parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 6.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint (T0340)I32.CB (T0340)D50.CB 2.8452 4.7421 6.1647 103.0349 Constraint (T0340)Y31.CB (T0340)R51.CB 3.2466 5.4109 7.0342 100.0349 Constraint (T0340)H22.CB (T0340)R33.CB 2.6417 4.4029 5.7237 97.9918 Constraint (T0340)D50.CB (T0340)V83.CB 2.6049 4.3415 5.6439 96.8615 Constraint (T0340)R51.CB (T0340)V84.CB 2.7967 4.6612 6.0596 95.8626 Constraint (T0340)E54.CB (T0340)L82.CB 2.4427 4.0711 5.2925 95.0612 Constraint (T0340)N20.CB (T0340)S34.CB 2.6752 4.4587 5.7963 93.9919 Constraint (T0340)F19.CB (T0340)A41.CB 2.6630 4.4383 5.7698 92.9931 Constraint (T0340)Q30.CB (T0340)L52.CB 2.7417 4.5695 5.9404 92.0363 Constraint (T0340)I53.CB (T0340)L82.CB 2.9083 4.8471 6.3012 91.9394 Constraint (T0340)N56.CB (T0340)R80.CB 3.2447 5.4078 7.0301 91.1140 Constraint (T0340)N20.CB (T0340)R33.CB 2.7579 4.5965 5.9754 90.9932 Constraint (T0340)Q30.CB (T0340)V68.CB 2.9917 4.9861 6.4819 90.7406 Constraint (T0340)F19.CB (T0340)V35.CB 3.0505 5.0841 6.6094 89.9921 Constraint (T0340)F19.CB (T0340)I32.CB 3.1819 5.3032 6.8942 89.9921 Constraint (T0340)Y17.CB (T0340)A41.CB 3.2092 5.3486 6.9532 88.9933 Constraint (T0340)I32.CB (T0340)A48.CB 3.3374 5.5624 7.2311 88.6144 Constraint (T0340)L21.CB (T0340)Q30.CB 3.1414 5.2356 6.8063 87.9922 Constraint (T0340)L10.CB (T0340)A79.CB 2.8891 4.8152 6.2597 86.9923 Constraint (T0340)Y17.CB (T0340)P40.CB 3.0691 5.1152 6.6497 85.9935 Constraint (T0340)I53.CB (T0340)V84.CB 3.3975 5.6625 7.3613 85.8625 Constraint (T0340)H9.CB (T0340)R80.CB 2.9968 4.9947 6.4931 84.9923 Constraint (T0340)H22.CB (T0340)Y31.CB 3.0050 5.0083 6.5108 84.9919 Constraint (T0340)V55.CB (T0340)S71.CB 2.9710 4.9517 6.4372 83.0419 Constraint (T0340)Q30.CB (T0340)V60.CB 3.1147 5.1912 6.7485 80.0346 Constraint (T0340)C8.CB (T0340)L81.CB 2.9340 4.8900 6.3570 76.9923 Constraint (T0340)P5.CB (T0340)V84.CB 3.0947 5.1578 6.7052 71.9926 Constraint (T0340)L10.CB (T0340)P40.CB 2.8639 4.7731 6.2050 70.9992 Constraint (T0340)R6.CB (T0340)V83.CB 3.2152 5.3587 6.9663 70.9926 Constraint (T0340)L7.CB (T0340)L82.CB 3.1916 5.3193 6.9151 69.9927 Constraint (T0340)R11.CB (T0340)E78.CB 3.1885 5.3141 6.9084 66.9937 Constraint (T0340)L52.CB (T0340)V83.CB 3.3324 5.5540 7.2202 63.1144 Constraint (T0340)L21.CB (T0340)I32.CB 3.4216 5.7027 7.4135 58.9921 Constraint (T0340)L52.CB (T0340)L81.CB 3.3706 5.6177 7.3029 57.0615 Constraint (T0340)L10.CB (T0340)S44.CB 3.2132 5.3553 6.9619 52.9939 Constraint (T0340)V35.CB (T0340)L46.CB 3.1719 5.2865 6.8725 49.7411 Constraint (T0340)Q58.CB (T0340)S71.CB 3.2324 5.3873 7.0035 46.9982 Constraint (T0340)D24.CB (T0340)H65.CB 2.3594 3.9324 5.1121 44.7458 Constraint (T0340)V55.CB (T0340)L81.CB 3.2040 5.3400 6.9420 42.7467 Constraint (T0340)N56.CB (T0340)R75.CB 3.1148 5.1913 6.7486 41.9986 Constraint (T0340)C8.CB (T0340)S44.CB 3.0045 5.0075 6.5098 40.9996 Constraint (T0340)S23.CB (T0340)H65.CB 2.7651 4.6085 5.9911 39.9979 Constraint (T0340)C8.CB (T0340)L46.CB 3.3213 5.5355 7.1962 38.9999 Constraint (T0340)K12.CB (T0340)D77.CB 3.0401 5.0669 6.5869 37.9981 Constraint (T0340)F19.CB (T0340)L46.CB 3.4261 5.7102 7.4233 35.9983 Constraint (T0340)I32.CB (T0340)L46.CB 3.4219 5.7032 7.4141 34.9996 Constraint (T0340)S34.CB (T0340)A48.CB 3.2598 5.4330 7.0629 34.6206 Constraint (T0340)D24.CB (T0340)R64.CB 2.9336 4.8893 6.3561 33.0000 Constraint (T0340)R11.CB (T0340)P40.CB 3.3039 5.5065 7.1584 32.9993 Constraint (T0340)Q49.CB (T0340)P86.CB 2.5884 4.3140 5.6082 31.9997 Constraint (T0340)V55.CB (T0340)I72.CB 3.4126 5.6877 7.3940 31.9987 Constraint (T0340)C8.CB (T0340)V83.CB 3.3780 5.6301 7.3191 31.9938 Constraint (T0340)V35.CB (T0340)A48.CB 3.4218 5.7031 7.4140 29.4155 Constraint (T0340)L21.CB (T0340)R33.CB 3.4431 5.7385 7.4600 28.9998 Constraint (T0340)R11.CB (T0340)D77.CB 3.3980 5.6634 7.3624 28.9997 Constraint (T0340)K25.CB (T0340)R64.CB 3.0409 5.0681 6.5886 27.9986 Constraint (T0340)P5.CB (T0340)L82.CB 3.2674 5.4456 7.0793 26.9999 Constraint (T0340)H9.CB (T0340)E78.CB 3.2041 5.3401 6.9422 26.9983 Constraint (T0340)K12.CB (T0340)P40.CB 2.7985 4.6641 6.0634 25.9998 Constraint (T0340)N56.CB (T0340)A79.CB 3.1363 5.2272 6.7954 25.0673 Constraint (T0340)D24.CB (T0340)V68.CB 3.2683 5.4472 7.0813 24.0000 Constraint (T0340)L10.CB (T0340)A41.CB 3.3552 5.5919 7.2695 23.9997 Constraint (T0340)L21.CB (T0340)V68.CB 3.3485 5.5809 7.2552 22.9981 Constraint (T0340)Y17.CB (T0340)A79.CB 3.2438 5.4064 7.0283 20.9986 Constraint (T0340)Q30.CB (T0340)H65.CB 3.0566 5.0944 6.6227 20.9192 Constraint (T0340)P28.CB (T0340)E61.CB 2.9867 4.9779 6.4712 20.6204 Constraint (T0340)Q30.CB (T0340)L63.CB 3.3897 5.6495 7.3444 20.1216 Constraint (T0340)V55.CB (T0340)R75.CB 3.1739 5.2899 6.8768 19.0000 Constraint (T0340)D24.CB (T0340)L63.CB 3.3610 5.6016 7.2821 18.0000 Constraint (T0340)R51.CB (T0340)P86.CB 2.9010 4.8350 6.2855 16.9961 Constraint (T0340)K12.CB (T0340)A79.CB 3.2087 5.3478 6.9521 16.9926 Constraint (T0340)L21.CB (T0340)H65.CB 3.2222 5.3704 6.9815 14.9996 Constraint (T0340)L3.CB (T0340)P86.CB 3.1310 5.2183 6.7837 14.9986 Constraint (T0340)Y31.CB (T0340)Q49.CB 3.3164 5.5274 7.1856 14.9983 Constraint (T0340)D50.CB (T0340)P86.CB 3.1362 5.2271 6.7952 13.9998 Constraint (T0340)L7.CB (T0340)R80.CB 3.5106 5.8509 7.6062 13.9943 Constraint (T0340)E54.CB (T0340)L81.CB 3.4965 5.8274 7.5756 13.8687 Constraint (T0340)V55.CB (T0340)A79.CB 3.4304 5.7174 7.4326 13.7470 Constraint (T0340)V35.CB (T0340)R47.CB 3.4580 5.7633 7.4923 13.7428 Constraint (T0340)L3.CB (T0340)V84.CB 2.9291 4.8819 6.3464 11.9999 Constraint (T0340)S26.CB (T0340)R64.CB 2.9561 4.9269 6.4050 11.0000 Constraint (T0340)Q15.CB (T0340)S39.CB 3.1578 5.2630 6.8419 10.9999 Constraint (T0340)R51.CB (T0340)V83.CB 3.4530 5.7550 7.4815 10.9994 Constraint (T0340)R33.CB (T0340)A48.CB 3.3512 5.5854 7.2610 10.7425 Constraint (T0340)H9.CB (T0340)S44.CB 3.2935 5.4891 7.1358 9.9999 Constraint (T0340)L46.CB (T0340)V83.CB 3.5641 5.9402 7.7222 9.0000 Constraint (T0340)P5.CB (T0340)I53.CB 3.3284 5.5473 7.2115 9.0000 Constraint (T0340)P14.CB (T0340)E76.CB 3.2062 5.3437 6.9468 8.9997 Constraint (T0340)Y17.CB (T0340)I72.CB 3.2108 5.3514 6.9568 8.9996 Constraint (T0340)K12.CB (T0340)R75.CB 3.1785 5.2975 6.8867 8.9984 Constraint (T0340)K25.CB (T0340)H65.CB 3.3114 5.5190 7.1747 8.7456 Constraint (T0340)L10.CB (T0340)E78.CB 3.4936 5.8227 7.5695 7.0000 Constraint (T0340)P28.CB (T0340)R51.CB 2.9289 4.8814 6.3459 6.9998 Constraint (T0340)K12.CB (T0340)E76.CB 3.2671 5.4452 7.0788 6.9991 Constraint (T0340)N56.CB (T0340)S71.CB 3.2307 5.3845 6.9998 6.0000 Constraint (T0340)V60.CB (T0340)S71.CB 3.4140 5.6900 7.3970 5.9999 Constraint (T0340)R4.CB (T0340)V84.CB 3.3867 5.6445 7.3379 5.9998 Constraint (T0340)R47.CB (T0340)P86.CB 3.5217 5.8695 7.6304 5.9998 Constraint (T0340)L52.CB (T0340)V68.CB 3.4177 5.6962 7.4050 5.9996 Constraint (T0340)Q58.CB (T0340)V68.CB 2.8843 4.8071 6.2493 5.9984 Constraint (T0340)L10.CB (T0340)L81.CB 3.3176 5.5294 7.1882 5.9984 Constraint (T0340)I32.CB (T0340)L52.CB 3.1332 5.2221 6.7887 5.4216 Constraint (T0340)S26.CB (T0340)H65.CB 3.2710 5.4517 7.0872 5.0000 Constraint (T0340)D24.CB (T0340)L52.CB 3.2145 5.3574 6.9647 5.0000 Constraint (T0340)D24.CB (T0340)R51.CB 3.0969 5.1615 6.7099 5.0000 Constraint (T0340)L21.CB (T0340)Y31.CB 3.5379 5.8965 7.6655 5.0000 Constraint (T0340)K12.CB (T0340)E78.CB 3.3337 5.5561 7.2230 4.9999 Constraint (T0340)R27.CB (T0340)E61.CB 3.4689 5.7815 7.5160 4.9998 Constraint (T0340)S23.CB (T0340)R64.CB 3.3740 5.6233 7.3103 4.9997 Constraint (T0340)H22.CB (T0340)H65.CB 3.2810 5.4684 7.1089 4.9995 Constraint (T0340)V55.CB (T0340)V68.CB 3.1499 5.2498 6.8248 4.3000 Constraint (T0340)P28.CB (T0340)I53.CB 3.5120 5.8534 7.6094 4.0000 Constraint (T0340)R27.CB (T0340)H65.CB 3.2705 5.4508 7.0860 4.0000 Constraint (T0340)S1.CB (T0340)P86.CB 3.2004 5.3340 6.9342 3.9999 Constraint (T0340)P14.CB (T0340)D77.CB 3.3855 5.6424 7.3352 3.9999 Constraint (T0340)N20.CB (T0340)D36.CB 3.1257 5.2095 6.7724 3.9996 Constraint (T0340)D24.CB (T0340)R33.CB 3.1564 5.2606 6.8388 3.7472 Constraint (T0340)Q30.CB (T0340)R51.CB 3.5659 5.9432 7.7262 3.0000 Constraint (T0340)P28.CB (T0340)L63.CB 3.3629 5.6049 7.2863 3.0000 Constraint (T0340)R27.CB (T0340)R64.CB 2.6511 4.4185 5.7441 3.0000 Constraint (T0340)L21.CB (T0340)L52.CB 3.5066 5.8443 7.5976 3.0000 Constraint (T0340)Y17.CB (T0340)S39.CB 3.4068 5.6781 7.3815 3.0000 Constraint (T0340)N20.CB (T0340)I32.CB 3.1863 5.3105 6.9036 3.0000 Constraint (T0340)Q15.CB (T0340)K73.CB 3.5238 5.8730 7.6349 3.0000 Constraint (T0340)R4.CB (T0340)S87.CB 2.8625 4.7709 6.2021 2.9999 Constraint (T0340)N56.CB (T0340)I72.CB 2.5290 4.2150 5.4796 2.9997 Constraint (T0340)I32.CB (T0340)Q49.CB 3.5435 5.9058 7.6776 2.9997 Constraint (T0340)Q30.CB (T0340)E61.CB 3.0744 5.1240 6.6612 2.9997 Constraint (T0340)Q30.CB (T0340)I53.CB 3.3413 5.5689 7.2396 2.9997 Constraint (T0340)S23.CB (T0340)V60.CB 2.7928 4.6546 6.0510 2.9997 Constraint (T0340)F19.CB (T0340)D36.CB 3.5086 5.8477 7.6020 2.9997 Constraint (T0340)Q58.CB (T0340)I72.CB 3.0261 5.0435 6.5565 2.9987 Constraint (T0340)L21.CB (T0340)V69.CB 2.8671 4.7786 6.2121 2.9987 Constraint (T0340)N20.CB (T0340)V69.CB 3.5946 5.9910 7.7882 2.9987 Constraint (T0340)R11.CB (T0340)S39.CB 3.3238 5.5397 7.2016 2.9987 Constraint (T0340)Q15.CB (T0340)P40.CB 3.4160 5.6933 7.4013 2.9981 Constraint (T0340)I32.CB (T0340)R51.CB 3.5844 5.9741 7.7663 2.1219 Constraint (T0340)N56.CB (T0340)L81.CB 3.0493 5.0821 6.6067 2.0998 Constraint (T0340)R47.CB (T0340)S87.CB 3.2810 5.4684 7.1089 2.0000 Constraint (T0340)R27.CB (T0340)V60.CB 3.4680 5.7800 7.5140 2.0000 Constraint (T0340)S26.CB (T0340)R51.CB 3.2531 5.4218 7.0483 2.0000 Constraint (T0340)R11.CB (T0340)A79.CB 2.8733 4.7889 6.2256 1.9999 Constraint (T0340)L10.CB (T0340)R80.CB 2.9704 4.9507 6.4359 1.9999 Constraint (T0340)H9.CB (T0340)L81.CB 3.3005 5.5009 7.1512 1.9999 Constraint (T0340)C8.CB (T0340)L82.CB 3.0252 5.0421 6.5547 1.9999 Constraint (T0340)H22.CB (T0340)S34.CB 2.6769 4.4615 5.7999 1.9999 Constraint (T0340)R51.CB (T0340)S87.CB 3.2339 5.3898 7.0067 1.9998 Constraint (T0340)D50.CB (T0340)V84.CB 3.5163 5.8605 7.6187 1.7473 Constraint (T0340)P28.CB (T0340)L52.CB 3.2233 5.3721 6.9838 1.0000 Constraint (T0340)R27.CB (T0340)V84.CB 3.3071 5.5119 7.1654 1.0000 Constraint (T0340)R27.CB (T0340)R51.CB 2.9727 4.9545 6.4409 1.0000 Constraint (T0340)S26.CB (T0340)E61.CB 3.3100 5.5167 7.1717 1.0000 Constraint (T0340)S26.CB (T0340)V60.CB 3.4289 5.7148 7.4292 1.0000 Constraint (T0340)Q15.CB (T0340)R75.CB 2.7813 4.6354 6.0261 1.0000 Constraint (T0340)P14.CB (T0340)K73.CB 3.4534 5.7556 7.4823 1.0000 Constraint (T0340)C8.CB (T0340)R80.CB 3.4659 5.7765 7.5094 1.0000 Constraint (T0340)S26.CB (T0340)L52.CB 3.1515 5.2524 6.8282 1.0000 Constraint (T0340)S23.CB (T0340)R33.CB 3.3895 5.6491 7.3438 1.0000 Constraint (T0340)S23.CB (T0340)I32.CB 2.9711 4.9519 6.4374 1.0000 Constraint (T0340)S26.CB (T0340)V84.CB 3.5019 5.8365 7.5875 1.0000 Constraint (T0340)V55.CB (T0340)L82.CB 3.3142 5.5237 7.1808 0.9999 Constraint (T0340)L52.CB (T0340)L82.CB 3.3750 5.6251 7.3126 0.9999 Constraint (T0340)K25.CB (T0340)L63.CB 3.5068 5.8447 7.5981 0.9999 Constraint (T0340)S23.CB (T0340)V68.CB 2.4322 4.0536 5.2697 0.9999 Constraint (T0340)L21.CB (T0340)A41.CB 2.5263 4.2106 5.4737 0.9999 Constraint (T0340)N20.CB (T0340)A41.CB 2.8766 4.7943 6.2326 0.9999 Constraint (T0340)N20.CB (T0340)P40.CB 3.4251 5.7085 7.4211 0.9999 Constraint (T0340)N20.CB (T0340)S39.CB 1.5547 2.5912 3.3686 0.9999 Constraint (T0340)F19.CB (T0340)P40.CB 2.3485 3.9141 5.0884 0.9999 Constraint (T0340)L10.CB (T0340)F19.CB 2.8056 4.6759 6.0787 0.9999 Constraint (T0340)H9.CB (T0340)A79.CB 3.2212 5.3687 6.9793 0.9999 Constraint (T0340)V55.CB (T0340)V83.CB 2.7589 4.5981 5.9775 0.9999 Constraint (T0340)E54.CB (T0340)V84.CB 2.1613 3.6022 4.6828 0.9999 Constraint (T0340)E54.CB (T0340)V83.CB 3.5276 5.8793 7.6431 0.9999 Constraint (T0340)I53.CB (T0340)P86.CB 2.1841 3.6402 4.7322 0.9999 Constraint (T0340)L10.CB (T0340)V83.CB 3.4818 5.8031 7.5440 0.9999 Constraint (T0340)H9.CB (T0340)L82.CB 3.5187 5.8644 7.6237 0.9999 Constraint (T0340)P5.CB (T0340)S87.CB 2.1863 3.6438 4.7369 0.9999 Constraint (T0340)P5.CB (T0340)P86.CB 2.9844 4.9740 6.4662 0.9999 Constraint (T0340)P5.CB (T0340)V83.CB 3.2362 5.3936 7.0117 0.9999 Constraint (T0340)R4.CB (T0340)T88.CB 2.1723 3.6204 4.7066 0.9999 Constraint (T0340)R4.CB (T0340)P86.CB 2.5483 4.2472 5.5214 0.9999 Constraint (T0340)L3.CB (T0340)R51.CB 3.5547 5.9245 7.7019 0.9999 Constraint (T0340)Q49.CB (T0340)S87.CB 2.3434 3.9056 5.0773 0.9981 Constraint (T0340)A79.CB (T0340)T88.CB 3.1318 5.2197 6.7856 0.7073 Constraint (T0340)E78.CB (T0340)R89.CB 3.4978 5.8297 7.5786 0.7073 Constraint (T0340)D77.CB (T0340)L90.CB 2.5457 4.2428 5.5157 0.7073 Constraint (T0340)E76.CB (T0340)L90.CB 3.2040 5.3400 6.9419 0.7073 Constraint (T0340)S44.CB (T0340)T88.CB 3.5428 5.9047 7.6761 0.7073 Constraint (T0340)P40.CB (T0340)T88.CB 3.1855 5.3092 6.9020 0.7073 Constraint (T0340)D36.CB (T0340)A48.CB 2.8117 4.6862 6.0920 0.3000 Constraint (T0340)R89.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: