 Constraint 39 409 9.8584 12.3230 18.4845 8.8237 Constraint 39 401 10.5070 13.1338 19.7007 8.8237 Constraint 39 393 13.4235 16.7794 25.1691 8.8237 Constraint 39 384 12.3549 15.4436 23.1655 8.8237 Constraint 39 374 10.9572 13.6965 20.5447 8.8237 Constraint 39 109 10.8738 13.5922 20.3883 8.8237 Constraint 58 177 12.3959 15.4949 23.2423 8.8061 Constraint 86 516 14.4939 18.1174 27.1762 8.8032 Constraint 86 506 11.4683 14.3354 21.5031 8.8032 Constraint 47 501 6.2933 7.8666 11.7999 8.8024 Constraint 47 493 7.8088 9.7610 14.6415 8.8024 Constraint 65 290 10.1429 12.6786 19.0179 8.7997 Constraint 65 277 11.3556 14.1946 21.2918 8.7997 Constraint 65 214 11.5998 14.4998 21.7496 8.7759 Constraint 73 506 12.4627 15.5784 23.3676 8.7133 Constraint 58 189 11.0978 13.8722 20.8084 8.7132 Constraint 81 393 14.9728 18.7160 28.0740 8.6456 Constraint 73 384 13.3030 16.6288 24.9432 8.6339 Constraint 367 525 12.2597 15.3246 22.9869 8.0496 Constraint 352 525 11.9190 14.8988 22.3482 7.9948 Constraint 296 506 12.2578 15.3222 22.9834 7.9932 Constraint 315 506 9.0972 11.3715 17.0573 7.9922 Constraint 199 516 13.9612 17.4515 26.1773 7.9304 Constraint 261 516 13.0879 16.3599 24.5398 7.9098 Constraint 308 506 9.0458 11.3072 16.9608 7.8922 Constraint 65 239 11.7534 14.6917 22.0376 7.8561 Constraint 39 501 7.1403 8.9254 13.3880 7.8488 Constraint 39 493 6.4646 8.0807 12.1211 7.8488 Constraint 39 484 9.2216 11.5269 17.2904 7.8488 Constraint 39 476 11.0698 13.8373 20.7559 7.8488 Constraint 39 469 9.5469 11.9336 17.9005 7.8488 Constraint 65 296 9.3942 11.7428 17.6142 7.8437 Constraint 58 261 8.2170 10.2712 15.4069 7.8404 Constraint 39 177 9.3784 11.7230 17.5845 7.8387 Constraint 65 315 11.1385 13.9231 20.8847 7.8207 Constraint 58 255 9.5294 11.9117 17.8676 7.8090 Constraint 58 247 8.6148 10.7685 16.1527 7.8090 Constraint 65 308 10.0222 12.5278 18.7917 7.8037 Constraint 58 308 10.6362 13.2953 19.9429 7.8028 Constraint 65 417 15.3076 19.1345 28.7017 7.7918 Constraint 58 384 14.9376 18.6720 28.0080 7.7918 Constraint 65 222 10.1552 12.6939 19.0409 7.7781 Constraint 65 199 13.8534 17.3168 25.9752 7.7775 Constraint 73 516 14.1120 17.6400 26.4601 7.7597 Constraint 169 516 15.5524 19.4404 29.1607 7.7510 Constraint 47 189 12.1939 15.2423 22.8635 7.7458 Constraint 65 374 13.2456 16.5570 24.8355 7.7299 Constraint 73 417 12.7270 15.9088 23.8632 7.6950 Constraint 73 393 12.8130 16.0163 24.0245 7.6950 Constraint 81 417 13.7671 17.2088 25.8133 7.6707 Constraint 359 525 13.4293 16.7866 25.1799 7.0419 Constraint 341 525 11.5635 14.4544 21.6816 7.0419 Constraint 330 525 12.2125 15.2656 22.8983 7.0419 Constraint 296 516 12.2862 15.3578 23.0367 6.9964 Constraint 315 516 9.2382 11.5477 17.3216 6.9953 Constraint 230 525 15.1388 18.9235 28.3852 6.9463 Constraint 222 525 15.6283 19.5354 29.3031 6.9463 Constraint 214 525 15.6633 19.5791 29.3686 6.9463 Constraint 58 230 11.8261 14.7827 22.1740 6.8981 Constraint 308 516 9.5092 11.8865 17.8297 6.8953 Constraint 47 261 10.7019 13.3774 20.0661 6.8730 Constraint 39 261 9.1534 11.4417 17.1625 6.8730 Constraint 65 230 12.5059 15.6324 23.4486 6.8677 Constraint 58 214 8.0323 10.0403 15.0605 6.8549 Constraint 58 290 6.7290 8.4112 12.6168 6.8439 Constraint 58 277 8.6347 10.7933 16.1900 6.8439 Constraint 58 269 8.6034 10.7543 16.1314 6.8439 Constraint 47 255 12.2695 15.3369 23.0053 6.8416 Constraint 47 247 11.0027 13.7533 20.6300 6.8416 Constraint 39 255 11.5017 14.3772 21.5658 6.8416 Constraint 39 247 9.8427 12.3034 18.4551 6.8416 Constraint 47 214 11.0802 13.8502 20.7754 6.8411 Constraint 47 177 12.0351 15.0438 22.5658 6.8409 Constraint 47 308 11.6254 14.5317 21.7976 6.8354 Constraint 65 207 11.7729 14.7162 22.0743 6.8229 Constraint 58 222 8.9776 11.2219 16.8329 6.8107 Constraint 58 199 10.6977 13.3722 20.0582 6.8101 Constraint 47 506 9.4718 11.8397 17.7596 6.8080 Constraint 65 384 13.2600 16.5750 24.8625 6.7635 Constraint 255 525 11.6417 14.5521 21.8282 6.0003 Constraint 207 516 15.2090 19.0112 28.5169 5.9786 Constraint 207 525 16.6306 20.7883 31.1824 5.9687 Constraint 189 525 15.4355 19.2944 28.9416 5.9457 Constraint 144 525 15.4711 19.3389 29.0083 5.9457 Constraint 120 525 13.1717 16.4646 24.6968 5.9457 Constraint 101 525 15.1639 18.9549 28.4324 5.9457 Constraint 39 230 12.5584 15.6980 23.5470 5.9307 Constraint 199 525 14.5612 18.2015 27.3023 5.9262 Constraint 247 525 13.3906 16.7383 25.1075 5.9041 Constraint 58 239 9.6242 12.0302 18.0453 5.9003 Constraint 58 315 6.8501 8.5626 12.8439 5.8997 Constraint 58 296 7.4861 9.3577 14.0365 5.8879 Constraint 39 214 8.5177 10.6471 15.9706 5.8875 Constraint 39 308 12.4438 15.5547 23.3320 5.8859 Constraint 47 290 8.3161 10.3952 15.5927 5.8765 Constraint 47 277 11.2260 14.0325 21.0487 5.8765 Constraint 47 269 11.7463 14.6829 22.0244 5.8765 Constraint 39 290 8.7900 10.9875 16.4812 5.8765 Constraint 39 277 10.8844 13.6055 20.4083 5.8765 Constraint 39 269 10.4922 13.1153 19.6730 5.8765 Constraint 47 516 8.9601 11.2002 16.8002 5.8544 Constraint 39 506 7.5456 9.4320 14.1480 5.8544 Constraint 47 222 10.8494 13.5618 20.3427 5.8433 Constraint 47 199 11.6272 14.5340 21.8010 5.8427 Constraint 39 189 9.5167 11.8959 17.8438 5.8427 Constraint 73 169 17.3135 21.6419 32.4628 5.8247 Constraint 58 393 14.1455 17.6818 26.5228 5.7961 Constraint 277 525 10.7562 13.4453 20.1679 5.0483 Constraint 290 525 11.1502 13.9377 20.9065 5.0030 Constraint 261 525 11.1955 13.9944 20.9917 5.0030 Constraint 164 239 11.3217 14.1521 21.2281 4.9772 Constraint 136 525 14.1106 17.6382 26.4573 4.9489 Constraint 131 525 16.7156 20.8945 31.3417 4.9489 Constraint 115 525 13.6930 17.1162 25.6744 4.9489 Constraint 109 525 16.5179 20.6474 30.9710 4.9489 Constraint 239 525 12.2620 15.3275 22.9912 4.9463 Constraint 47 239 11.1662 13.9578 20.9367 4.9329 Constraint 47 230 12.0687 15.0859 22.6288 4.9329 Constraint 39 239 11.7483 14.6854 22.0280 4.9329 Constraint 47 315 8.6007 10.7509 16.1264 4.9323 Constraint 39 315 9.2821 11.6027 17.4040 4.9323 Constraint 47 296 9.1131 11.3914 17.0871 4.9205 Constraint 39 296 10.6929 13.3662 20.0493 4.9205 Constraint 431 533 12.6475 15.8094 23.7141 4.9099 Constraint 426 533 13.2867 16.6084 24.9126 4.9099 Constraint 417 533 14.6118 18.2647 27.3971 4.9099 Constraint 409 533 11.9698 14.9623 22.4435 4.9099 Constraint 58 207 7.1609 8.9511 13.4266 4.9019 Constraint 65 516 11.0619 13.8273 20.7410 4.9008 Constraint 65 506 9.5646 11.9558 17.9337 4.9008 Constraint 58 516 10.7994 13.4993 20.2489 4.9008 Constraint 58 506 8.7400 10.9250 16.3875 4.9008 Constraint 39 516 7.7630 9.7037 14.5556 4.9008 Constraint 39 222 10.2147 12.7684 19.1526 4.8897 Constraint 39 199 8.4183 10.5229 15.7843 4.8891 Constraint 47 393 11.3503 14.1878 21.2818 4.8287 Constraint 65 393 12.4956 15.6195 23.4293 4.7990 Constraint 315 525 8.0794 10.0993 15.1489 4.0483 Constraint 296 525 9.7067 12.1334 18.2000 4.0483 Constraint 269 525 8.1110 10.1387 15.2081 4.0483 Constraint 323 525 10.7694 13.4618 20.1926 4.0477 Constraint 230 533 15.0817 18.8522 28.2783 3.9553 Constraint 93 525 13.3894 16.7368 25.1051 3.9518 Constraint 177 525 12.7577 15.9471 23.9207 3.9515 Constraint 152 525 17.6793 22.0991 33.1486 3.9515 Constraint 308 525 6.5443 8.1804 12.2706 3.9483 Constraint 47 207 9.0117 11.2646 16.8969 3.9345 Constraint 39 207 8.3449 10.4312 15.6467 3.9345 Constraint 469 533 13.7084 17.1355 25.7032 3.9323 Constraint 461 533 12.9499 16.1874 24.2811 3.9323 Constraint 453 533 15.9606 19.9507 29.9261 3.9323 Constraint 442 533 15.2943 19.1179 28.6768 3.9323 Constraint 401 533 15.0441 18.8051 28.2076 3.9323 Constraint 393 533 16.2134 20.2668 30.4002 3.9323 Constraint 384 533 13.6830 17.1037 25.6556 3.9323 Constraint 374 533 14.2329 17.7912 26.6868 3.9323 Constraint 247 533 12.2135 15.2669 22.9004 3.9099 Constraint 65 169 17.4410 21.8013 32.7019 3.8507 Constraint 214 533 16.6530 20.8162 31.2243 2.9776 Constraint 207 533 17.9736 22.4671 33.7006 2.9776 Constraint 31 461 9.3257 11.6571 17.4857 2.9699 Constraint 31 453 10.8239 13.5299 20.2949 2.9699 Constraint 31 442 12.6873 15.8591 23.7887 2.9699 Constraint 31 431 10.3893 12.9866 19.4799 2.9699 Constraint 31 426 9.5575 11.9469 17.9203 2.9699 Constraint 31 417 13.3301 16.6627 24.9940 2.9699 Constraint 31 409 10.8295 13.5369 20.3054 2.9699 Constraint 31 401 12.1298 15.1623 22.7434 2.9699 Constraint 31 393 13.5107 16.8884 25.3326 2.9699 Constraint 31 384 10.8247 13.5308 20.2962 2.9699 Constraint 31 374 11.1834 13.9792 20.9688 2.9699 Constraint 31 367 9.3671 11.7088 17.5632 2.9699 Constraint 31 359 7.1264 8.9080 13.3620 2.9699 Constraint 31 352 7.2156 9.0195 13.5293 2.9699 Constraint 31 341 5.9973 7.4966 11.2449 2.9699 Constraint 31 330 8.0618 10.0772 15.1158 2.9699 Constraint 31 323 6.9190 8.6488 12.9732 2.9699 Constraint 31 230 13.4688 16.8360 25.2540 2.9699 Constraint 31 169 14.3013 17.8766 26.8150 2.9699 Constraint 31 164 14.0678 17.5848 26.3772 2.9699 Constraint 31 152 13.5331 16.9164 25.3746 2.9699 Constraint 31 144 10.1809 12.7261 19.0892 2.9699 Constraint 31 136 10.4243 13.0304 19.5456 2.9699 Constraint 31 131 12.8413 16.0516 24.0775 2.9699 Constraint 31 120 8.1754 10.2193 15.3289 2.9699 Constraint 31 115 10.7836 13.4795 20.2192 2.9699 Constraint 31 109 12.5790 15.7238 23.5857 2.9699 Constraint 31 101 9.9357 12.4197 18.6295 2.9699 Constraint 277 533 12.5725 15.7156 23.5734 2.9553 Constraint 367 533 12.3836 15.4795 23.2192 2.9547 Constraint 359 533 13.1426 16.4282 24.6424 2.9547 Constraint 352 533 11.9454 14.9317 22.3976 2.9547 Constraint 341 533 12.0213 15.0266 22.5399 2.9547 Constraint 330 533 14.5890 18.2363 27.3544 2.9547 Constraint 199 533 15.4092 19.2615 28.8922 2.9547 Constraint 189 533 16.6542 20.8177 31.2266 2.9547 Constraint 177 533 16.1971 20.2463 30.3695 2.9547 Constraint 169 525 15.9414 19.9268 29.8902 2.9547 Constraint 164 525 15.1814 18.9768 28.4652 2.9547 Constraint 144 533 17.6275 22.0344 33.0516 2.9547 Constraint 136 533 17.3806 21.7258 32.5887 2.9547 Constraint 120 533 15.3174 19.1468 28.7201 2.9547 Constraint 115 533 17.9866 22.4833 33.7249 2.9547 Constraint 101 533 18.5014 23.1268 34.6902 2.9547 Constraint 93 533 17.1443 21.4304 32.1456 2.9547 Constraint 86 525 15.6911 19.6139 29.4208 2.9518 Constraint 290 533 12.2050 15.2562 22.8843 2.9099 Constraint 261 533 12.1113 15.1391 22.7087 2.9099 Constraint 255 533 12.2375 15.2969 22.9453 2.9099 Constraint 476 544 17.6423 22.0528 33.0792 2.0000 Constraint 469 544 13.9216 17.4020 26.1029 2.0000 Constraint 461 544 13.0436 16.3046 24.4568 2.0000 Constraint 453 544 15.7551 19.6939 29.5409 2.0000 Constraint 442 544 14.6622 18.3278 27.4916 2.0000 Constraint 431 544 10.4800 13.1000 19.6500 2.0000 Constraint 426 544 11.8644 14.8305 22.2458 2.0000 Constraint 417 544 12.0498 15.0622 22.5933 2.0000 Constraint 409 544 9.2424 11.5530 17.3295 2.0000 Constraint 401 544 13.5112 16.8890 25.3336 2.0000 Constraint 393 544 13.8469 17.3086 25.9629 2.0000 Constraint 384 544 10.1535 12.6918 19.0378 2.0000 Constraint 374 544 13.6923 17.1154 25.6731 2.0000 Constraint 367 544 11.9948 14.9934 22.4902 2.0000 Constraint 359 544 11.5768 14.4710 21.7065 2.0000 Constraint 352 544 11.9463 14.9329 22.3994 2.0000 Constraint 341 544 11.5243 14.4054 21.6082 2.0000 Constraint 330 544 14.7724 18.4655 27.6983 2.0000 Constraint 230 544 15.7300 19.6625 29.4937 2.0000 Constraint 222 544 17.8778 22.3472 33.5208 2.0000 Constraint 214 544 14.9431 18.6789 28.0183 2.0000 Constraint 207 544 16.1612 20.2014 30.3022 2.0000 Constraint 199 544 14.8068 18.5085 27.7627 2.0000 Constraint 189 544 16.0483 20.0603 30.0905 2.0000 Constraint 177 544 16.0034 20.0043 30.0064 2.0000 Constraint 144 544 15.9263 19.9078 29.8617 2.0000 Constraint 136 544 17.6706 22.0883 33.1324 2.0000 Constraint 120 544 15.0177 18.7721 28.1582 2.0000 Constraint 115 544 18.5195 23.1493 34.7240 2.0000 Constraint 101 544 17.8402 22.3002 33.4503 2.0000 Constraint 93 544 17.8778 22.3473 33.5209 2.0000 Constraint 469 550 15.7597 19.6997 29.5495 1.9971 Constraint 461 550 15.2464 19.0580 28.5871 1.9971 Constraint 442 550 18.3294 22.9117 34.3676 1.9971 Constraint 431 550 15.2367 19.0458 28.5687 1.9971 Constraint 426 550 16.9024 21.1280 31.6920 1.9971 Constraint 359 550 16.9445 21.1807 31.7710 1.9971 Constraint 352 550 15.4776 19.3470 29.0204 1.9971 Constraint 341 550 15.1263 18.9079 28.3619 1.9971 Constraint 330 550 16.0728 20.0911 30.1366 1.9971 Constraint 323 550 15.0007 18.7508 28.1262 1.9971 Constraint 230 550 18.7101 23.3876 35.0814 1.9971 Constraint 214 550 17.8206 22.2758 33.4137 1.9971 Constraint 31 501 8.8793 11.0991 16.6486 1.9950 Constraint 31 493 10.3583 12.9479 19.4218 1.9950 Constraint 31 484 13.7377 17.1722 25.7583 1.9950 Constraint 31 476 15.0724 18.8405 28.2607 1.9950 Constraint 31 469 12.3437 15.4296 23.1445 1.9950 Constraint 31 315 9.3472 11.6840 17.5260 1.9728 Constraint 31 308 10.0485 12.5606 18.8409 1.9728 Constraint 31 296 12.3113 15.3892 23.0837 1.9728 Constraint 31 290 12.1846 15.2307 22.8461 1.9728 Constraint 31 277 9.6103 12.0129 18.0193 1.9728 Constraint 31 269 8.3114 10.3893 15.5839 1.9728 Constraint 31 261 9.9685 12.4606 18.6909 1.9728 Constraint 31 239 12.1729 15.2162 22.8243 1.9720 Constraint 31 222 8.1044 10.1305 15.1958 1.9720 Constraint 31 214 8.7541 10.9427 16.4140 1.9720 Constraint 31 177 9.4495 11.8119 17.7178 1.9720 Constraint 315 533 8.8267 11.0333 16.5500 1.9553 Constraint 308 533 5.5618 6.9523 10.4284 1.9553 Constraint 296 533 10.4138 13.0173 19.5259 1.9553 Constraint 269 533 6.6676 8.3345 12.5018 1.9553 Constraint 239 533 9.7647 12.2059 18.3089 1.9553 Constraint 222 533 14.9327 18.6659 27.9988 1.9553 Constraint 323 533 12.8697 16.0872 24.1308 1.9547 Constraint 81 525 16.2556 20.3195 30.4792 1.9518 Constraint 417 550 15.7360 19.6700 29.5050 1.0000 Constraint 409 550 13.1860 16.4825 24.7237 1.0000 Constraint 401 550 17.5371 21.9213 32.8820 1.0000 Constraint 393 550 17.1141 21.3927 32.0890 1.0000 Constraint 384 550 13.3370 16.6712 25.0069 1.0000 Constraint 374 550 17.3172 21.6465 32.4697 1.0000 Constraint 367 550 16.2042 20.2552 30.3828 1.0000 Constraint 323 544 14.3125 17.8907 26.8360 1.0000 Constraint 277 544 15.8325 19.7906 29.6859 1.0000 Constraint 269 544 18.9799 23.7249 35.5873 1.0000 Constraint 247 550 18.1832 22.7290 34.0935 1.0000 Constraint 247 544 15.7048 19.6310 29.4464 1.0000 Constraint 239 544 19.1507 23.9384 35.9076 1.0000 Constraint 199 550 18.5519 23.1899 34.7848 1.0000 Constraint 484 550 13.0920 16.3651 24.5476 0.9971 Constraint 476 550 15.5726 19.4657 29.1986 0.9971 Constraint 453 550 16.7221 20.9026 31.3539 0.9971 Constraint 239 550 14.8373 18.5467 27.8200 0.9971 Constraint 222 550 16.2400 20.3000 30.4500 0.9971 Constraint 144 550 17.2728 21.5910 32.3864 0.9971 Constraint 136 550 15.1615 18.9519 28.4279 0.9971 Constraint 131 550 16.9639 21.2048 31.8073 0.9971 Constraint 120 550 12.4949 15.6187 23.4280 0.9971 Constraint 115 550 12.1544 15.1930 22.7895 0.9971 Constraint 109 550 14.5599 18.1999 27.2998 0.9971 Constraint 101 550 12.8036 16.0045 24.0068 0.9971 Constraint 93 550 8.9936 11.2420 16.8631 0.9971 Constraint 86 550 11.3221 14.1526 21.2289 0.9971 Constraint 81 550 13.6637 17.0796 25.6195 0.9971 Constraint 73 550 9.4292 11.7865 17.6797 0.9971 Constraint 65 550 10.0243 12.5304 18.7955 0.9971 Constraint 58 550 13.0388 16.2985 24.4478 0.9971 Constraint 47 550 11.5251 14.4064 21.6095 0.9971 Constraint 39 550 14.7323 18.4154 27.6231 0.9971 Constraint 31 550 16.8658 21.0823 31.6234 0.9971 Constraint 31 516 16.5085 20.6356 30.9535 0.9971 Constraint 31 506 14.5938 18.2422 27.3633 0.9971 Constraint 22 516 18.6159 23.2699 34.9048 0.9971 Constraint 22 506 16.8271 21.0339 31.5508 0.9971 Constraint 22 501 12.6919 15.8649 23.7974 0.9971 Constraint 22 493 12.8831 16.1038 24.1557 0.9971 Constraint 22 484 15.1685 18.9606 28.4409 0.9971 Constraint 22 476 14.7385 18.4231 27.6347 0.9971 Constraint 22 469 12.5759 15.7199 23.5798 0.9971 Constraint 22 461 10.4398 13.0497 19.5746 0.9971 Constraint 22 453 11.6906 14.6133 21.9199 0.9971 Constraint 22 442 11.2810 14.1012 21.1518 0.9971 Constraint 22 431 7.9114 9.8892 14.8338 0.9971 Constraint 22 426 6.8755 8.5944 12.8916 0.9971 Constraint 22 417 8.2605 10.3256 15.4884 0.9971 Constraint 22 409 4.0255 5.0319 7.5479 0.9971 Constraint 22 401 6.5259 8.1574 12.2361 0.9971 Constraint 22 393 7.1709 8.9637 13.4455 0.9971 Constraint 22 384 3.6126 4.5158 6.7736 0.9971 Constraint 22 374 5.9508 7.4385 11.1577 0.9971 Constraint 22 367 4.7627 5.9534 8.9301 0.9971 Constraint 22 359 4.9299 6.1623 9.2435 0.9971 Constraint 22 352 8.1286 10.1607 15.2411 0.9971 Constraint 22 341 8.9907 11.2383 16.8575 0.9971 Constraint 22 330 12.7277 15.9096 23.8644 0.9971 Constraint 22 323 14.3220 17.9025 26.8537 0.9971 Constraint 22 239 16.8114 21.0142 31.5214 0.9971 Constraint 22 230 16.4495 20.5619 30.8429 0.9971 Constraint 22 222 12.9204 16.1505 24.2258 0.9971 Constraint 22 214 14.5288 18.1610 27.2414 0.9971 Constraint 22 177 9.4260 11.7826 17.6738 0.9971 Constraint 22 169 13.9080 17.3850 26.0775 0.9971 Constraint 22 164 13.6633 17.0791 25.6187 0.9971 Constraint 22 152 13.2570 16.5713 24.8569 0.9971 Constraint 22 144 10.2797 12.8496 19.2744 0.9971 Constraint 22 136 13.7873 17.2341 25.8511 0.9971 Constraint 22 131 15.4920 19.3651 29.0476 0.9971 Constraint 22 120 11.6346 14.5432 21.8148 0.9971 Constraint 22 115 15.8829 19.8537 29.7805 0.9971 Constraint 22 109 15.8687 19.8359 29.7538 0.9971 Constraint 22 101 12.7297 15.9121 23.8682 0.9971 Constraint 22 93 15.1738 18.9673 28.4509 0.9971 Constraint 11 506 18.9369 23.6711 35.5066 0.9971 Constraint 11 501 15.0896 18.8621 28.2931 0.9971 Constraint 11 493 15.1845 18.9806 28.4709 0.9971 Constraint 11 484 17.4936 21.8670 32.8005 0.9971 Constraint 11 476 17.7074 22.1343 33.2014 0.9971 Constraint 11 469 16.1483 20.1853 30.2780 0.9971 Constraint 11 461 13.1735 16.4669 24.7004 0.9971 Constraint 11 453 14.0231 17.5289 26.2934 0.9971 Constraint 11 442 14.5984 18.2481 27.3721 0.9971 Constraint 11 431 11.7105 14.6381 21.9571 0.9971 Constraint 11 426 9.3446 11.6808 17.5212 0.9971 Constraint 11 417 11.9264 14.9080 22.3621 0.9971 Constraint 11 409 7.8513 9.8141 14.7211 0.9971 Constraint 11 401 7.8896 9.8621 14.7931 0.9971 Constraint 11 393 8.2495 10.3118 15.4677 0.9971 Constraint 11 384 5.2698 6.5872 9.8808 0.9971 Constraint 11 374 5.1853 6.4816 9.7224 0.9971 Constraint 11 367 5.8044 7.2555 10.8833 0.9971 Constraint 11 359 3.9379 4.9223 7.3835 0.9971 Constraint 11 352 8.5100 10.6375 15.9563 0.9971 Constraint 11 341 8.5653 10.7066 16.0600 0.9971 Constraint 11 330 12.1966 15.2457 22.8685 0.9971 Constraint 11 323 14.1950 17.7437 26.6155 0.9971 Constraint 11 239 16.3315 20.4143 30.6215 0.9971 Constraint 11 230 14.9783 18.7229 28.0843 0.9971 Constraint 11 222 11.9287 14.9109 22.3663 0.9971 Constraint 11 214 12.7098 15.8872 23.8308 0.9971 Constraint 11 177 10.3641 12.9552 19.4328 0.9971 Constraint 11 169 14.3385 17.9231 26.8846 0.9971 Constraint 11 164 14.9565 18.6956 28.0434 0.9971 Constraint 11 152 12.7793 15.9741 23.9612 0.9971 Constraint 11 144 11.1190 13.8987 20.8480 0.9971 Constraint 11 136 14.9919 18.7399 28.1098 0.9971 Constraint 11 131 15.4521 19.3152 28.9727 0.9971 Constraint 11 120 12.7799 15.9748 23.9623 0.9971 Constraint 11 115 16.6902 20.8628 31.2942 0.9971 Constraint 11 109 15.5231 19.4038 29.1058 0.9971 Constraint 11 101 12.7090 15.8862 23.8293 0.9971 Constraint 11 93 16.1588 20.1986 30.2978 0.9971 Constraint 11 86 18.6252 23.2815 34.9223 0.9971 Constraint 3 501 18.0217 22.5271 33.7906 0.9971 Constraint 3 493 17.9749 22.4686 33.7030 0.9971 Constraint 3 476 19.1173 23.8967 35.8450 0.9971 Constraint 3 469 17.4411 21.8014 32.7021 0.9971 Constraint 3 461 15.3903 19.2378 28.8568 0.9971 Constraint 3 453 15.7081 19.6351 29.4526 0.9971 Constraint 3 442 15.1735 18.9668 28.4503 0.9971 Constraint 3 431 12.6625 15.8281 23.7421 0.9971 Constraint 3 426 10.9701 13.7126 20.5689 0.9971 Constraint 3 417 11.2450 14.0563 21.0844 0.9971 Constraint 3 409 7.7865 9.7331 14.5997 0.9971 Constraint 3 401 8.4234 10.5293 15.7939 0.9971 Constraint 3 393 6.4457 8.0571 12.0857 0.9971 Constraint 3 384 3.2998 4.1248 6.1872 0.9971 Constraint 3 374 5.8224 7.2780 10.9170 0.9971 Constraint 3 367 8.0727 10.0909 15.1363 0.9971 Constraint 3 359 8.0888 10.1110 15.1665 0.9971 Constraint 3 352 12.3978 15.4972 23.2458 0.9971 Constraint 3 341 12.6844 15.8554 23.7832 0.9971 Constraint 3 330 16.5536 20.6920 31.0381 0.9971 Constraint 3 323 18.2429 22.8036 34.2054 0.9971 Constraint 3 230 18.7096 23.3870 35.0805 0.9971 Constraint 3 222 15.8903 19.8628 29.7942 0.9971 Constraint 3 214 17.1810 21.4763 32.2144 0.9971 Constraint 3 177 11.9434 14.9292 22.3938 0.9971 Constraint 3 169 15.6154 19.5193 29.2789 0.9971 Constraint 3 164 16.8026 21.0032 31.5048 0.9971 Constraint 3 152 15.7494 19.6867 29.5301 0.9971 Constraint 3 144 13.8640 17.3300 25.9951 0.9971 Constraint 3 136 17.8759 22.3449 33.5174 0.9971 Constraint 3 131 18.9561 23.6951 35.5427 0.9971 Constraint 3 120 16.2296 20.2870 30.4305 0.9971 Constraint 3 101 16.8852 21.1064 31.6597 0.9971 Constraint 31 255 13.8934 17.3667 26.0501 0.9749 Constraint 31 247 11.4457 14.3071 21.4606 0.9749 Constraint 31 207 4.2247 5.2809 7.9213 0.9749 Constraint 31 199 5.8302 7.2878 10.9316 0.9749 Constraint 31 189 4.8989 6.1237 9.1855 0.9749 Constraint 169 533 16.7721 20.9651 31.4477 0.9547 Constraint 164 533 17.6737 22.0921 33.1382 0.9547 Constraint 73 533 19.0460 23.8075 35.7112 0.9547 Constraint 73 525 17.3765 21.7206 32.5810 0.9547 Constraint 65 533 15.6391 19.5489 29.3234 0.9547 Constraint 65 525 14.0628 17.5785 26.3677 0.9547 Constraint 58 533 14.3964 17.9955 26.9933 0.9547 Constraint 58 525 12.8761 16.0951 24.1427 0.9547 Constraint 47 533 10.0888 12.6110 18.9165 0.9547 Constraint 47 525 9.1485 11.4356 17.1534 0.9547 Constraint 39 533 10.4553 13.0691 19.6036 0.9547 Constraint 39 525 8.5838 10.7298 16.0947 0.9547 Constraint 550 558 0.8000 1.0000 1.5000 0.0000 Constraint 544 558 0.8000 1.0000 1.5000 0.0000 Constraint 544 550 0.8000 1.0000 1.5000 0.0000 Constraint 533 558 0.8000 1.0000 1.5000 0.0000 Constraint 533 550 0.8000 1.0000 1.5000 0.0000 Constraint 533 544 0.8000 1.0000 1.5000 0.0000 Constraint 525 558 0.8000 1.0000 1.5000 0.0000 Constraint 525 550 0.8000 1.0000 1.5000 0.0000 Constraint 525 544 0.8000 1.0000 1.5000 0.0000 Constraint 525 533 0.8000 1.0000 1.5000 0.0000 Constraint 516 558 0.8000 1.0000 1.5000 0.0000 Constraint 516 550 0.8000 1.0000 1.5000 0.0000 Constraint 516 544 0.8000 1.0000 1.5000 0.0000 Constraint 516 533 0.8000 1.0000 1.5000 0.0000 Constraint 516 525 0.8000 1.0000 1.5000 0.0000 Constraint 506 558 0.8000 1.0000 1.5000 0.0000 Constraint 506 550 0.8000 1.0000 1.5000 0.0000 Constraint 506 544 0.8000 1.0000 1.5000 0.0000 Constraint 506 533 0.8000 1.0000 1.5000 0.0000 Constraint 506 525 0.8000 1.0000 1.5000 0.0000 Constraint 506 516 0.8000 1.0000 1.5000 0.0000 Constraint 501 558 0.8000 1.0000 1.5000 0.0000 Constraint 501 550 0.8000 1.0000 1.5000 0.0000 Constraint 501 544 0.8000 1.0000 1.5000 0.0000 Constraint 501 533 0.8000 1.0000 1.5000 0.0000 Constraint 501 525 0.8000 1.0000 1.5000 0.0000 Constraint 501 516 0.8000 1.0000 1.5000 0.0000 Constraint 501 506 0.8000 1.0000 1.5000 0.0000 Constraint 493 558 0.8000 1.0000 1.5000 0.0000 Constraint 493 550 0.8000 1.0000 1.5000 0.0000 Constraint 493 544 0.8000 1.0000 1.5000 0.0000 Constraint 493 533 0.8000 1.0000 1.5000 0.0000 Constraint 493 525 0.8000 1.0000 1.5000 0.0000 Constraint 493 516 0.8000 1.0000 1.5000 0.0000 Constraint 493 506 0.8000 1.0000 1.5000 0.0000 Constraint 493 501 0.8000 1.0000 1.5000 0.0000 Constraint 484 558 0.8000 1.0000 1.5000 0.0000 Constraint 484 544 0.8000 1.0000 1.5000 0.0000 Constraint 484 533 0.8000 1.0000 1.5000 0.0000 Constraint 484 525 0.8000 1.0000 1.5000 0.0000 Constraint 484 516 0.8000 1.0000 1.5000 0.0000 Constraint 484 506 0.8000 1.0000 1.5000 0.0000 Constraint 484 501 0.8000 1.0000 1.5000 0.0000 Constraint 484 493 0.8000 1.0000 1.5000 0.0000 Constraint 476 558 0.8000 1.0000 1.5000 0.0000 Constraint 476 533 0.8000 1.0000 1.5000 0.0000 Constraint 476 525 0.8000 1.0000 1.5000 0.0000 Constraint 476 516 0.8000 1.0000 1.5000 0.0000 Constraint 476 506 0.8000 1.0000 1.5000 0.0000 Constraint 476 501 0.8000 1.0000 1.5000 0.0000 Constraint 476 493 0.8000 1.0000 1.5000 0.0000 Constraint 476 484 0.8000 1.0000 1.5000 0.0000 Constraint 469 558 0.8000 1.0000 1.5000 0.0000 Constraint 469 525 0.8000 1.0000 1.5000 0.0000 Constraint 469 516 0.8000 1.0000 1.5000 0.0000 Constraint 469 506 0.8000 1.0000 1.5000 0.0000 Constraint 469 501 0.8000 1.0000 1.5000 0.0000 Constraint 469 493 0.8000 1.0000 1.5000 0.0000 Constraint 469 484 0.8000 1.0000 1.5000 0.0000 Constraint 469 476 0.8000 1.0000 1.5000 0.0000 Constraint 461 558 0.8000 1.0000 1.5000 0.0000 Constraint 461 516 0.8000 1.0000 1.5000 0.0000 Constraint 461 506 0.8000 1.0000 1.5000 0.0000 Constraint 461 501 0.8000 1.0000 1.5000 0.0000 Constraint 461 493 0.8000 1.0000 1.5000 0.0000 Constraint 461 484 0.8000 1.0000 1.5000 0.0000 Constraint 461 476 0.8000 1.0000 1.5000 0.0000 Constraint 461 469 0.8000 1.0000 1.5000 0.0000 Constraint 453 558 0.8000 1.0000 1.5000 0.0000 Constraint 453 506 0.8000 1.0000 1.5000 0.0000 Constraint 453 501 0.8000 1.0000 1.5000 0.0000 Constraint 453 493 0.8000 1.0000 1.5000 0.0000 Constraint 453 484 0.8000 1.0000 1.5000 0.0000 Constraint 453 476 0.8000 1.0000 1.5000 0.0000 Constraint 453 469 0.8000 1.0000 1.5000 0.0000 Constraint 453 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 558 0.8000 1.0000 1.5000 0.0000 Constraint 442 501 0.8000 1.0000 1.5000 0.0000 Constraint 442 493 0.8000 1.0000 1.5000 0.0000 Constraint 442 484 0.8000 1.0000 1.5000 0.0000 Constraint 442 476 0.8000 1.0000 1.5000 0.0000 Constraint 442 469 0.8000 1.0000 1.5000 0.0000 Constraint 442 461 0.8000 1.0000 1.5000 0.0000 Constraint 442 453 0.8000 1.0000 1.5000 0.0000 Constraint 431 558 0.8000 1.0000 1.5000 0.0000 Constraint 431 493 0.8000 1.0000 1.5000 0.0000 Constraint 431 484 0.8000 1.0000 1.5000 0.0000 Constraint 431 476 0.8000 1.0000 1.5000 0.0000 Constraint 431 469 0.8000 1.0000 1.5000 0.0000 Constraint 431 461 0.8000 1.0000 1.5000 0.0000 Constraint 431 453 0.8000 1.0000 1.5000 0.0000 Constraint 431 442 0.8000 1.0000 1.5000 0.0000 Constraint 426 558 0.8000 1.0000 1.5000 0.0000 Constraint 426 484 0.8000 1.0000 1.5000 0.0000 Constraint 426 476 0.8000 1.0000 1.5000 0.0000 Constraint 426 469 0.8000 1.0000 1.5000 0.0000 Constraint 426 461 0.8000 1.0000 1.5000 0.0000 Constraint 426 453 0.8000 1.0000 1.5000 0.0000 Constraint 426 442 0.8000 1.0000 1.5000 0.0000 Constraint 426 431 0.8000 1.0000 1.5000 0.0000 Constraint 417 558 0.8000 1.0000 1.5000 0.0000 Constraint 417 476 0.8000 1.0000 1.5000 0.0000 Constraint 417 469 0.8000 1.0000 1.5000 0.0000 Constraint 417 461 0.8000 1.0000 1.5000 0.0000 Constraint 417 453 0.8000 1.0000 1.5000 0.0000 Constraint 417 442 0.8000 1.0000 1.5000 0.0000 Constraint 417 431 0.8000 1.0000 1.5000 0.0000 Constraint 417 426 0.8000 1.0000 1.5000 0.0000 Constraint 409 558 0.8000 1.0000 1.5000 0.0000 Constraint 409 469 0.8000 1.0000 1.5000 0.0000 Constraint 409 461 0.8000 1.0000 1.5000 0.0000 Constraint 409 453 0.8000 1.0000 1.5000 0.0000 Constraint 409 442 0.8000 1.0000 1.5000 0.0000 Constraint 409 431 0.8000 1.0000 1.5000 0.0000 Constraint 409 426 0.8000 1.0000 1.5000 0.0000 Constraint 409 417 0.8000 1.0000 1.5000 0.0000 Constraint 401 558 0.8000 1.0000 1.5000 0.0000 Constraint 401 461 0.8000 1.0000 1.5000 0.0000 Constraint 401 453 0.8000 1.0000 1.5000 0.0000 Constraint 401 442 0.8000 1.0000 1.5000 0.0000 Constraint 401 431 0.8000 1.0000 1.5000 0.0000 Constraint 401 426 0.8000 1.0000 1.5000 0.0000 Constraint 401 417 0.8000 1.0000 1.5000 0.0000 Constraint 401 409 0.8000 1.0000 1.5000 0.0000 Constraint 393 558 0.8000 1.0000 1.5000 0.0000 Constraint 393 453 0.8000 1.0000 1.5000 0.0000 Constraint 393 442 0.8000 1.0000 1.5000 0.0000 Constraint 393 431 0.8000 1.0000 1.5000 0.0000 Constraint 393 426 0.8000 1.0000 1.5000 0.0000 Constraint 393 417 0.8000 1.0000 1.5000 0.0000 Constraint 393 409 0.8000 1.0000 1.5000 0.0000 Constraint 393 401 0.8000 1.0000 1.5000 0.0000 Constraint 384 558 0.8000 1.0000 1.5000 0.0000 Constraint 384 442 0.8000 1.0000 1.5000 0.0000 Constraint 384 431 0.8000 1.0000 1.5000 0.0000 Constraint 384 426 0.8000 1.0000 1.5000 0.0000 Constraint 384 417 0.8000 1.0000 1.5000 0.0000 Constraint 384 409 0.8000 1.0000 1.5000 0.0000 Constraint 384 401 0.8000 1.0000 1.5000 0.0000 Constraint 384 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 558 0.8000 1.0000 1.5000 0.0000 Constraint 374 431 0.8000 1.0000 1.5000 0.0000 Constraint 374 426 0.8000 1.0000 1.5000 0.0000 Constraint 374 417 0.8000 1.0000 1.5000 0.0000 Constraint 374 409 0.8000 1.0000 1.5000 0.0000 Constraint 374 401 0.8000 1.0000 1.5000 0.0000 Constraint 374 393 0.8000 1.0000 1.5000 0.0000 Constraint 374 384 0.8000 1.0000 1.5000 0.0000 Constraint 367 558 0.8000 1.0000 1.5000 0.0000 Constraint 367 426 0.8000 1.0000 1.5000 0.0000 Constraint 367 417 0.8000 1.0000 1.5000 0.0000 Constraint 367 409 0.8000 1.0000 1.5000 0.0000 Constraint 367 401 0.8000 1.0000 1.5000 0.0000 Constraint 367 393 0.8000 1.0000 1.5000 0.0000 Constraint 367 384 0.8000 1.0000 1.5000 0.0000 Constraint 367 374 0.8000 1.0000 1.5000 0.0000 Constraint 359 558 0.8000 1.0000 1.5000 0.0000 Constraint 359 417 0.8000 1.0000 1.5000 0.0000 Constraint 359 409 0.8000 1.0000 1.5000 0.0000 Constraint 359 401 0.8000 1.0000 1.5000 0.0000 Constraint 359 393 0.8000 1.0000 1.5000 0.0000 Constraint 359 384 0.8000 1.0000 1.5000 0.0000 Constraint 359 374 0.8000 1.0000 1.5000 0.0000 Constraint 359 367 0.8000 1.0000 1.5000 0.0000 Constraint 352 558 0.8000 1.0000 1.5000 0.0000 Constraint 352 417 0.8000 1.0000 1.5000 0.0000 Constraint 352 409 0.8000 1.0000 1.5000 0.0000 Constraint 352 401 0.8000 1.0000 1.5000 0.0000 Constraint 352 393 0.8000 1.0000 1.5000 0.0000 Constraint 352 384 0.8000 1.0000 1.5000 0.0000 Constraint 352 374 0.8000 1.0000 1.5000 0.0000 Constraint 352 367 0.8000 1.0000 1.5000 0.0000 Constraint 352 359 0.8000 1.0000 1.5000 0.0000 Constraint 341 558 0.8000 1.0000 1.5000 0.0000 Constraint 341 409 0.8000 1.0000 1.5000 0.0000 Constraint 341 401 0.8000 1.0000 1.5000 0.0000 Constraint 341 393 0.8000 1.0000 1.5000 0.0000 Constraint 341 384 0.8000 1.0000 1.5000 0.0000 Constraint 341 374 0.8000 1.0000 1.5000 0.0000 Constraint 341 367 0.8000 1.0000 1.5000 0.0000 Constraint 341 359 0.8000 1.0000 1.5000 0.0000 Constraint 341 352 0.8000 1.0000 1.5000 0.0000 Constraint 330 558 0.8000 1.0000 1.5000 0.0000 Constraint 330 401 0.8000 1.0000 1.5000 0.0000 Constraint 330 393 0.8000 1.0000 1.5000 0.0000 Constraint 330 384 0.8000 1.0000 1.5000 0.0000 Constraint 330 374 0.8000 1.0000 1.5000 0.0000 Constraint 330 367 0.8000 1.0000 1.5000 0.0000 Constraint 330 359 0.8000 1.0000 1.5000 0.0000 Constraint 330 352 0.8000 1.0000 1.5000 0.0000 Constraint 330 341 0.8000 1.0000 1.5000 0.0000 Constraint 323 558 0.8000 1.0000 1.5000 0.0000 Constraint 323 393 0.8000 1.0000 1.5000 0.0000 Constraint 323 384 0.8000 1.0000 1.5000 0.0000 Constraint 323 374 0.8000 1.0000 1.5000 0.0000 Constraint 323 367 0.8000 1.0000 1.5000 0.0000 Constraint 323 359 0.8000 1.0000 1.5000 0.0000 Constraint 323 352 0.8000 1.0000 1.5000 0.0000 Constraint 323 341 0.8000 1.0000 1.5000 0.0000 Constraint 323 330 0.8000 1.0000 1.5000 0.0000 Constraint 315 558 0.8000 1.0000 1.5000 0.0000 Constraint 315 550 0.8000 1.0000 1.5000 0.0000 Constraint 315 544 0.8000 1.0000 1.5000 0.0000 Constraint 315 384 0.8000 1.0000 1.5000 0.0000 Constraint 315 374 0.8000 1.0000 1.5000 0.0000 Constraint 315 367 0.8000 1.0000 1.5000 0.0000 Constraint 315 359 0.8000 1.0000 1.5000 0.0000 Constraint 315 352 0.8000 1.0000 1.5000 0.0000 Constraint 315 341 0.8000 1.0000 1.5000 0.0000 Constraint 315 330 0.8000 1.0000 1.5000 0.0000 Constraint 315 323 0.8000 1.0000 1.5000 0.0000 Constraint 308 558 0.8000 1.0000 1.5000 0.0000 Constraint 308 550 0.8000 1.0000 1.5000 0.0000 Constraint 308 544 0.8000 1.0000 1.5000 0.0000 Constraint 308 374 0.8000 1.0000 1.5000 0.0000 Constraint 308 367 0.8000 1.0000 1.5000 0.0000 Constraint 308 359 0.8000 1.0000 1.5000 0.0000 Constraint 308 352 0.8000 1.0000 1.5000 0.0000 Constraint 308 341 0.8000 1.0000 1.5000 0.0000 Constraint 308 330 0.8000 1.0000 1.5000 0.0000 Constraint 308 323 0.8000 1.0000 1.5000 0.0000 Constraint 308 315 0.8000 1.0000 1.5000 0.0000 Constraint 296 558 0.8000 1.0000 1.5000 0.0000 Constraint 296 550 0.8000 1.0000 1.5000 0.0000 Constraint 296 544 0.8000 1.0000 1.5000 0.0000 Constraint 296 359 0.8000 1.0000 1.5000 0.0000 Constraint 296 352 0.8000 1.0000 1.5000 0.0000 Constraint 296 341 0.8000 1.0000 1.5000 0.0000 Constraint 296 330 0.8000 1.0000 1.5000 0.0000 Constraint 296 323 0.8000 1.0000 1.5000 0.0000 Constraint 296 315 0.8000 1.0000 1.5000 0.0000 Constraint 296 308 0.8000 1.0000 1.5000 0.0000 Constraint 290 558 0.8000 1.0000 1.5000 0.0000 Constraint 290 550 0.8000 1.0000 1.5000 0.0000 Constraint 290 544 0.8000 1.0000 1.5000 0.0000 Constraint 290 352 0.8000 1.0000 1.5000 0.0000 Constraint 290 341 0.8000 1.0000 1.5000 0.0000 Constraint 290 330 0.8000 1.0000 1.5000 0.0000 Constraint 290 323 0.8000 1.0000 1.5000 0.0000 Constraint 290 315 0.8000 1.0000 1.5000 0.0000 Constraint 290 308 0.8000 1.0000 1.5000 0.0000 Constraint 290 296 0.8000 1.0000 1.5000 0.0000 Constraint 277 558 0.8000 1.0000 1.5000 0.0000 Constraint 277 550 0.8000 1.0000 1.5000 0.0000 Constraint 277 330 0.8000 1.0000 1.5000 0.0000 Constraint 277 323 0.8000 1.0000 1.5000 0.0000 Constraint 277 315 0.8000 1.0000 1.5000 0.0000 Constraint 277 308 0.8000 1.0000 1.5000 0.0000 Constraint 277 296 0.8000 1.0000 1.5000 0.0000 Constraint 277 290 0.8000 1.0000 1.5000 0.0000 Constraint 269 558 0.8000 1.0000 1.5000 0.0000 Constraint 269 550 0.8000 1.0000 1.5000 0.0000 Constraint 269 323 0.8000 1.0000 1.5000 0.0000 Constraint 269 315 0.8000 1.0000 1.5000 0.0000 Constraint 269 308 0.8000 1.0000 1.5000 0.0000 Constraint 269 296 0.8000 1.0000 1.5000 0.0000 Constraint 269 290 0.8000 1.0000 1.5000 0.0000 Constraint 269 277 0.8000 1.0000 1.5000 0.0000 Constraint 261 558 0.8000 1.0000 1.5000 0.0000 Constraint 261 550 0.8000 1.0000 1.5000 0.0000 Constraint 261 544 0.8000 1.0000 1.5000 0.0000 Constraint 261 315 0.8000 1.0000 1.5000 0.0000 Constraint 261 308 0.8000 1.0000 1.5000 0.0000 Constraint 261 296 0.8000 1.0000 1.5000 0.0000 Constraint 261 290 0.8000 1.0000 1.5000 0.0000 Constraint 261 277 0.8000 1.0000 1.5000 0.0000 Constraint 261 269 0.8000 1.0000 1.5000 0.0000 Constraint 255 558 0.8000 1.0000 1.5000 0.0000 Constraint 255 550 0.8000 1.0000 1.5000 0.0000 Constraint 255 544 0.8000 1.0000 1.5000 0.0000 Constraint 255 308 0.8000 1.0000 1.5000 0.0000 Constraint 255 296 0.8000 1.0000 1.5000 0.0000 Constraint 255 290 0.8000 1.0000 1.5000 0.0000 Constraint 255 277 0.8000 1.0000 1.5000 0.0000 Constraint 255 269 0.8000 1.0000 1.5000 0.0000 Constraint 255 261 0.8000 1.0000 1.5000 0.0000 Constraint 247 558 0.8000 1.0000 1.5000 0.0000 Constraint 247 296 0.8000 1.0000 1.5000 0.0000 Constraint 247 290 0.8000 1.0000 1.5000 0.0000 Constraint 247 277 0.8000 1.0000 1.5000 0.0000 Constraint 247 269 0.8000 1.0000 1.5000 0.0000 Constraint 247 261 0.8000 1.0000 1.5000 0.0000 Constraint 247 255 0.8000 1.0000 1.5000 0.0000 Constraint 239 558 0.8000 1.0000 1.5000 0.0000 Constraint 239 296 0.8000 1.0000 1.5000 0.0000 Constraint 239 290 0.8000 1.0000 1.5000 0.0000 Constraint 239 277 0.8000 1.0000 1.5000 0.0000 Constraint 239 269 0.8000 1.0000 1.5000 0.0000 Constraint 239 261 0.8000 1.0000 1.5000 0.0000 Constraint 239 255 0.8000 1.0000 1.5000 0.0000 Constraint 239 247 0.8000 1.0000 1.5000 0.0000 Constraint 230 558 0.8000 1.0000 1.5000 0.0000 Constraint 230 290 0.8000 1.0000 1.5000 0.0000 Constraint 230 277 0.8000 1.0000 1.5000 0.0000 Constraint 230 269 0.8000 1.0000 1.5000 0.0000 Constraint 230 261 0.8000 1.0000 1.5000 0.0000 Constraint 230 255 0.8000 1.0000 1.5000 0.0000 Constraint 230 247 0.8000 1.0000 1.5000 0.0000 Constraint 230 239 0.8000 1.0000 1.5000 0.0000 Constraint 222 558 0.8000 1.0000 1.5000 0.0000 Constraint 222 277 0.8000 1.0000 1.5000 0.0000 Constraint 222 269 0.8000 1.0000 1.5000 0.0000 Constraint 222 261 0.8000 1.0000 1.5000 0.0000 Constraint 222 255 0.8000 1.0000 1.5000 0.0000 Constraint 222 247 0.8000 1.0000 1.5000 0.0000 Constraint 222 239 0.8000 1.0000 1.5000 0.0000 Constraint 222 230 0.8000 1.0000 1.5000 0.0000 Constraint 214 558 0.8000 1.0000 1.5000 0.0000 Constraint 214 277 0.8000 1.0000 1.5000 0.0000 Constraint 214 269 0.8000 1.0000 1.5000 0.0000 Constraint 214 261 0.8000 1.0000 1.5000 0.0000 Constraint 214 255 0.8000 1.0000 1.5000 0.0000 Constraint 214 247 0.8000 1.0000 1.5000 0.0000 Constraint 214 239 0.8000 1.0000 1.5000 0.0000 Constraint 214 230 0.8000 1.0000 1.5000 0.0000 Constraint 214 222 0.8000 1.0000 1.5000 0.0000 Constraint 207 558 0.8000 1.0000 1.5000 0.0000 Constraint 207 550 0.8000 1.0000 1.5000 0.0000 Constraint 207 269 0.8000 1.0000 1.5000 0.0000 Constraint 207 261 0.8000 1.0000 1.5000 0.0000 Constraint 207 255 0.8000 1.0000 1.5000 0.0000 Constraint 207 247 0.8000 1.0000 1.5000 0.0000 Constraint 207 239 0.8000 1.0000 1.5000 0.0000 Constraint 207 230 0.8000 1.0000 1.5000 0.0000 Constraint 207 222 0.8000 1.0000 1.5000 0.0000 Constraint 207 214 0.8000 1.0000 1.5000 0.0000 Constraint 199 558 0.8000 1.0000 1.5000 0.0000 Constraint 199 261 0.8000 1.0000 1.5000 0.0000 Constraint 199 255 0.8000 1.0000 1.5000 0.0000 Constraint 199 247 0.8000 1.0000 1.5000 0.0000 Constraint 199 239 0.8000 1.0000 1.5000 0.0000 Constraint 199 230 0.8000 1.0000 1.5000 0.0000 Constraint 199 222 0.8000 1.0000 1.5000 0.0000 Constraint 199 214 0.8000 1.0000 1.5000 0.0000 Constraint 199 207 0.8000 1.0000 1.5000 0.0000 Constraint 189 558 0.8000 1.0000 1.5000 0.0000 Constraint 189 550 0.8000 1.0000 1.5000 0.0000 Constraint 189 255 0.8000 1.0000 1.5000 0.0000 Constraint 189 247 0.8000 1.0000 1.5000 0.0000 Constraint 189 239 0.8000 1.0000 1.5000 0.0000 Constraint 189 230 0.8000 1.0000 1.5000 0.0000 Constraint 189 222 0.8000 1.0000 1.5000 0.0000 Constraint 189 214 0.8000 1.0000 1.5000 0.0000 Constraint 189 207 0.8000 1.0000 1.5000 0.0000 Constraint 189 199 0.8000 1.0000 1.5000 0.0000 Constraint 177 558 0.8000 1.0000 1.5000 0.0000 Constraint 177 550 0.8000 1.0000 1.5000 0.0000 Constraint 177 239 0.8000 1.0000 1.5000 0.0000 Constraint 177 230 0.8000 1.0000 1.5000 0.0000 Constraint 177 222 0.8000 1.0000 1.5000 0.0000 Constraint 177 214 0.8000 1.0000 1.5000 0.0000 Constraint 177 207 0.8000 1.0000 1.5000 0.0000 Constraint 177 199 0.8000 1.0000 1.5000 0.0000 Constraint 177 189 0.8000 1.0000 1.5000 0.0000 Constraint 169 558 0.8000 1.0000 1.5000 0.0000 Constraint 169 550 0.8000 1.0000 1.5000 0.0000 Constraint 169 544 0.8000 1.0000 1.5000 0.0000 Constraint 169 230 0.8000 1.0000 1.5000 0.0000 Constraint 169 222 0.8000 1.0000 1.5000 0.0000 Constraint 169 214 0.8000 1.0000 1.5000 0.0000 Constraint 169 207 0.8000 1.0000 1.5000 0.0000 Constraint 169 199 0.8000 1.0000 1.5000 0.0000 Constraint 169 189 0.8000 1.0000 1.5000 0.0000 Constraint 169 177 0.8000 1.0000 1.5000 0.0000 Constraint 164 558 0.8000 1.0000 1.5000 0.0000 Constraint 164 550 0.8000 1.0000 1.5000 0.0000 Constraint 164 544 0.8000 1.0000 1.5000 0.0000 Constraint 164 222 0.8000 1.0000 1.5000 0.0000 Constraint 164 214 0.8000 1.0000 1.5000 0.0000 Constraint 164 207 0.8000 1.0000 1.5000 0.0000 Constraint 164 199 0.8000 1.0000 1.5000 0.0000 Constraint 164 189 0.8000 1.0000 1.5000 0.0000 Constraint 164 177 0.8000 1.0000 1.5000 0.0000 Constraint 164 169 0.8000 1.0000 1.5000 0.0000 Constraint 152 558 0.8000 1.0000 1.5000 0.0000 Constraint 152 550 0.8000 1.0000 1.5000 0.0000 Constraint 152 544 0.8000 1.0000 1.5000 0.0000 Constraint 152 533 0.8000 1.0000 1.5000 0.0000 Constraint 152 207 0.8000 1.0000 1.5000 0.0000 Constraint 152 199 0.8000 1.0000 1.5000 0.0000 Constraint 152 189 0.8000 1.0000 1.5000 0.0000 Constraint 152 177 0.8000 1.0000 1.5000 0.0000 Constraint 152 169 0.8000 1.0000 1.5000 0.0000 Constraint 152 164 0.8000 1.0000 1.5000 0.0000 Constraint 144 558 0.8000 1.0000 1.5000 0.0000 Constraint 144 199 0.8000 1.0000 1.5000 0.0000 Constraint 144 189 0.8000 1.0000 1.5000 0.0000 Constraint 144 177 0.8000 1.0000 1.5000 0.0000 Constraint 144 169 0.8000 1.0000 1.5000 0.0000 Constraint 144 164 0.8000 1.0000 1.5000 0.0000 Constraint 144 152 0.8000 1.0000 1.5000 0.0000 Constraint 136 558 0.8000 1.0000 1.5000 0.0000 Constraint 136 189 0.8000 1.0000 1.5000 0.0000 Constraint 136 177 0.8000 1.0000 1.5000 0.0000 Constraint 136 169 0.8000 1.0000 1.5000 0.0000 Constraint 136 164 0.8000 1.0000 1.5000 0.0000 Constraint 136 152 0.8000 1.0000 1.5000 0.0000 Constraint 136 144 0.8000 1.0000 1.5000 0.0000 Constraint 131 558 0.8000 1.0000 1.5000 0.0000 Constraint 131 544 0.8000 1.0000 1.5000 0.0000 Constraint 131 533 0.8000 1.0000 1.5000 0.0000 Constraint 131 177 0.8000 1.0000 1.5000 0.0000 Constraint 131 169 0.8000 1.0000 1.5000 0.0000 Constraint 131 164 0.8000 1.0000 1.5000 0.0000 Constraint 131 152 0.8000 1.0000 1.5000 0.0000 Constraint 131 144 0.8000 1.0000 1.5000 0.0000 Constraint 131 136 0.8000 1.0000 1.5000 0.0000 Constraint 120 558 0.8000 1.0000 1.5000 0.0000 Constraint 120 169 0.8000 1.0000 1.5000 0.0000 Constraint 120 164 0.8000 1.0000 1.5000 0.0000 Constraint 120 152 0.8000 1.0000 1.5000 0.0000 Constraint 120 144 0.8000 1.0000 1.5000 0.0000 Constraint 120 136 0.8000 1.0000 1.5000 0.0000 Constraint 120 131 0.8000 1.0000 1.5000 0.0000 Constraint 115 558 0.8000 1.0000 1.5000 0.0000 Constraint 115 164 0.8000 1.0000 1.5000 0.0000 Constraint 115 152 0.8000 1.0000 1.5000 0.0000 Constraint 115 144 0.8000 1.0000 1.5000 0.0000 Constraint 115 136 0.8000 1.0000 1.5000 0.0000 Constraint 115 131 0.8000 1.0000 1.5000 0.0000 Constraint 115 120 0.8000 1.0000 1.5000 0.0000 Constraint 109 558 0.8000 1.0000 1.5000 0.0000 Constraint 109 544 0.8000 1.0000 1.5000 0.0000 Constraint 109 533 0.8000 1.0000 1.5000 0.0000 Constraint 109 152 0.8000 1.0000 1.5000 0.0000 Constraint 109 144 0.8000 1.0000 1.5000 0.0000 Constraint 109 136 0.8000 1.0000 1.5000 0.0000 Constraint 109 131 0.8000 1.0000 1.5000 0.0000 Constraint 109 120 0.8000 1.0000 1.5000 0.0000 Constraint 109 115 0.8000 1.0000 1.5000 0.0000 Constraint 101 558 0.8000 1.0000 1.5000 0.0000 Constraint 101 152 0.8000 1.0000 1.5000 0.0000 Constraint 101 144 0.8000 1.0000 1.5000 0.0000 Constraint 101 136 0.8000 1.0000 1.5000 0.0000 Constraint 101 131 0.8000 1.0000 1.5000 0.0000 Constraint 101 120 0.8000 1.0000 1.5000 0.0000 Constraint 101 115 0.8000 1.0000 1.5000 0.0000 Constraint 101 109 0.8000 1.0000 1.5000 0.0000 Constraint 93 558 0.8000 1.0000 1.5000 0.0000 Constraint 93 144 0.8000 1.0000 1.5000 0.0000 Constraint 93 136 0.8000 1.0000 1.5000 0.0000 Constraint 93 131 0.8000 1.0000 1.5000 0.0000 Constraint 93 120 0.8000 1.0000 1.5000 0.0000 Constraint 93 115 0.8000 1.0000 1.5000 0.0000 Constraint 93 109 0.8000 1.0000 1.5000 0.0000 Constraint 93 101 0.8000 1.0000 1.5000 0.0000 Constraint 86 558 0.8000 1.0000 1.5000 0.0000 Constraint 86 544 0.8000 1.0000 1.5000 0.0000 Constraint 86 533 0.8000 1.0000 1.5000 0.0000 Constraint 86 136 0.8000 1.0000 1.5000 0.0000 Constraint 86 131 0.8000 1.0000 1.5000 0.0000 Constraint 86 120 0.8000 1.0000 1.5000 0.0000 Constraint 86 115 0.8000 1.0000 1.5000 0.0000 Constraint 86 109 0.8000 1.0000 1.5000 0.0000 Constraint 86 101 0.8000 1.0000 1.5000 0.0000 Constraint 86 93 0.8000 1.0000 1.5000 0.0000 Constraint 81 558 0.8000 1.0000 1.5000 0.0000 Constraint 81 544 0.8000 1.0000 1.5000 0.0000 Constraint 81 533 0.8000 1.0000 1.5000 0.0000 Constraint 81 131 0.8000 1.0000 1.5000 0.0000 Constraint 81 120 0.8000 1.0000 1.5000 0.0000 Constraint 81 115 0.8000 1.0000 1.5000 0.0000 Constraint 81 109 0.8000 1.0000 1.5000 0.0000 Constraint 81 101 0.8000 1.0000 1.5000 0.0000 Constraint 81 93 0.8000 1.0000 1.5000 0.0000 Constraint 81 86 0.8000 1.0000 1.5000 0.0000 Constraint 73 558 0.8000 1.0000 1.5000 0.0000 Constraint 73 544 0.8000 1.0000 1.5000 0.0000 Constraint 73 120 0.8000 1.0000 1.5000 0.0000 Constraint 73 115 0.8000 1.0000 1.5000 0.0000 Constraint 73 109 0.8000 1.0000 1.5000 0.0000 Constraint 73 101 0.8000 1.0000 1.5000 0.0000 Constraint 73 93 0.8000 1.0000 1.5000 0.0000 Constraint 73 86 0.8000 1.0000 1.5000 0.0000 Constraint 73 81 0.8000 1.0000 1.5000 0.0000 Constraint 65 558 0.8000 1.0000 1.5000 0.0000 Constraint 65 544 0.8000 1.0000 1.5000 0.0000 Constraint 65 120 0.8000 1.0000 1.5000 0.0000 Constraint 65 115 0.8000 1.0000 1.5000 0.0000 Constraint 65 109 0.8000 1.0000 1.5000 0.0000 Constraint 65 101 0.8000 1.0000 1.5000 0.0000 Constraint 65 93 0.8000 1.0000 1.5000 0.0000 Constraint 65 86 0.8000 1.0000 1.5000 0.0000 Constraint 65 81 0.8000 1.0000 1.5000 0.0000 Constraint 65 73 0.8000 1.0000 1.5000 0.0000 Constraint 58 558 0.8000 1.0000 1.5000 0.0000 Constraint 58 544 0.8000 1.0000 1.5000 0.0000 Constraint 58 115 0.8000 1.0000 1.5000 0.0000 Constraint 58 109 0.8000 1.0000 1.5000 0.0000 Constraint 58 101 0.8000 1.0000 1.5000 0.0000 Constraint 58 93 0.8000 1.0000 1.5000 0.0000 Constraint 58 86 0.8000 1.0000 1.5000 0.0000 Constraint 58 81 0.8000 1.0000 1.5000 0.0000 Constraint 58 73 0.8000 1.0000 1.5000 0.0000 Constraint 58 65 0.8000 1.0000 1.5000 0.0000 Constraint 47 558 0.8000 1.0000 1.5000 0.0000 Constraint 47 544 0.8000 1.0000 1.5000 0.0000 Constraint 47 109 0.8000 1.0000 1.5000 0.0000 Constraint 47 101 0.8000 1.0000 1.5000 0.0000 Constraint 47 93 0.8000 1.0000 1.5000 0.0000 Constraint 47 86 0.8000 1.0000 1.5000 0.0000 Constraint 47 81 0.8000 1.0000 1.5000 0.0000 Constraint 47 73 0.8000 1.0000 1.5000 0.0000 Constraint 47 65 0.8000 1.0000 1.5000 0.0000 Constraint 47 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 558 0.8000 1.0000 1.5000 0.0000 Constraint 39 544 0.8000 1.0000 1.5000 0.0000 Constraint 39 101 0.8000 1.0000 1.5000 0.0000 Constraint 39 93 0.8000 1.0000 1.5000 0.0000 Constraint 39 86 0.8000 1.0000 1.5000 0.0000 Constraint 39 81 0.8000 1.0000 1.5000 0.0000 Constraint 39 73 0.8000 1.0000 1.5000 0.0000 Constraint 39 65 0.8000 1.0000 1.5000 0.0000 Constraint 39 58 0.8000 1.0000 1.5000 0.0000 Constraint 39 47 0.8000 1.0000 1.5000 0.0000 Constraint 31 558 0.8000 1.0000 1.5000 0.0000 Constraint 31 544 0.8000 1.0000 1.5000 0.0000 Constraint 31 533 0.8000 1.0000 1.5000 0.0000 Constraint 31 525 0.8000 1.0000 1.5000 0.0000 Constraint 31 93 0.8000 1.0000 1.5000 0.0000 Constraint 31 86 0.8000 1.0000 1.5000 0.0000 Constraint 31 81 0.8000 1.0000 1.5000 0.0000 Constraint 31 73 0.8000 1.0000 1.5000 0.0000 Constraint 31 65 0.8000 1.0000 1.5000 0.0000 Constraint 31 58 0.8000 1.0000 1.5000 0.0000 Constraint 31 47 0.8000 1.0000 1.5000 0.0000 Constraint 31 39 0.8000 1.0000 1.5000 0.0000 Constraint 22 558 0.8000 1.0000 1.5000 0.0000 Constraint 22 550 0.8000 1.0000 1.5000 0.0000 Constraint 22 544 0.8000 1.0000 1.5000 0.0000 Constraint 22 533 0.8000 1.0000 1.5000 0.0000 Constraint 22 525 0.8000 1.0000 1.5000 0.0000 Constraint 22 315 0.8000 1.0000 1.5000 0.0000 Constraint 22 308 0.8000 1.0000 1.5000 0.0000 Constraint 22 296 0.8000 1.0000 1.5000 0.0000 Constraint 22 290 0.8000 1.0000 1.5000 0.0000 Constraint 22 277 0.8000 1.0000 1.5000 0.0000 Constraint 22 269 0.8000 1.0000 1.5000 0.0000 Constraint 22 261 0.8000 1.0000 1.5000 0.0000 Constraint 22 255 0.8000 1.0000 1.5000 0.0000 Constraint 22 247 0.8000 1.0000 1.5000 0.0000 Constraint 22 207 0.8000 1.0000 1.5000 0.0000 Constraint 22 199 0.8000 1.0000 1.5000 0.0000 Constraint 22 189 0.8000 1.0000 1.5000 0.0000 Constraint 22 86 0.8000 1.0000 1.5000 0.0000 Constraint 22 81 0.8000 1.0000 1.5000 0.0000 Constraint 22 73 0.8000 1.0000 1.5000 0.0000 Constraint 22 65 0.8000 1.0000 1.5000 0.0000 Constraint 22 58 0.8000 1.0000 1.5000 0.0000 Constraint 22 47 0.8000 1.0000 1.5000 0.0000 Constraint 22 39 0.8000 1.0000 1.5000 0.0000 Constraint 22 31 0.8000 1.0000 1.5000 0.0000 Constraint 11 558 0.8000 1.0000 1.5000 0.0000 Constraint 11 550 0.8000 1.0000 1.5000 0.0000 Constraint 11 544 0.8000 1.0000 1.5000 0.0000 Constraint 11 533 0.8000 1.0000 1.5000 0.0000 Constraint 11 525 0.8000 1.0000 1.5000 0.0000 Constraint 11 516 0.8000 1.0000 1.5000 0.0000 Constraint 11 315 0.8000 1.0000 1.5000 0.0000 Constraint 11 308 0.8000 1.0000 1.5000 0.0000 Constraint 11 296 0.8000 1.0000 1.5000 0.0000 Constraint 11 290 0.8000 1.0000 1.5000 0.0000 Constraint 11 277 0.8000 1.0000 1.5000 0.0000 Constraint 11 269 0.8000 1.0000 1.5000 0.0000 Constraint 11 261 0.8000 1.0000 1.5000 0.0000 Constraint 11 255 0.8000 1.0000 1.5000 0.0000 Constraint 11 247 0.8000 1.0000 1.5000 0.0000 Constraint 11 207 0.8000 1.0000 1.5000 0.0000 Constraint 11 199 0.8000 1.0000 1.5000 0.0000 Constraint 11 189 0.8000 1.0000 1.5000 0.0000 Constraint 11 81 0.8000 1.0000 1.5000 0.0000 Constraint 11 73 0.8000 1.0000 1.5000 0.0000 Constraint 11 65 0.8000 1.0000 1.5000 0.0000 Constraint 11 58 0.8000 1.0000 1.5000 0.0000 Constraint 11 47 0.8000 1.0000 1.5000 0.0000 Constraint 11 39 0.8000 1.0000 1.5000 0.0000 Constraint 11 31 0.8000 1.0000 1.5000 0.0000 Constraint 11 22 0.8000 1.0000 1.5000 0.0000 Constraint 3 558 0.8000 1.0000 1.5000 0.0000 Constraint 3 550 0.8000 1.0000 1.5000 0.0000 Constraint 3 544 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 525 0.8000 1.0000 1.5000 0.0000 Constraint 3 516 0.8000 1.0000 1.5000 0.0000 Constraint 3 506 0.8000 1.0000 1.5000 0.0000 Constraint 3 484 0.8000 1.0000 1.5000 0.0000 Constraint 3 315 0.8000 1.0000 1.5000 0.0000 Constraint 3 308 0.8000 1.0000 1.5000 0.0000 Constraint 3 296 0.8000 1.0000 1.5000 0.0000 Constraint 3 290 0.8000 1.0000 1.5000 0.0000 Constraint 3 277 0.8000 1.0000 1.5000 0.0000 Constraint 3 269 0.8000 1.0000 1.5000 0.0000 Constraint 3 261 0.8000 1.0000 1.5000 0.0000 Constraint 3 255 0.8000 1.0000 1.5000 0.0000 Constraint 3 247 0.8000 1.0000 1.5000 0.0000 Constraint 3 239 0.8000 1.0000 1.5000 0.0000 Constraint 3 207 0.8000 1.0000 1.5000 0.0000 Constraint 3 199 0.8000 1.0000 1.5000 0.0000 Constraint 3 189 0.8000 1.0000 1.5000 0.0000 Constraint 3 115 0.8000 1.0000 1.5000 0.0000 Constraint 3 109 0.8000 1.0000 1.5000 0.0000 Constraint 3 93 0.8000 1.0000 1.5000 0.0000 Constraint 3 86 0.8000 1.0000 1.5000 0.0000 Constraint 3 81 0.8000 1.0000 1.5000 0.0000 Constraint 3 73 0.8000 1.0000 1.5000 0.0000 Constraint 3 65 0.8000 1.0000 1.5000 0.0000 Constraint 3 58 0.8000 1.0000 1.5000 0.0000 Constraint 3 47 0.8000 1.0000 1.5000 0.0000 Constraint 3 39 0.8000 1.0000 1.5000 0.0000 Constraint 3 31 0.8000 1.0000 1.5000 0.0000 Constraint 3 22 0.8000 1.0000 1.5000 0.0000 Constraint 3 11 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: