parameters: 0.7 1.5 0.5 # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 23.0000 0.0000 3.0000 0.5000 2.5156 1.0000 2.0625 1.5000 1.6406 2.0000 1.2500 2.5000 0.8906 3.0000 0.5625 3.5000 0.2656 4.0000 0.0000 4.5000 -0.2344 5.0000 -0.4375 5.5000 -0.6094 6.0000 -0.7500 6.5000 -0.8594 7.0000 -0.9375 7.5000 -0.9844 8.0000 -1.0000 8.5000 -0.9949 9.0000 -0.9796 9.5000 -0.9541 10.0000 -0.9184 10.5000 -0.8724 11.0000 -0.8163 11.5000 -0.7500 12.0000 -0.6735 12.5000 -0.5867 13.0000 -0.4898 13.5000 -0.3827 14.0000 -0.2653 14.5000 -0.1378 15.0000 0.0000 15.5000 0.1480 16.0000 0.3061 16.5000 0.4745 17.0000 0.6531 17.5000 0.8418 18.0000 1.0408 18.5000 1.2500 19.0000 1.4694 19.5000 1.6990 parameters: 0.6000 1.3000 0.5000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint (T0340)V55.CB (T0340)I72.CB 3.8680 6.4467 8.3806 107.0345 Constraint (T0340)V55.CB (T0340)S71.CB 3.2583 5.4306 7.0597 107.0345 Constraint (T0340)V55.CB (T0340)A70.CB 6.2110 10.3517 13.4572 107.0345 Constraint (T0340)V55.CB (T0340)V69.CB 6.2794 10.4657 13.6054 107.0345 Constraint (T0340)V55.CB (T0340)V68.CB 4.3562 7.2604 9.4385 107.0345 Constraint (T0340)V55.CB (T0340)E67.CB 6.0937 10.1561 13.2030 107.0345 Constraint (T0340)V55.CB (T0340)A66.CB 8.2178 13.6963 17.8052 107.0345 Constraint (T0340)E54.CB (T0340)I72.CB 7.0116 11.6861 15.1919 107.0345 Constraint (T0340)E54.CB (T0340)S71.CB 5.9658 9.9430 12.9259 107.0345 Constraint (T0340)E54.CB (T0340)A70.CB 8.8959 14.8265 19.2745 107.0345 Constraint (T0340)E54.CB (T0340)V69.CB 8.9403 14.9005 19.3707 107.0345 Constraint (T0340)E54.CB (T0340)V68.CB 6.2244 10.3740 13.4861 107.0345 Constraint (T0340)E54.CB (T0340)E67.CB 7.6779 12.7965 16.6355 107.0345 Constraint (T0340)E54.CB (T0340)A66.CB 10.2210 17.0350 22.1455 107.0345 Constraint (T0340)I53.CB (T0340)I72.CB 8.1693 13.6156 17.7002 107.0345 Constraint (T0340)I53.CB (T0340)S71.CB 7.6004 12.6674 16.4676 107.0345 Constraint (T0340)I53.CB (T0340)A70.CB 10.1254 16.8757 21.9384 107.0345 Constraint (T0340)I53.CB (T0340)V69.CB 9.4340 15.7234 20.4404 107.0345 Constraint (T0340)I53.CB (T0340)V68.CB 6.4929 10.8215 14.0680 107.0345 Constraint (T0340)I53.CB (T0340)E67.CB 8.3144 13.8574 18.0146 107.0345 Constraint (T0340)I53.CB (T0340)A66.CB 10.4479 17.4131 22.6370 107.0345 Constraint (T0340)L52.CB (T0340)I72.CB 5.4300 9.0500 11.7650 107.0345 Constraint (T0340)L52.CB (T0340)S71.CB 6.0388 10.0647 13.0842 107.0345 Constraint (T0340)L52.CB (T0340)A70.CB 8.1493 13.5822 17.6568 107.0345 Constraint (T0340)L52.CB (T0340)V69.CB 6.6623 11.1038 14.4350 107.0345 Constraint (T0340)L52.CB (T0340)V68.CB 4.2883 7.1472 9.2914 107.0345 Constraint (T0340)L52.CB (T0340)E67.CB 7.0835 11.8059 15.3477 107.0345 Constraint (T0340)L52.CB (T0340)A66.CB 8.4303 14.0504 18.2656 107.0345 Constraint (T0340)Q49.CB (T0340)I72.CB 10.7817 17.9694 23.3602 107.0345 Constraint (T0340)Q49.CB (T0340)V69.CB 11.1869 18.6448 24.2383 107.0345 Constraint (T0340)Q49.CB (T0340)V68.CB 9.8092 16.3486 21.2532 107.0345 Constraint (T0340)A48.CB (T0340)I72.CB 10.0124 16.6873 21.6935 107.0345 Constraint (T0340)A48.CB (T0340)S71.CB 12.1926 20.3210 26.4173 107.0345 Constraint (T0340)A48.CB (T0340)V69.CB 10.4989 17.4982 22.7477 107.0345 Constraint (T0340)A48.CB (T0340)V68.CB 9.8583 16.4304 21.3596 107.0345 Constraint (T0340)R47.CB (T0340)I72.CB 10.3190 17.1983 22.3577 107.0345 Constraint (T0340)R47.CB (T0340)V69.CB 11.7047 19.5079 25.3603 107.0345 Constraint (T0340)R47.CB (T0340)V68.CB 10.5695 17.6158 22.9005 107.0345 Constraint (T0340)P37.CB (T0340)I72.CB 11.3154 18.8591 24.5168 107.0345 Constraint (T0340)P37.CB (T0340)V69.CB 12.4943 20.8238 27.0709 107.0345 Constraint (T0340)P37.CB (T0340)L52.CB 11.7114 19.5189 25.3746 107.0345 Constraint (T0340)P37.CB (T0340)Q49.CB 9.9667 16.6112 21.5945 107.0345 Constraint (T0340)P37.CB (T0340)A48.CB 7.2907 12.1512 15.7966 107.0345 Constraint (T0340)P37.CB (T0340)R47.CB 7.7836 12.9727 16.8645 107.0345 Constraint (T0340)D36.CB (T0340)I72.CB 8.4200 14.0333 18.2433 107.0345 Constraint (T0340)D36.CB (T0340)S71.CB 11.5001 19.1669 24.9169 107.0345 Constraint (T0340)D36.CB (T0340)A70.CB 11.9316 19.8861 25.8519 107.0345 Constraint (T0340)D36.CB (T0340)V69.CB 9.4201 15.7002 20.4102 107.0345 Constraint (T0340)D36.CB (T0340)V68.CB 10.4662 17.4437 22.6768 107.0345 Constraint (T0340)D36.CB (T0340)V55.CB 10.7804 17.9673 23.3575 107.0345 Constraint (T0340)D36.CB (T0340)I53.CB 12.8303 21.3839 27.7991 107.0345 Constraint (T0340)D36.CB (T0340)L52.CB 9.5338 15.8897 20.6566 107.0345 Constraint (T0340)D36.CB (T0340)Q49.CB 9.2467 15.4111 20.0345 107.0345 Constraint (T0340)D36.CB (T0340)A48.CB 6.6649 11.1082 14.4407 107.0345 Constraint (T0340)D36.CB (T0340)R47.CB 7.5931 12.6552 16.4518 107.0345 Constraint (T0340)V35.CB (T0340)I72.CB 8.4614 14.1024 18.3331 107.0345 Constraint (T0340)V35.CB (T0340)S71.CB 11.1967 18.6611 24.2595 107.0345 Constraint (T0340)V35.CB (T0340)A70.CB 12.2842 20.4736 26.6157 107.0345 Constraint (T0340)V35.CB (T0340)V69.CB 9.6968 16.1614 21.0098 107.0345 Constraint (T0340)V35.CB (T0340)V68.CB 9.6986 16.1643 21.0136 107.0345 Constraint (T0340)V35.CB (T0340)V55.CB 9.7291 16.2151 21.0796 107.0345 Constraint (T0340)V35.CB (T0340)E54.CB 11.1204 18.5339 24.0941 107.0345 Constraint (T0340)V35.CB (T0340)I53.CB 10.4869 17.4782 22.7216 107.0345 Constraint (T0340)V35.CB (T0340)L52.CB 7.5234 12.5389 16.3006 107.0345 Constraint (T0340)V35.CB (T0340)Q49.CB 6.1311 10.2185 13.2840 107.0345 Constraint (T0340)V35.CB (T0340)A48.CB 3.7441 6.2402 8.1123 107.0345 Constraint (T0340)V35.CB (T0340)R47.CB 4.1948 6.9913 9.0888 107.0345 Constraint (T0340)I32.CB (T0340)I72.CB 6.8581 11.4302 14.8592 107.0345 Constraint (T0340)I32.CB (T0340)S71.CB 8.8436 14.7393 19.1611 107.0345 Constraint (T0340)I32.CB (T0340)A70.CB 10.1678 16.9464 22.0303 107.0345 Constraint (T0340)I32.CB (T0340)V69.CB 7.6439 12.7398 16.5617 107.0345 Constraint (T0340)I32.CB (T0340)V68.CB 6.6658 11.1096 14.4425 107.0345 Constraint (T0340)I32.CB (T0340)E67.CB 9.7584 16.2641 21.1433 107.0345 Constraint (T0340)I32.CB (T0340)A66.CB 9.9055 16.5092 21.4620 107.0345 Constraint (T0340)I32.CB (T0340)V55.CB 7.3099 12.1831 15.8380 107.0345 Constraint (T0340)I32.CB (T0340)E54.CB 8.1868 13.6447 17.7381 107.0345 Constraint (T0340)I32.CB (T0340)I53.CB 7.0280 11.7134 15.2274 107.0345 Constraint (T0340)I32.CB (T0340)L52.CB 4.0464 6.7440 8.7672 107.0345 Constraint (T0340)I32.CB (T0340)Q49.CB 4.0879 6.8131 8.8570 107.0345 Constraint (T0340)I32.CB (T0340)A48.CB 3.4278 5.7130 7.4268 107.0345 Constraint (T0340)I32.CB (T0340)R47.CB 4.2262 7.0436 9.1567 107.0345 Constraint (T0340)Y31.CB (T0340)I72.CB 8.1797 13.6328 17.7226 107.0345 Constraint (T0340)Y31.CB (T0340)S71.CB 9.2886 15.4811 20.1254 107.0345 Constraint (T0340)Y31.CB (T0340)A70.CB 10.3107 17.1845 22.3398 107.0345 Constraint (T0340)Y31.CB (T0340)V69.CB 7.8476 13.0794 17.0032 107.0345 Constraint (T0340)Y31.CB (T0340)V68.CB 6.3227 10.5378 13.6991 107.0345 Constraint (T0340)Y31.CB (T0340)E67.CB 8.9312 14.8853 19.3509 107.0345 Constraint (T0340)Y31.CB (T0340)A66.CB 8.9923 14.9872 19.4833 107.0345 Constraint (T0340)Y31.CB (T0340)V55.CB 8.2013 13.6688 17.7694 107.0345 Constraint (T0340)Y31.CB (T0340)E54.CB 8.4234 14.0391 18.2508 107.0345 Constraint (T0340)Y31.CB (T0340)I53.CB 6.5034 10.8389 14.0906 107.0345 Constraint (T0340)Y31.CB (T0340)L52.CB 4.3830 7.3050 9.4965 107.0345 Constraint (T0340)Y31.CB (T0340)Q49.CB 4.0238 6.7063 8.7181 107.0345 Constraint (T0340)Y31.CB (T0340)A48.CB 4.9807 8.3012 10.7915 107.0345 Constraint (T0340)Y31.CB (T0340)R47.CB 6.3997 10.6662 13.8660 107.0345 Constraint (T0340)S71.CB (T0340)R80.CB 7.1399 11.8999 15.4699 106.1609 Constraint (T0340)A70.CB (T0340)R80.CB 10.0580 16.7633 21.7923 106.1609 Constraint (T0340)A70.CB (T0340)A79.CB 8.0147 13.3578 17.3652 106.1609 Constraint (T0340)V69.CB (T0340)R80.CB 10.1433 16.9054 21.9771 106.1609 Constraint (T0340)V69.CB (T0340)A79.CB 7.8247 13.0411 16.9535 106.1609 Constraint (T0340)V68.CB (T0340)R80.CB 8.5733 14.2889 18.5755 106.1609 Constraint (T0340)V68.CB (T0340)A79.CB 7.2375 12.0626 15.6813 106.1609 Constraint (T0340)E67.CB (T0340)R80.CB 10.4127 17.3544 22.5608 106.1609 Constraint (T0340)E67.CB (T0340)A79.CB 9.2461 15.4102 20.0333 106.1609 Constraint (T0340)V55.CB (T0340)R80.CB 4.4665 7.4442 9.6775 106.1609 Constraint (T0340)V55.CB (T0340)A79.CB 4.0252 6.7087 8.7212 106.1609 Constraint (T0340)E54.CB (T0340)R80.CB 4.8442 8.0737 10.4957 106.1609 Constraint (T0340)E54.CB (T0340)A79.CB 6.4402 10.7337 13.9538 106.1609 Constraint (T0340)I53.CB (T0340)R80.CB 6.9763 11.6272 15.1154 106.1609 Constraint (T0340)I53.CB (T0340)A79.CB 8.2840 13.8067 17.9487 106.1609 Constraint (T0340)L52.CB (T0340)R80.CB 6.7269 11.2116 14.5750 106.1609 Constraint (T0340)L52.CB (T0340)A79.CB 6.4852 10.8086 14.0512 106.1609 Constraint (T0340)A48.CB (T0340)R80.CB 11.8465 19.7441 25.6674 106.1609 Constraint (T0340)R47.CB (T0340)R80.CB 10.1857 16.9762 22.0691 106.1609 Constraint (T0340)P37.CB (T0340)A79.CB 11.2788 18.7980 24.4374 106.1609 Constraint (T0340)D36.CB (T0340)R80.CB 11.5547 19.2578 25.0351 106.1609 Constraint (T0340)D36.CB (T0340)A79.CB 9.0977 15.1628 19.7117 106.1609 Constraint (T0340)V35.CB (T0340)R80.CB 10.3179 17.1965 22.3554 106.1609 Constraint (T0340)V35.CB (T0340)A79.CB 8.7107 14.5179 18.8733 106.1609 Constraint (T0340)I32.CB (T0340)R80.CB 9.0586 15.0976 19.6269 106.1609 Constraint (T0340)I32.CB (T0340)A79.CB 7.9963 13.3272 17.3254 106.1609 Constraint (T0340)Y31.CB (T0340)R80.CB 10.8577 18.0962 23.5251 106.0609 Constraint (T0340)R51.CB (T0340)I72.CB 8.7339 14.5565 18.9235 106.0345 Constraint (T0340)R51.CB (T0340)S71.CB 9.1872 15.3120 19.9056 106.0345 Constraint (T0340)R51.CB (T0340)A70.CB 11.0372 18.3953 23.9139 106.0345 Constraint (T0340)R51.CB (T0340)V69.CB 9.2836 15.4726 20.1144 106.0345 Constraint (T0340)R51.CB (T0340)V68.CB 6.8410 11.4016 14.8221 106.0345 Constraint (T0340)R51.CB (T0340)E67.CB 9.2902 15.4837 20.1288 106.0345 Constraint (T0340)R51.CB (T0340)A66.CB 10.3913 17.3188 22.5145 106.0345 Constraint (T0340)D50.CB (T0340)I72.CB 8.4921 14.1536 18.3997 106.0345 Constraint (T0340)D50.CB (T0340)S71.CB 9.9176 16.5293 21.4881 106.0345 Constraint (T0340)D50.CB (T0340)V69.CB 9.7534 16.2557 21.1325 106.0345 Constraint (T0340)D50.CB (T0340)V68.CB 8.0018 13.3363 17.3371 106.0345 Constraint (T0340)D50.CB (T0340)A66.CB 11.7615 19.6025 25.4833 106.0345 Constraint (T0340)P37.CB (T0340)R51.CB 12.7939 21.3232 27.7202 106.0345 Constraint (T0340)P37.CB (T0340)D50.CB 9.9005 16.5009 21.4512 106.0345 Constraint (T0340)D36.CB (T0340)R51.CB 11.1648 18.6080 24.1904 106.0345 Constraint (T0340)D36.CB (T0340)D50.CB 8.7001 14.5001 18.8502 106.0345 Constraint (T0340)V35.CB (T0340)R51.CB 8.4433 14.0722 18.2938 106.0345 Constraint (T0340)V35.CB (T0340)D50.CB 5.5940 9.3233 12.1202 106.0345 Constraint (T0340)S34.CB (T0340)I72.CB 8.7247 14.5411 18.9035 106.0345 Constraint (T0340)S34.CB (T0340)S71.CB 11.3543 18.9239 24.6010 106.0345 Constraint (T0340)S34.CB (T0340)A70.CB 11.6950 19.4916 25.3391 106.0345 Constraint (T0340)S34.CB (T0340)V69.CB 8.6911 14.4852 18.8307 106.0345 Constraint (T0340)S34.CB (T0340)V68.CB 9.1955 15.3259 19.9236 106.0345 Constraint (T0340)S34.CB (T0340)E67.CB 12.0179 20.0298 26.0387 106.0345 Constraint (T0340)S34.CB (T0340)A66.CB 11.0403 18.4006 23.9207 106.0345 Constraint (T0340)S34.CB (T0340)V55.CB 10.6510 17.7516 23.0771 106.0345 Constraint (T0340)S34.CB (T0340)E54.CB 12.2440 20.4066 26.5286 106.0345 Constraint (T0340)S34.CB (T0340)I53.CB 11.3047 18.8411 24.4934 106.0345 Constraint (T0340)S34.CB (T0340)L52.CB 8.0841 13.4734 17.5155 106.0345 Constraint (T0340)S34.CB (T0340)R51.CB 8.6780 14.4633 18.8023 106.0345 Constraint (T0340)S34.CB (T0340)D50.CB 6.8013 11.3355 14.7362 106.0345 Constraint (T0340)S34.CB (T0340)Q49.CB 6.1709 10.2848 13.3702 106.0345 Constraint (T0340)S34.CB (T0340)A48.CB 3.7344 6.2240 8.0912 106.0345 Constraint (T0340)S34.CB (T0340)R47.CB 6.1820 10.3033 13.3943 106.0345 Constraint (T0340)R33.CB (T0340)I72.CB 8.1777 13.6295 17.7183 106.0345 Constraint (T0340)R33.CB (T0340)S71.CB 10.2392 17.0654 22.1850 106.0345 Constraint (T0340)R33.CB (T0340)A70.CB 10.5623 17.6038 22.8849 106.0345 Constraint (T0340)R33.CB (T0340)V69.CB 7.5339 12.5565 16.3234 106.0345 Constraint (T0340)R33.CB (T0340)V68.CB 7.5048 12.5080 16.2604 106.0345 Constraint (T0340)R33.CB (T0340)E67.CB 10.1960 16.9933 22.0913 106.0345 Constraint (T0340)R33.CB (T0340)A66.CB 9.2815 15.4691 20.1099 106.0345 Constraint (T0340)R33.CB (T0340)V55.CB 9.6775 16.1292 20.9679 106.0345 Constraint (T0340)R33.CB (T0340)E54.CB 10.9286 18.2143 23.6786 106.0345 Constraint (T0340)R33.CB (T0340)I53.CB 9.6342 16.0570 20.8741 106.0345 Constraint (T0340)R33.CB (T0340)L52.CB 6.6034 11.0056 14.3073 106.0345 Constraint (T0340)R33.CB (T0340)R51.CB 6.7514 11.2524 14.6281 106.0345 Constraint (T0340)R33.CB (T0340)D50.CB 5.9375 9.8959 12.8647 106.0345 Constraint (T0340)R33.CB (T0340)Q49.CB 5.1051 8.5085 11.0610 106.0345 Constraint (T0340)R33.CB (T0340)A48.CB 3.8939 6.4898 8.4368 106.0345 Constraint (T0340)R33.CB (T0340)R47.CB 6.5536 10.9226 14.1994 106.0345 Constraint (T0340)I32.CB (T0340)R51.CB 4.6835 7.8059 10.1477 106.0345 Constraint (T0340)I32.CB (T0340)D50.CB 2.8679 4.7799 6.2138 106.0345 Constraint (T0340)Y31.CB (T0340)R51.CB 3.3007 5.5011 7.1514 106.0345 Constraint (T0340)Y31.CB (T0340)D50.CB 4.1839 6.9732 9.0651 106.0345 Constraint (T0340)R47.CB (T0340)A79.CB 9.9117 16.5195 21.4753 105.1610 Constraint (T0340)A66.CB (T0340)A79.CB 10.6410 17.7350 23.0555 105.1610 Constraint (T0340)R51.CB (T0340)R80.CB 9.3144 15.5239 20.1811 105.1609 Constraint (T0340)R51.CB (T0340)A79.CB 9.6839 16.1399 20.9819 105.1609 Constraint (T0340)D50.CB (T0340)R80.CB 8.5550 14.2584 18.5359 105.1609 Constraint (T0340)S34.CB (T0340)R80.CB 12.4040 20.6733 26.8753 105.1609 Constraint (T0340)S34.CB (T0340)A79.CB 10.4471 17.4119 22.6354 105.1609 Constraint (T0340)Q49.CB (T0340)R80.CB 11.8459 19.7432 25.6662 105.0610 Constraint (T0340)A48.CB (T0340)A79.CB 10.8616 18.1027 23.5335 105.0610 Constraint (T0340)Y31.CB (T0340)A79.CB 10.1496 16.9160 21.9908 105.0610 Constraint (T0340)R33.CB (T0340)R80.CB 12.1513 20.2522 26.3279 105.0609 Constraint (T0340)R33.CB (T0340)A79.CB 10.5290 17.5484 22.8129 105.0609 Constraint (T0340)N56.CB (T0340)I72.CB 5.5733 9.2888 12.0755 105.0345 Constraint (T0340)N56.CB (T0340)S71.CB 4.6250 7.7083 10.0207 105.0345 Constraint (T0340)N56.CB (T0340)A70.CB 7.4969 12.4949 16.2434 105.0345 Constraint (T0340)N56.CB (T0340)V69.CB 8.4086 14.0144 18.2187 105.0345 Constraint (T0340)N56.CB (T0340)V68.CB 6.9705 11.6175 15.1027 105.0345 Constraint (T0340)N56.CB (T0340)E67.CB 7.9833 13.3054 17.2971 105.0345 Constraint (T0340)N56.CB (T0340)A66.CB 10.3131 17.1885 22.3450 105.0345 Constraint (T0340)R47.CB (T0340)N56.CB 12.0279 20.0464 26.0604 105.0345 Constraint (T0340)A41.CB (T0340)I72.CB 6.7947 11.3245 14.7218 105.0345 Constraint (T0340)A41.CB (T0340)V69.CB 9.0010 15.0016 19.5021 105.0345 Constraint (T0340)A41.CB (T0340)N56.CB 9.1886 15.3143 19.9085 105.0345 Constraint (T0340)A41.CB (T0340)V55.CB 7.8430 13.0716 16.9931 105.0345 Constraint (T0340)A41.CB (T0340)E54.CB 9.5347 15.8912 20.6586 105.0345 Constraint (T0340)A41.CB (T0340)L52.CB 6.7994 11.3323 14.7320 105.0345 Constraint (T0340)V35.CB (T0340)N56.CB 11.6006 19.3344 25.1347 105.0345 Constraint (T0340)I32.CB (T0340)N56.CB 9.7974 16.3289 21.2276 105.0345 Constraint (T0340)I32.CB (T0340)A41.CB 4.8691 8.1151 10.5497 105.0345 Constraint (T0340)Y31.CB (T0340)N56.CB 11.0354 18.3924 23.9101 105.0345 Constraint (T0340)Y31.CB (T0340)A41.CB 8.1670 13.6117 17.6951 105.0345 Constraint (T0340)V55.CB (T0340)H65.CB 7.7489 12.9148 16.7893 104.9127 Constraint (T0340)E54.CB (T0340)H65.CB 9.2660 15.4433 20.0763 104.9127 Constraint (T0340)I53.CB (T0340)H65.CB 8.7552 14.5921 18.9697 104.9127 Constraint (T0340)L52.CB (T0340)H65.CB 6.4954 10.8256 14.0733 104.9127 Constraint (T0340)Q49.CB (T0340)H65.CB 9.9119 16.5199 21.4758 104.9127 Constraint (T0340)A48.CB (T0340)H65.CB 9.9315 16.5525 21.5183 104.9127 Constraint (T0340)R47.CB (T0340)H65.CB 11.5668 19.2779 25.0613 104.9127 Constraint (T0340)D36.CB (T0340)H65.CB 11.0504 18.4173 23.9425 104.9127 Constraint (T0340)V35.CB (T0340)H65.CB 10.5004 17.5007 22.7509 104.9127 Constraint (T0340)I32.CB (T0340)H65.CB 7.4797 12.4662 16.2061 104.9127 Constraint (T0340)Y31.CB (T0340)H65.CB 6.0803 10.1339 13.1741 104.9127 Constraint (T0340)D50.CB (T0340)A79.CB 8.5361 14.2269 18.4949 104.1610 Constraint (T0340)N56.CB (T0340)R80.CB 3.3299 5.5499 7.2149 104.1609 Constraint (T0340)N56.CB (T0340)A79.CB 3.7520 6.2534 8.1294 104.1609 Constraint (T0340)A41.CB (T0340)R80.CB 7.7752 12.9587 16.8463 104.1609 Constraint (T0340)A41.CB (T0340)A79.CB 6.0062 10.0103 13.0134 104.1609 Constraint (T0340)Q49.CB (T0340)A79.CB 11.5398 19.2330 25.0029 104.0611 Constraint (T0340)D36.CB (T0340)A66.CB 12.4224 20.7039 26.9151 104.0403 Constraint (T0340)D36.CB (T0340)E54.CB 12.9041 21.5068 27.9589 104.0403 Constraint (T0340)H65.CB (T0340)R80.CB 11.9045 19.8408 25.7931 104.0390 Constraint (T0340)H65.CB (T0340)A79.CB 10.3451 17.2418 22.4143 104.0390 Constraint (T0340)Q49.CB (T0340)S71.CB 12.3101 20.5168 26.6718 104.0348 Constraint (T0340)R47.CB (T0340)S71.CB 12.2838 20.4730 26.6149 104.0348 Constraint (T0340)Q58.CB (T0340)I72.CB 6.2423 10.4038 13.5250 104.0348 Constraint (T0340)Q58.CB (T0340)S71.CB 3.8366 6.3943 8.3126 104.0348 Constraint (T0340)Q58.CB (T0340)A70.CB 6.5260 10.8766 14.1396 104.0348 Constraint (T0340)Q58.CB (T0340)V69.CB 7.7819 12.9699 16.8609 104.0348 Constraint (T0340)Q58.CB (T0340)V68.CB 5.6154 9.3589 12.1666 104.0348 Constraint (T0340)Q58.CB (T0340)E67.CB 5.7147 9.5245 12.3819 104.0348 Constraint (T0340)L46.CB (T0340)I72.CB 7.6250 12.7083 16.5208 104.0348 Constraint (T0340)L46.CB (T0340)S71.CB 9.8278 16.3797 21.2935 104.0348 Constraint (T0340)L46.CB (T0340)A70.CB 11.7303 19.5505 25.4157 104.0348 Constraint (T0340)L46.CB (T0340)V69.CB 9.7097 16.1828 21.0376 104.0348 Constraint (T0340)L46.CB (T0340)V68.CB 8.7844 14.6406 19.0328 104.0348 Constraint (T0340)L46.CB (T0340)E67.CB 11.8909 19.8181 25.7635 104.0348 Constraint (T0340)L46.CB (T0340)A66.CB 12.5138 20.8564 27.1133 104.0348 Constraint (T0340)L46.CB (T0340)Q58.CB 10.6885 17.8141 23.1584 104.0348 Constraint (T0340)L46.CB (T0340)V55.CB 7.5314 12.5523 16.3179 104.0348 Constraint (T0340)P40.CB (T0340)I72.CB 7.2002 12.0003 15.6003 104.0348 Constraint (T0340)P40.CB (T0340)S71.CB 9.9194 16.5323 21.4919 104.0348 Constraint (T0340)P40.CB (T0340)A70.CB 11.2983 18.8305 24.4797 104.0348 Constraint (T0340)P40.CB (T0340)V69.CB 9.8664 16.4440 21.3772 104.0348 Constraint (T0340)P40.CB (T0340)V68.CB 10.2668 17.1114 22.2448 104.0348 Constraint (T0340)P40.CB (T0340)Q58.CB 11.6357 19.3928 25.2106 104.0348 Constraint (T0340)P40.CB (T0340)V55.CB 8.5020 14.1700 18.4211 104.0348 Constraint (T0340)P40.CB (T0340)E54.CB 10.6238 17.7063 23.0182 104.0348 Constraint (T0340)P40.CB (T0340)I53.CB 11.4595 19.0992 24.8290 104.0348 Constraint (T0340)P40.CB (T0340)L52.CB 8.8301 14.7169 19.1320 104.0348 Constraint (T0340)P40.CB (T0340)Q49.CB 10.9567 18.2612 23.7395 104.0348 Constraint (T0340)P37.CB (T0340)L46.CB 7.3638 12.2730 15.9549 104.0348 Constraint (T0340)D36.CB (T0340)L46.CB 6.3084 10.5140 13.6682 104.0348 Constraint (T0340)V35.CB (T0340)L46.CB 3.5887 5.9812 7.7755 104.0348 Constraint (T0340)I32.CB (T0340)Q58.CB 10.1818 16.9696 22.0605 104.0348 Constraint (T0340)I32.CB (T0340)L46.CB 3.6783 6.1304 7.9696 104.0348 Constraint (T0340)Y31.CB (T0340)Q58.CB 10.2952 17.1587 22.3063 104.0348 Constraint (T0340)Y31.CB (T0340)L46.CB 6.7521 11.2536 14.6296 104.0348 Constraint (T0340)Y31.CB (T0340)P40.CB 10.8638 18.1063 23.5382 104.0348 Constraint (T0340)V60.CB (T0340)I72.CB 5.6467 9.4112 12.2346 104.0345 Constraint (T0340)V60.CB (T0340)S71.CB 4.3833 7.3056 9.4972 104.0345 Constraint (T0340)V60.CB (T0340)A70.CB 6.5137 10.8562 14.1131 104.0345 Constraint (T0340)V60.CB (T0340)V69.CB 6.2023 10.3372 13.4384 104.0345 Constraint (T0340)R51.CB (T0340)V60.CB 5.5234 9.2056 11.9673 104.0345 Constraint (T0340)D50.CB (T0340)V60.CB 7.3539 12.2565 15.9334 104.0345 Constraint (T0340)Q49.CB (T0340)V60.CB 9.5947 15.9912 20.7886 104.0345 Constraint (T0340)A48.CB (T0340)V60.CB 10.3556 17.2593 22.4370 104.0345 Constraint (T0340)R47.CB (T0340)V60.CB 10.3687 17.2812 22.4656 104.0345 Constraint (T0340)A41.CB (T0340)D50.CB 6.0479 10.0798 13.1037 104.0345 Constraint (T0340)D36.CB (T0340)V60.CB 12.1037 20.1728 26.2246 104.0345 Constraint (T0340)V35.CB (T0340)V60.CB 10.6202 17.7003 23.0103 104.0345 Constraint (T0340)S34.CB (T0340)V60.CB 10.7173 17.8621 23.2208 104.0345 Constraint (T0340)S34.CB (T0340)N56.CB 12.9799 21.6332 28.1232 104.0345 Constraint (T0340)R33.CB (T0340)V60.CB 8.8860 14.8100 19.2530 104.0345 Constraint (T0340)I32.CB (T0340)V60.CB 7.1458 11.9097 15.4826 104.0345 Constraint (T0340)Y31.CB (T0340)V60.CB 6.4889 10.8148 14.0593 104.0345 Constraint (T0340)N56.CB (T0340)K73.CB 7.3560 12.2601 15.9381 104.0345 Constraint (T0340)V55.CB (T0340)K73.CB 6.4456 10.7426 13.9654 104.0345 Constraint (T0340)E54.CB (T0340)K73.CB 9.6940 16.1567 21.0038 104.0345 Constraint (T0340)I53.CB (T0340)K73.CB 11.0757 18.4595 23.9973 104.0345 Constraint (T0340)L52.CB (T0340)K73.CB 8.4488 14.0813 18.3057 104.0345 Constraint (T0340)A48.CB (T0340)K73.CB 12.3886 20.6476 26.8419 104.0345 Constraint (T0340)A41.CB (T0340)K73.CB 8.9387 14.8978 19.3672 104.0345 Constraint (T0340)D36.CB (T0340)K73.CB 9.4970 15.8283 20.5768 104.0345 Constraint (T0340)V35.CB (T0340)K73.CB 10.5101 17.5169 22.7719 104.0345 Constraint (T0340)I32.CB (T0340)K73.CB 9.4960 15.8267 20.5748 104.0345 Constraint (T0340)Y31.CB (T0340)K73.CB 10.6963 17.8271 23.1753 104.0345 Constraint (T0340)V35.CB (T0340)A66.CB 12.4881 20.8135 27.0576 104.0345 Constraint (T0340)R51.CB (T0340)H65.CB 7.8271 13.0452 16.9588 103.9127 Constraint (T0340)D50.CB (T0340)H65.CB 9.2785 15.4642 20.1035 103.9127 Constraint (T0340)S34.CB (T0340)H65.CB 8.8614 14.7690 19.1997 103.9127 Constraint (T0340)R33.CB (T0340)H65.CB 6.6550 11.0917 14.4192 103.9127 Constraint (T0340)A66.CB (T0340)R75.CB 9.3927 15.6544 20.3508 103.4137 Constraint (T0340)V55.CB (T0340)R75.CB 4.5212 7.5353 9.7958 103.4137 Constraint (T0340)E54.CB (T0340)R75.CB 7.5196 12.5327 16.2925 103.4137 Constraint (T0340)L52.CB (T0340)R75.CB 7.8147 13.0246 16.9319 103.4137 Constraint (T0340)D36.CB (T0340)R75.CB 10.3375 17.2292 22.3980 103.4137 Constraint (T0340)V35.CB (T0340)R75.CB 10.6154 17.6924 23.0001 103.4137 Constraint (T0340)I32.CB (T0340)R75.CB 9.6596 16.0993 20.9291 103.4137 Constraint (T0340)Q58.CB (T0340)R80.CB 6.2202 10.3670 13.4771 103.1612 Constraint (T0340)Q58.CB (T0340)A79.CB 6.7085 11.1808 14.5350 103.1612 Constraint (T0340)L46.CB (T0340)R80.CB 7.3318 12.2197 15.8856 103.1612 Constraint (T0340)L46.CB (T0340)A79.CB 6.6810 11.1349 14.4754 103.1612 Constraint (T0340)P40.CB (T0340)R80.CB 7.5982 12.6636 16.4627 103.1612 Constraint (T0340)P40.CB (T0340)A79.CB 5.3586 8.9311 11.6104 103.1612 Constraint (T0340)V60.CB (T0340)R80.CB 7.4224 12.3707 16.0819 103.1609 Constraint (T0340)V60.CB (T0340)A79.CB 7.3893 12.3154 16.0101 103.1609 Constraint (T0340)V55.CB (T0340)E76.CB 7.5553 12.5921 16.3698 103.1609 Constraint (T0340)E54.CB (T0340)E76.CB 10.1681 16.9469 22.0310 103.1609 Constraint (T0340)L52.CB (T0340)E76.CB 10.7527 17.9212 23.2976 103.1609 Constraint (T0340)V69.CB (T0340)E78.CB 10.8579 18.0965 23.5255 103.1609 Constraint (T0340)V68.CB (T0340)E78.CB 10.4165 17.3608 22.5690 103.1609 Constraint (T0340)V55.CB (T0340)E78.CB 6.8436 11.4060 14.8278 103.1609 Constraint (T0340)E54.CB (T0340)E78.CB 8.5676 14.2794 18.5632 103.1609 Constraint (T0340)L52.CB (T0340)E78.CB 9.5606 15.9344 20.7147 103.1609 Constraint (T0340)V35.CB (T0340)E78.CB 10.9918 18.3197 23.8156 103.1609 Constraint (T0340)D50.CB (T0340)A70.CB 11.7631 19.6051 25.4866 103.0349 Constraint (T0340)D50.CB (T0340)E67.CB 10.8730 18.1216 23.5581 103.0349 Constraint (T0340)P40.CB (T0340)R51.CB 11.2685 18.7809 24.4152 103.0348 Constraint (T0340)P40.CB (T0340)D50.CB 8.7756 14.6260 19.0138 103.0348 Constraint (T0340)S39.CB (T0340)I72.CB 8.0804 13.4673 17.5075 103.0348 Constraint (T0340)S39.CB (T0340)S71.CB 11.1239 18.5398 24.1017 103.0348 Constraint (T0340)S39.CB (T0340)V69.CB 9.9342 16.5570 21.5241 103.0348 Constraint (T0340)S39.CB (T0340)V68.CB 10.7362 17.8936 23.2617 103.0348 Constraint (T0340)S39.CB (T0340)V55.CB 10.0388 16.7314 21.7508 103.0348 Constraint (T0340)S39.CB (T0340)E54.CB 12.1912 20.3187 26.4143 103.0348 Constraint (T0340)S39.CB (T0340)L52.CB 9.4395 15.7325 20.4523 103.0348 Constraint (T0340)S39.CB (T0340)R51.CB 11.4123 19.0206 24.7268 103.0348 Constraint (T0340)S39.CB (T0340)D50.CB 8.7487 14.5812 18.9555 103.0348 Constraint (T0340)S39.CB (T0340)Q49.CB 10.0912 16.8186 21.8642 103.0348 Constraint (T0340)S39.CB (T0340)A48.CB 7.7810 12.9684 16.8589 103.0348 Constraint (T0340)S34.CB (T0340)L46.CB 6.2675 10.4458 13.5796 103.0348 Constraint (T0340)R33.CB (T0340)L46.CB 6.7932 11.3220 14.7186 103.0348 Constraint (T0340)V60.CB (T0340)K73.CB 8.0692 13.4487 17.4833 103.0345 Constraint (T0340)R51.CB (T0340)K73.CB 11.6520 19.4200 25.2460 103.0345 Constraint (T0340)D50.CB (T0340)K73.CB 11.4470 19.0784 24.8019 103.0345 Constraint (T0340)A42.CB (T0340)I72.CB 9.6743 16.1238 20.9610 103.0345 Constraint (T0340)A42.CB (T0340)S71.CB 12.4814 20.8023 27.0430 103.0345 Constraint (T0340)A42.CB (T0340)V69.CB 11.6398 19.3997 25.2196 103.0345 Constraint (T0340)A42.CB (T0340)N56.CB 12.0104 20.0173 26.0225 103.0345 Constraint (T0340)A42.CB (T0340)V55.CB 10.8350 18.0583 23.4758 103.0345 Constraint (T0340)A42.CB (T0340)E54.CB 12.2805 20.4675 26.6078 103.0345 Constraint (T0340)A42.CB (T0340)I53.CB 12.1538 20.2563 26.3332 103.0345 Constraint (T0340)A42.CB (T0340)L52.CB 9.4856 15.8094 20.5522 103.0345 Constraint (T0340)S34.CB (T0340)K73.CB 10.3188 17.1981 22.3575 103.0345 Constraint (T0340)R33.CB (T0340)K73.CB 10.0544 16.7574 21.7846 103.0345 Constraint (T0340)R33.CB (T0340)A42.CB 8.3992 13.9986 18.1982 103.0345 Constraint (T0340)I32.CB (T0340)A42.CB 6.7557 11.2595 14.6373 103.0345 Constraint (T0340)E61.CB (T0340)I72.CB 8.9665 14.9441 19.4274 103.0345 Constraint (T0340)E61.CB (T0340)S71.CB 7.4549 12.4248 16.1523 103.0345 Constraint (T0340)E61.CB (T0340)A70.CB 9.2130 15.3549 19.9614 103.0345 Constraint (T0340)L52.CB (T0340)E61.CB 5.6659 9.4432 12.2762 103.0345 Constraint (T0340)R51.CB (T0340)E61.CB 5.7250 9.5416 12.4041 103.0345 Constraint (T0340)D50.CB (T0340)E61.CB 8.6038 14.3396 18.6415 103.0345 Constraint (T0340)Q49.CB (T0340)E61.CB 10.3444 17.2407 22.4128 103.0345 Constraint (T0340)R33.CB (T0340)E61.CB 10.6351 17.7252 23.0427 103.0345 Constraint (T0340)I32.CB (T0340)E61.CB 9.1060 15.1766 19.7296 103.0345 Constraint (T0340)Y31.CB (T0340)E61.CB 7.4219 12.3699 16.0808 103.0345 Constraint (T0340)N56.CB (T0340)H65.CB 10.3895 17.3158 22.5105 102.9127 Constraint (T0340)I72.CB (T0340)V84.CB 10.2108 17.0180 22.1234 102.8610 Constraint (T0340)S71.CB (T0340)V84.CB 10.4274 17.3790 22.5928 102.8610 Constraint (T0340)V69.CB (T0340)V84.CB 11.4234 19.0390 24.7507 102.8610 Constraint (T0340)V68.CB (T0340)V84.CB 8.7624 14.6040 18.9852 102.8610 Constraint (T0340)E67.CB (T0340)V84.CB 11.0651 18.4418 23.9743 102.8610 Constraint (T0340)N56.CB (T0340)V84.CB 9.9057 16.5096 21.4624 102.8610 Constraint (T0340)V55.CB (T0340)V84.CB 7.9684 13.2807 17.2649 102.8610 Constraint (T0340)E54.CB (T0340)V84.CB 5.9731 9.9551 12.9417 102.8610 Constraint (T0340)I53.CB (T0340)V84.CB 3.4769 5.7949 7.5333 102.8610 Constraint (T0340)L52.CB (T0340)V84.CB 4.9752 8.2920 10.7797 102.8610 Constraint (T0340)Q49.CB (T0340)V84.CB 6.0454 10.0756 13.0983 102.8610 Constraint (T0340)A48.CB (T0340)V84.CB 8.0598 13.4330 17.4629 102.8610 Constraint (T0340)R47.CB (T0340)V84.CB 6.8161 11.3601 14.7682 102.8610 Constraint (T0340)D36.CB (T0340)V84.CB 12.6213 21.0355 27.3462 102.8610 Constraint (T0340)V35.CB (T0340)V84.CB 9.6671 16.1119 20.9454 102.8610 Constraint (T0340)I32.CB (T0340)V84.CB 6.4877 10.8128 14.0566 102.8610 Constraint (T0340)Y31.CB (T0340)V84.CB 5.9514 9.9190 12.8947 102.8610 Constraint (T0340)N56.CB (T0340)A74.CB 5.8008 9.6681 12.5685 102.4136 Constraint (T0340)V55.CB (T0340)A74.CB 5.9566 9.9277 12.9060 102.4136 Constraint (T0340)E54.CB (T0340)A74.CB 8.9456 14.9093 19.3820 102.4136 Constraint (T0340)L52.CB (T0340)A74.CB 9.1674 15.2790 19.8627 102.4136 Constraint (T0340)V35.CB (T0340)A74.CB 12.5796 20.9660 27.2558 102.4136 Constraint (T0340)I32.CB (T0340)A74.CB 11.2187 18.6978 24.3071 102.4136 Constraint (T0340)S39.CB (T0340)R80.CB 9.9627 16.6045 21.5859 102.1612 Constraint (T0340)S39.CB (T0340)A79.CB 7.5671 12.6118 16.3953 102.1612 Constraint (T0340)I32.CB (T0340)E78.CB 10.9363 18.2271 23.6953 102.1610 Constraint (T0340)A42.CB (T0340)R80.CB 10.2202 17.0337 22.1438 102.1609 Constraint (T0340)A42.CB (T0340)A79.CB 8.6877 14.4795 18.8233 102.1609 Constraint (T0340)V35.CB (T0340)E76.CB 12.2125 20.3542 26.4604 102.1609 Constraint (T0340)E67.CB (T0340)E78.CB 12.0584 20.0973 26.1265 102.0610 Constraint (T0340)A66.CB (T0340)R80.CB 12.4502 20.7503 26.9753 102.0610 Constraint (T0340)I53.CB (T0340)E78.CB 10.6876 17.8127 23.1565 102.0610 Constraint (T0340)R47.CB (T0340)E78.CB 12.0582 20.0970 26.1261 102.0610 Constraint (T0340)E61.CB (T0340)R80.CB 9.7081 16.1801 21.0342 102.0609 Constraint (T0340)D36.CB (T0340)E76.CB 11.4449 19.0748 24.7972 102.0609 Constraint (T0340)A41.CB (T0340)S71.CB 9.3535 15.5892 20.2660 102.0359 Constraint (T0340)A41.CB (T0340)A70.CB 10.8781 18.1301 23.5691 102.0359 Constraint (T0340)A41.CB (T0340)V68.CB 8.6932 14.4887 18.8353 102.0359 Constraint (T0340)A41.CB (T0340)E67.CB 11.6965 19.4942 25.3425 102.0359 Constraint (T0340)A41.CB (T0340)A66.CB 11.9999 19.9998 25.9997 102.0359 Constraint (T0340)A41.CB (T0340)I53.CB 9.5104 15.8507 20.6059 102.0359 Constraint (T0340)N59.CB (T0340)I72.CB 8.2835 13.8059 17.9476 102.0348 Constraint (T0340)N59.CB (T0340)S71.CB 6.2288 10.3814 13.4958 102.0348 Constraint (T0340)N59.CB (T0340)A70.CB 8.6433 14.4055 18.7272 102.0348 Constraint (T0340)N59.CB (T0340)V69.CB 9.2144 15.3573 19.9645 102.0348 Constraint (T0340)N59.CB (T0340)V68.CB 6.2828 10.4713 13.6127 102.0348 Constraint (T0340)Q49.CB (T0340)N59.CB 11.9339 19.8898 25.8567 102.0348 Constraint (T0340)A48.CB (T0340)N59.CB 13.1026 21.8376 28.3889 102.0348 Constraint (T0340)R47.CB (T0340)N59.CB 12.5791 20.9651 27.2546 102.0348 Constraint (T0340)L46.CB (T0340)N59.CB 10.9842 18.3070 23.7991 102.0348 Constraint (T0340)L46.CB (T0340)N56.CB 9.1367 15.2279 19.7963 102.0348 Constraint (T0340)A41.CB (T0340)Q58.CB 11.1848 18.6413 24.2337 102.0348 Constraint (T0340)P40.CB (T0340)N56.CB 8.9853 14.9754 19.4681 102.0348 Constraint (T0340)I32.CB (T0340)N59.CB 10.0217 16.7028 21.7136 102.0348 Constraint (T0340)Y31.CB (T0340)N59.CB 9.2701 15.4501 20.0851 102.0348 Constraint (T0340)A42.CB (T0340)K73.CB 11.5150 19.1917 24.9492 102.0345 Constraint (T0340)L46.CB (T0340)H65.CB 10.5570 17.5949 22.8734 101.9130 Constraint (T0340)R33.CB (T0340)N56.CB 12.3134 20.5223 26.6790 101.9127 Constraint (T0340)V60.CB (T0340)V84.CB 6.7558 11.2597 14.6376 101.8610 Constraint (T0340)R51.CB (T0340)V84.CB 2.8837 4.8062 6.2481 101.8610 Constraint (T0340)D50.CB (T0340)V84.CB 4.1728 6.9547 9.0411 101.8610 Constraint (T0340)S34.CB (T0340)V84.CB 10.6521 17.7535 23.0795 101.8610 Constraint (T0340)R33.CB (T0340)V84.CB 9.1333 15.2221 19.7888 101.8610 Constraint (T0340)Q49.CB (T0340)Q58.CB 13.0124 21.6873 28.1935 101.6130 Constraint (T0340)Q58.CB (T0340)R75.CB 6.1708 10.2846 13.3700 101.4139 Constraint (T0340)L46.CB (T0340)R75.CB 9.1579 15.2631 19.8421 101.4139 Constraint (T0340)P40.CB (T0340)R75.CB 7.3075 12.1791 15.8329 101.4139 Constraint (T0340)S34.CB (T0340)R75.CB 11.6338 19.3896 25.2065 101.4137 Constraint (T0340)N56.CB (T0340)R75.CB 3.9676 6.6126 8.5964 101.4137 Constraint (T0340)A41.CB (T0340)R75.CB 8.1888 13.6480 17.7424 101.4137 Constraint (T0340)V60.CB (T0340)A74.CB 7.9949 13.3248 17.3222 101.4136 Constraint (T0340)H65.CB (T0340)R75.CB 9.8956 16.4927 21.4404 101.2919 Constraint (T0340)N59.CB (T0340)R80.CB 7.7388 12.8980 16.7674 101.1612 Constraint (T0340)N59.CB (T0340)A79.CB 8.9163 14.8604 19.3186 101.1612 Constraint (T0340)E61.CB (T0340)A79.CB 10.4486 17.4144 22.6387 101.1610 Constraint (T0340)N56.CB (T0340)E76.CB 6.0313 10.0522 13.0678 101.1609 Constraint (T0340)A41.CB (T0340)E76.CB 9.5361 15.8934 20.6615 101.1609 Constraint (T0340)N56.CB (T0340)E78.CB 5.1277 8.5462 11.1100 101.1609 Constraint (T0340)A41.CB (T0340)E78.CB 8.0119 13.3531 17.3590 101.1609 Constraint (T0340)D50.CB (T0340)E78.CB 11.1536 18.5894 24.1662 101.0610 Constraint (T0340)Q49.CB (T0340)E67.CB 12.5579 20.9298 27.2088 101.0403 Constraint (T0340)Q49.CB (T0340)A66.CB 12.7057 21.1761 27.5289 101.0403 Constraint (T0340)A48.CB (T0340)A66.CB 12.5090 20.8483 27.1028 101.0403 Constraint (T0340)D36.CB (T0340)E78.CB 11.0470 18.4117 23.9352 101.0390 Constraint (T0340)A41.CB (T0340)V60.CB 9.4973 15.8288 20.5775 101.0359 Constraint (T0340)A41.CB (T0340)R51.CB 8.5618 14.2697 18.5506 101.0359 Constraint (T0340)D50.CB (T0340)N59.CB 9.5070 15.8450 20.5985 101.0348 Constraint (T0340)L46.CB (T0340)V60.CB 8.7491 14.5818 18.9564 101.0348 Constraint (T0340)P40.CB (T0340)V60.CB 11.1244 18.5407 24.1029 101.0348 Constraint (T0340)S39.CB (T0340)N56.CB 11.1439 18.5731 24.1450 101.0348 Constraint (T0340)R33.CB (T0340)N59.CB 12.0958 20.1596 26.2075 101.0348 Constraint (T0340)S44.CB (T0340)I72.CB 8.9471 14.9119 19.3854 101.0348 Constraint (T0340)S44.CB (T0340)V55.CB 8.7628 14.6047 18.9861 101.0348 Constraint (T0340)S44.CB (T0340)E54.CB 9.6665 16.1108 20.9440 101.0348 Constraint (T0340)S44.CB (T0340)I53.CB 10.0394 16.7323 21.7519 101.0348 Constraint (T0340)V35.CB (T0340)S44.CB 5.8318 9.7197 12.6356 101.0348 Constraint (T0340)S34.CB (T0340)S44.CB 9.0309 15.0515 19.5670 101.0348 Constraint (T0340)R33.CB (T0340)S44.CB 10.1368 16.8947 21.9632 101.0348 Constraint (T0340)I32.CB (T0340)S44.CB 7.2390 12.0650 15.6845 101.0348 Constraint (T0340)Y31.CB (T0340)S44.CB 10.3312 17.2187 22.3843 101.0348 Constraint (T0340)N59.CB (T0340)K73.CB 10.4815 17.4691 22.7099 101.0348 Constraint (T0340)Q58.CB (T0340)K73.CB 7.9743 13.2906 17.2777 101.0348 Constraint (T0340)L46.CB (T0340)K73.CB 10.2923 17.1538 22.2999 101.0348 Constraint (T0340)P40.CB (T0340)K73.CB 8.5610 14.2683 18.5488 101.0348 Constraint (T0340)Q30.CB (T0340)I72.CB 5.8257 9.7095 12.6223 101.0345 Constraint (T0340)Q30.CB (T0340)S71.CB 6.1230 10.2050 13.2666 101.0345 Constraint (T0340)Q30.CB (T0340)A70.CB 7.2944 12.1573 15.8045 101.0345 Constraint (T0340)Q30.CB (T0340)V69.CB 5.4572 9.0954 11.8240 101.0345 Constraint (T0340)Q30.CB (T0340)V68.CB 3.1487 5.2479 6.8223 101.0345 Constraint (T0340)Q30.CB (T0340)E67.CB 5.6624 9.4373 12.2685 101.0345 Constraint (T0340)Q30.CB (T0340)A66.CB 6.4156 10.6927 13.9005 101.0345 Constraint (T0340)Q30.CB (T0340)V55.CB 5.5397 9.2328 12.0026 101.0345 Constraint (T0340)Q30.CB (T0340)E54.CB 6.1606 10.2677 13.3480 101.0345 Constraint (T0340)Q30.CB (T0340)I53.CB 5.0650 8.4417 10.9742 101.0345 Constraint (T0340)Q30.CB (T0340)L52.CB 2.8466 4.7444 6.1677 101.0345 Constraint (T0340)Q30.CB (T0340)Q49.CB 7.1182 11.8636 15.4227 101.0345 Constraint (T0340)Q30.CB (T0340)A48.CB 7.7647 12.9412 16.8236 101.0345 Constraint (T0340)Q30.CB (T0340)R47.CB 8.5879 14.3131 18.6070 101.0345 Constraint (T0340)R33.CB (T0340)Q58.CB 12.2261 20.3768 26.4898 100.9130 Constraint (T0340)I72.CB (T0340)V83.CB 7.9415 13.2358 17.2066 100.8612 Constraint (T0340)S71.CB (T0340)V83.CB 8.8322 14.7203 19.1363 100.8612 Constraint (T0340)A70.CB (T0340)V83.CB 11.2969 18.8282 24.4766 100.8612 Constraint (T0340)V69.CB (T0340)V83.CB 9.8505 16.4175 21.3428 100.8612 Constraint (T0340)V68.CB (T0340)V83.CB 7.6649 12.7749 16.6073 100.8612 Constraint (T0340)E67.CB (T0340)V83.CB 10.4123 17.3538 22.5599 100.8612 Constraint (T0340)A66.CB (T0340)V83.CB 11.8670 19.7783 25.7118 100.8612 Constraint (T0340)N56.CB (T0340)V83.CB 7.9033 13.1722 17.1238 100.8612 Constraint (T0340)V55.CB (T0340)V83.CB 6.0981 10.1635 13.2125 100.8612 Constraint (T0340)E54.CB (T0340)V83.CB 5.2304 8.7173 11.3324 100.8612 Constraint (T0340)I53.CB (T0340)V83.CB 4.0699 6.7831 8.8181 100.8612 Constraint (T0340)L52.CB (T0340)V83.CB 3.5291 5.8818 7.6464 100.8612 Constraint (T0340)Q49.CB (T0340)V83.CB 5.9505 9.9175 12.8928 100.8612 Constraint (T0340)A48.CB (T0340)V83.CB 6.8362 11.3937 14.8117 100.8612 Constraint (T0340)R47.CB (T0340)V83.CB 5.1779 8.6299 11.2189 100.8612 Constraint (T0340)A41.CB (T0340)V83.CB 6.4873 10.8121 14.0558 100.8612 Constraint (T0340)P37.CB (T0340)V83.CB 11.3312 18.8853 24.5508 100.8612 Constraint (T0340)D36.CB (T0340)V83.CB 9.9716 16.6193 21.6051 100.8612 Constraint (T0340)V35.CB (T0340)V83.CB 7.2274 12.0456 15.6593 100.8612 Constraint (T0340)I32.CB (T0340)V83.CB 4.6769 7.7949 10.1333 100.8612 Constraint (T0340)Y31.CB (T0340)V83.CB 5.8791 9.7985 12.7380 100.8612 Constraint (T0340)A42.CB (T0340)V84.CB 11.3890 18.9817 24.6762 100.8610 Constraint (T0340)H65.CB (T0340)V84.CB 10.3509 17.2515 22.4269 100.7391 Constraint (T0340)R33.CB (T0340)R75.CB 11.4814 19.1357 24.8764 100.7064 Constraint (T0340)S39.CB (T0340)R75.CB 9.1691 15.2818 19.8663 100.4139 Constraint (T0340)V60.CB (T0340)R75.CB 7.6624 12.7707 16.6019 100.4137 Constraint (T0340)I53.CB (T0340)A74.CB 10.8891 18.1484 23.5930 100.4136 Constraint (T0340)H65.CB (T0340)A74.CB 9.0948 15.1579 19.7053 100.2918 Constraint (T0340)S44.CB (T0340)R80.CB 6.8189 11.3648 14.7742 100.1612 Constraint (T0340)S44.CB (T0340)A79.CB 6.3390 10.5649 13.7344 100.1612 Constraint (T0340)Q58.CB (T0340)E76.CB 8.8243 14.7072 19.1194 100.1612 Constraint (T0340)L46.CB (T0340)E76.CB 10.9463 18.2438 23.7170 100.1612 Constraint (T0340)P40.CB (T0340)E76.CB 7.6907 12.8178 16.6631 100.1612 Constraint (T0340)Q58.CB (T0340)E78.CB 8.6845 14.4742 18.8165 100.1612 Constraint (T0340)L46.CB (T0340)E78.CB 8.8448 14.7413 19.1637 100.1612 Constraint (T0340)P40.CB (T0340)E78.CB 6.3219 10.5366 13.6975 100.1612 Constraint (T0340)V60.CB (T0340)E76.CB 10.7923 17.9871 23.3833 100.1609 Constraint (T0340)V60.CB (T0340)E78.CB 10.3073 17.1788 22.3325 100.1609 Constraint (T0340)A42.CB (T0340)E78.CB 10.0232 16.7054 21.7170 100.1609 Constraint (T0340)Q30.CB (T0340)R80.CB 9.1617 15.2694 19.8503 100.1609 Constraint (T0340)Q30.CB (T0340)A79.CB 8.4198 14.0331 18.2430 100.1609 Constraint (T0340)R51.CB (T0340)E78.CB 12.4807 20.8012 27.0416 100.0611 Constraint (T0340)A42.CB (T0340)V68.CB 11.6485 19.4141 25.2384 100.0359 Constraint (T0340)A42.CB (T0340)V60.CB 12.4693 20.7822 27.0168 100.0359 Constraint (T0340)A42.CB (T0340)R51.CB 10.6625 17.7708 23.1021 100.0359 Constraint (T0340)Y31.CB (T0340)A42.CB 9.8928 16.4880 21.4344 100.0359 Constraint (T0340)S39.CB (T0340)I53.CB 12.4489 20.7481 26.9725 100.0348 Constraint (T0340)S39.CB (T0340)K73.CB 9.2776 15.4626 20.1014 100.0348 Constraint (T0340)L46.CB (T0340)E61.CB 10.8756 18.1260 23.5638 100.0348 Constraint (T0340)R43.CB (T0340)I72.CB 10.2630 17.1049 22.2364 100.0348 Constraint (T0340)R43.CB (T0340)V55.CB 10.9951 18.3251 23.8226 100.0348 Constraint (T0340)R43.CB (T0340)L52.CB 10.5822 17.6370 22.9280 100.0348 Constraint (T0340)S34.CB (T0340)R43.CB 9.1189 15.1982 19.7577 100.0348 Constraint (T0340)I32.CB (T0340)R43.CB 8.8038 14.6731 19.0750 100.0348 Constraint (T0340)Y31.CB (T0340)R43.CB 12.0935 20.1558 26.2026 100.0348 Constraint (T0340)Q30.CB (T0340)R51.CB 4.1122 6.8536 8.9097 100.0345 Constraint (T0340)Q30.CB (T0340)D50.CB 5.7633 9.6055 12.4872 100.0345 Constraint (T0340)A48.CB (T0340)E61.CB 11.7743 19.6238 25.5109 100.0345 Constraint (T0340)R47.CB (T0340)E61.CB 11.7058 19.5096 25.3625 100.0345 Constraint (T0340)E61.CB (T0340)K73.CB 11.2521 18.7535 24.3795 100.0345 Constraint (T0340)D36.CB (T0340)A74.CB 11.9059 19.8432 25.7961 99.9918 Constraint (T0340)D36.CB (T0340)N56.CB 12.2410 20.4016 26.5221 99.9184 Constraint (T0340)A41.CB (T0340)H65.CB 10.4391 17.3985 22.6181 99.9140 Constraint (T0340)A41.CB (T0340)V84.CB 9.4040 15.6733 20.3753 99.8623 Constraint (T0340)N59.CB (T0340)V84.CB 7.4700 12.4500 16.1850 99.8613 Constraint (T0340)Q58.CB (T0340)V84.CB 9.4158 15.6929 20.4008 99.8613 Constraint (T0340)L46.CB (T0340)V84.CB 7.0788 11.7980 15.3374 99.8613 Constraint (T0340)P40.CB (T0340)V84.CB 11.8651 19.7752 25.7078 99.8613 Constraint (T0340)V60.CB (T0340)V83.CB 6.3201 10.5335 13.6935 99.8612 Constraint (T0340)R51.CB (T0340)V83.CB 3.8722 6.4536 8.3897 99.8612 Constraint (T0340)D50.CB (T0340)V83.CB 2.7095 4.5158 5.8705 99.8612 Constraint (T0340)S34.CB (T0340)V83.CB 8.8731 14.7885 19.2251 99.8612 Constraint (T0340)R33.CB (T0340)V83.CB 8.0255 13.3759 17.3886 99.8612 Constraint (T0340)K73.CB (T0340)V83.CB 11.0374 18.3957 23.9144 99.8612 Constraint (T0340)A70.CB (T0340)V84.CB 12.7407 21.2346 27.6049 99.8610 Constraint (T0340)A66.CB (T0340)V84.CB 12.6222 21.0370 27.3481 99.8610 Constraint (T0340)I53.CB (T0340)R75.CB 9.4376 15.7294 20.4482 99.7064 Constraint (T0340)A41.CB (T0340)A74.CB 10.4458 17.4096 22.6325 99.4149 Constraint (T0340)Q58.CB (T0340)A74.CB 6.4337 10.7228 13.9396 99.4139 Constraint (T0340)L46.CB (T0340)A74.CB 11.5965 19.3275 25.1258 99.4139 Constraint (T0340)P40.CB (T0340)A74.CB 9.8799 16.4664 21.4064 99.4139 Constraint (T0340)A42.CB (T0340)R75.CB 10.8557 18.0928 23.5207 99.4137 Constraint (T0340)Y31.CB (T0340)A74.CB 12.1944 20.3241 26.4213 99.4136 Constraint (T0340)S39.CB (T0340)E76.CB 9.8976 16.4961 21.4449 99.1612 Constraint (T0340)S44.CB (T0340)E78.CB 7.0949 11.8248 15.3722 99.1612 Constraint (T0340)R43.CB (T0340)R80.CB 9.2765 15.4608 20.0990 99.1612 Constraint (T0340)R43.CB (T0340)A79.CB 8.0236 13.3726 17.3844 99.1612 Constraint (T0340)R43.CB (T0340)E78.CB 8.4002 14.0004 18.2005 99.1612 Constraint (T0340)S39.CB (T0340)E78.CB 9.0873 15.1456 19.6892 99.1612 Constraint (T0340)A41.CB (T0340)N59.CB 12.0751 20.1252 26.1628 99.0361 Constraint (T0340)S44.CB (T0340)N56.CB 9.2739 15.4566 20.0935 99.0348 Constraint (T0340)Q30.CB (T0340)N56.CB 8.4506 14.0843 18.3095 99.0345 Constraint (T0340)R47.CB (T0340)Q58.CB 12.9837 21.6394 28.1313 98.9130 Constraint (T0340)Q30.CB (T0340)H65.CB 4.0426 6.7376 8.7589 98.9127 Constraint (T0340)A42.CB (T0340)V83.CB 8.5865 14.3109 18.6041 98.8612 Constraint (T0340)E61.CB (T0340)V84.CB 6.4283 10.7139 13.9280 98.8610 Constraint (T0340)H65.CB (T0340)V83.CB 9.7999 16.3331 21.2330 98.7393 Constraint (T0340)S39.CB (T0340)A74.CB 11.2933 18.8222 24.4689 98.4139 Constraint (T0340)S44.CB (T0340)R75.CB 9.1426 15.2377 19.8091 98.4139 Constraint (T0340)I32.CB (T0340)E76.CB 12.0728 20.1213 26.1576 98.1611 Constraint (T0340)A42.CB (T0340)E76.CB 11.6382 19.3970 25.2161 98.1610 Constraint (T0340)I72.CB (T0340)L81.CB 5.4272 9.0453 11.7589 98.1609 Constraint (T0340)S71.CB (T0340)L81.CB 6.3537 10.5895 13.7663 98.1609 Constraint (T0340)A70.CB (T0340)L81.CB 9.0320 15.0533 19.5693 98.1609 Constraint (T0340)V69.CB (T0340)L81.CB 8.1615 13.6025 17.6833 98.1609 Constraint (T0340)V68.CB (T0340)L81.CB 6.3854 10.6424 13.8351 98.1609 Constraint (T0340)E67.CB (T0340)L81.CB 8.9524 14.9207 19.3969 98.1609 Constraint (T0340)A66.CB (T0340)L81.CB 10.5988 17.6646 22.9640 98.1609 Constraint (T0340)N56.CB (T0340)L81.CB 4.8143 8.0238 10.4309 98.1609 Constraint (T0340)V55.CB (T0340)L81.CB 3.5004 5.8340 7.5842 98.1609 Constraint (T0340)E54.CB (T0340)L81.CB 4.2106 7.0176 9.1229 98.1609 Constraint (T0340)I53.CB (T0340)L81.CB 5.0923 8.4871 11.0332 98.1609 Constraint (T0340)L52.CB (T0340)L81.CB 3.6413 6.0689 7.8895 98.1609 Constraint (T0340)Q49.CB (T0340)L81.CB 8.6043 14.3405 18.6426 98.1609 Constraint (T0340)A48.CB (T0340)L81.CB 8.5779 14.2966 18.5855 98.1609 Constraint (T0340)R47.CB (T0340)L81.CB 7.2927 12.1546 15.8009 98.1609 Constraint (T0340)A41.CB (T0340)L81.CB 5.5617 9.2695 12.0504 98.1609 Constraint (T0340)P37.CB (T0340)L81.CB 11.1387 18.5644 24.1338 98.1609 Constraint (T0340)D36.CB (T0340)L81.CB 9.2534 15.4224 20.0491 98.1609 Constraint (T0340)V35.CB (T0340)L81.CB 7.5332 12.5553 16.3219 98.1609 Constraint (T0340)I32.CB (T0340)L81.CB 5.6785 9.4641 12.3034 98.1609 Constraint (T0340)Y31.CB (T0340)L81.CB 7.5157 12.5262 16.2840 98.1609 Constraint (T0340)A48.CB (T0340)E67.CB 12.7504 21.2507 27.6259 98.0406 Constraint (T0340)S44.CB (T0340)S71.CB 11.0085 18.3476 23.8518 98.0362 Constraint (T0340)S44.CB (T0340)V69.CB 11.6702 19.4503 25.2854 98.0362 Constraint (T0340)S44.CB (T0340)V68.CB 10.9983 18.3306 23.8298 98.0362 Constraint (T0340)S39.CB (T0340)V60.CB 11.9623 19.9371 25.9183 98.0348 Constraint (T0340)R43.CB (T0340)N56.CB 11.4479 19.0799 24.8038 98.0348 Constraint (T0340)Q30.CB (T0340)Q58.CB 7.1675 11.9458 15.5295 98.0348 Constraint (T0340)Q30.CB (T0340)L46.CB 7.5863 12.6439 16.4371 98.0348 Constraint (T0340)Q30.CB (T0340)P40.CB 10.5957 17.6596 22.9574 98.0348 Constraint (T0340)Q30.CB (T0340)V60.CB 3.2977 5.4962 7.1451 98.0345 Constraint (T0340)Q30.CB (T0340)K73.CB 8.3224 13.8707 18.0319 98.0345 Constraint (T0340)H22.CB (T0340)I72.CB 7.8282 13.0471 16.9612 97.9918 Constraint (T0340)H22.CB (T0340)S71.CB 9.2669 15.4449 20.0784 97.9918 Constraint (T0340)H22.CB (T0340)A70.CB 9.3887 15.6479 20.3423 97.9918 Constraint (T0340)H22.CB (T0340)V69.CB 6.4906 10.8177 14.0631 97.9918 Constraint (T0340)H22.CB (T0340)V68.CB 6.1794 10.2990 13.3886 97.9918 Constraint (T0340)H22.CB (T0340)E67.CB 8.5182 14.1971 18.4562 97.9918 Constraint (T0340)H22.CB (T0340)A66.CB 7.5287 12.5479 16.3123 97.9918 Constraint (T0340)H22.CB (T0340)H65.CB 4.6612 7.7686 10.0992 97.9918 Constraint (T0340)H22.CB (T0340)V55.CB 9.1389 15.2316 19.8010 97.9918 Constraint (T0340)H22.CB (T0340)E54.CB 10.2870 17.1450 22.2885 97.9918 Constraint (T0340)H22.CB (T0340)I53.CB 8.9291 14.8819 19.3464 97.9918 Constraint (T0340)H22.CB (T0340)L52.CB 6.1773 10.2954 13.3841 97.9918 Constraint (T0340)H22.CB (T0340)R51.CB 6.2947 10.4912 13.6385 97.9918 Constraint (T0340)H22.CB (T0340)D50.CB 6.7468 11.2447 14.6181 97.9918 Constraint (T0340)H22.CB (T0340)Q49.CB 6.1575 10.2626 13.3413 97.9918 Constraint (T0340)H22.CB (T0340)A48.CB 5.9742 9.9569 12.9440 97.9918 Constraint (T0340)H22.CB (T0340)R47.CB 8.2790 13.7984 17.9379 97.9918 Constraint (T0340)H22.CB (T0340)P37.CB 10.9944 18.3239 23.8211 97.9918 Constraint (T0340)H22.CB (T0340)D36.CB 8.7505 14.5841 18.9593 97.9918 Constraint (T0340)H22.CB (T0340)V35.CB 7.4981 12.4968 16.2458 97.9918 Constraint (T0340)H22.CB (T0340)S34.CB 5.3161 8.8602 11.5183 97.9918 Constraint (T0340)H22.CB (T0340)R33.CB 2.6417 4.4029 5.7237 97.9918 Constraint (T0340)H22.CB (T0340)I32.CB 4.7266 7.8777 10.2410 97.9918 Constraint (T0340)H22.CB (T0340)Y31.CB 3.1445 5.2408 6.8131 97.9918 Constraint (T0340)N59.CB (T0340)V83.CB 7.7699 12.9498 16.8347 97.8615 Constraint (T0340)Q58.CB (T0340)V83.CB 8.4779 14.1298 18.3688 97.8615 Constraint (T0340)L46.CB (T0340)V83.CB 4.1425 6.9041 8.9753 97.8615 Constraint (T0340)P40.CB (T0340)V83.CB 8.6227 14.3711 18.6825 97.8615 Constraint (T0340)D50.CB (T0340)R75.CB 10.5415 17.5692 22.8399 97.7064 Constraint (T0340)R47.CB (T0340)R75.CB 12.1692 20.2819 26.3665 97.7064 Constraint (T0340)Y31.CB (T0340)R75.CB 11.1697 18.6161 24.2009 97.7064 Constraint (T0340)R43.CB (T0340)R75.CB 10.3786 17.2976 22.4869 97.4139 Constraint (T0340)N59.CB (T0340)A74.CB 9.4082 15.6803 20.3843 97.4139 Constraint (T0340)R33.CB (T0340)A74.CB 12.2902 20.4836 26.6287 97.2918 Constraint (T0340)V68.CB (T0340)D77.CB 10.8093 18.0155 23.4202 97.1609 Constraint (T0340)E67.CB (T0340)D77.CB 12.1273 20.2122 26.2758 97.1609 Constraint (T0340)V55.CB (T0340)D77.CB 7.9114 13.1857 17.1414 97.1609 Constraint (T0340)E54.CB (T0340)D77.CB 10.3181 17.1968 22.3558 97.1609 Constraint (T0340)L52.CB (T0340)D77.CB 10.8727 18.1212 23.5576 97.1609 Constraint (T0340)D36.CB (T0340)D77.CB 10.9945 18.3242 23.8215 97.1609 Constraint (T0340)V35.CB (T0340)D77.CB 11.7421 19.5701 25.4411 97.1609 Constraint (T0340)I32.CB (T0340)D77.CB 12.0083 20.0138 26.0179 97.1609 Constraint (T0340)V60.CB (T0340)L81.CB 5.5779 9.2965 12.0854 97.1609 Constraint (T0340)R51.CB (T0340)L81.CB 6.3080 10.5134 13.6674 97.1609 Constraint (T0340)D50.CB (T0340)L81.CB 5.3651 8.9418 11.6244 97.1609 Constraint (T0340)A42.CB (T0340)L81.CB 8.2832 13.8053 17.9469 97.1609 Constraint (T0340)S34.CB (T0340)L81.CB 9.3146 15.5243 20.1816 97.1609 Constraint (T0340)R33.CB (T0340)L81.CB 8.8331 14.7219 19.1384 97.1609 Constraint (T0340)A74.CB (T0340)V83.CB 11.5098 19.1830 24.9379 97.1141 Constraint (T0340)N59.CB (T0340)E78.CB 11.0631 18.4386 23.9701 97.0613 Constraint (T0340)E61.CB (T0340)E78.CB 13.0596 21.7660 28.2957 97.0611 Constraint (T0340)S44.CB (T0340)Q58.CB 11.7273 19.5455 25.4091 97.0362 Constraint (T0340)R33.CB (T0340)R43.CB 10.8766 18.1276 23.5659 97.0362 Constraint (T0340)S39.CB (T0340)A70.CB 11.8621 19.7702 25.7013 97.0351 Constraint (T0340)Q30.CB (T0340)S39.CB 10.7140 17.8567 23.2137 97.0348 Constraint (T0340)R43.CB (T0340)E54.CB 12.3513 20.5854 26.7611 97.0348 Constraint (T0340)Q30.CB (T0340)E61.CB 5.1402 8.5670 11.1371 97.0345 Constraint (T0340)H22.CB (T0340)R80.CB 12.3312 20.5520 26.7176 96.9919 Constraint (T0340)H22.CB (T0340)A79.CB 10.8380 18.0633 23.4823 96.9919 Constraint (T0340)L21.CB (T0340)R80.CB 9.4431 15.7385 20.4601 96.9918 Constraint (T0340)L21.CB (T0340)A79.CB 7.6877 12.8129 16.6567 96.9918 Constraint (T0340)L21.CB (T0340)I72.CB 4.6732 7.7886 10.1252 96.9918 Constraint (T0340)L21.CB (T0340)S71.CB 6.5046 10.8411 14.0934 96.9918 Constraint (T0340)L21.CB (T0340)A70.CB 7.1029 11.8381 15.3896 96.9918 Constraint (T0340)L21.CB (T0340)V69.CB 4.3294 7.2157 9.3804 96.9918 Constraint (T0340)L21.CB (T0340)V68.CB 3.9776 6.6293 8.6181 96.9918 Constraint (T0340)L21.CB (T0340)E67.CB 6.8988 11.4980 14.9474 96.9918 Constraint (T0340)L21.CB (T0340)A66.CB 6.5811 10.9685 14.2590 96.9918 Constraint (T0340)L21.CB (T0340)H65.CB 4.4019 7.3365 9.5374 96.9918 Constraint (T0340)L21.CB (T0340)V55.CB 6.2306 10.3843 13.4995 96.9918 Constraint (T0340)L21.CB (T0340)E54.CB 8.0290 13.3816 17.3961 96.9918 Constraint (T0340)L21.CB (T0340)I53.CB 7.4623 12.4371 16.1682 96.9918 Constraint (T0340)L21.CB (T0340)L52.CB 4.0967 6.8278 8.8761 96.9918 Constraint (T0340)L21.CB (T0340)R51.CB 5.9661 9.9436 12.9266 96.9918 Constraint (T0340)L21.CB (T0340)D50.CB 5.8889 9.8148 12.7592 96.9918 Constraint (T0340)L21.CB (T0340)Q49.CB 6.9369 11.5615 15.0299 96.9918 Constraint (T0340)L21.CB (T0340)A48.CB 6.3562 10.5937 13.7718 96.9918 Constraint (T0340)L21.CB (T0340)R47.CB 7.7371 12.8952 16.7637 96.9918 Constraint (T0340)L21.CB (T0340)P37.CB 10.0968 16.8279 21.8763 96.9918 Constraint (T0340)L21.CB (T0340)D36.CB 7.3697 12.2828 15.9677 96.9918 Constraint (T0340)L21.CB (T0340)V35.CB 6.4025 10.6708 13.8720 96.9918 Constraint (T0340)L21.CB (T0340)S34.CB 5.3931 8.9885 11.6851 96.9918 Constraint (T0340)L21.CB (T0340)R33.CB 3.7317 6.2195 8.0854 96.9918 Constraint (T0340)L21.CB (T0340)I32.CB 3.5891 5.9818 7.7764 96.9918 Constraint (T0340)L21.CB (T0340)Y31.CB 3.9502 6.5837 8.5588 96.9918 Constraint (T0340)S39.CB (T0340)V84.CB 12.4168 20.6947 26.9031 96.8615 Constraint (T0340)S39.CB (T0340)V83.CB 9.4564 15.7607 20.4889 96.8615 Constraint (T0340)S44.CB (T0340)V84.CB 9.6640 16.1067 20.9387 96.8613 Constraint (T0340)E61.CB (T0340)V83.CB 7.5790 12.6316 16.4211 96.8612 Constraint (T0340)Q30.CB (T0340)V84.CB 6.4480 10.7467 13.9707 96.8610 Constraint (T0340)R51.CB (T0340)R75.CB 10.9818 18.3030 23.7939 96.7064 Constraint (T0340)R51.CB (T0340)A74.CB 12.3536 20.5894 26.7662 96.4139 Constraint (T0340)S34.CB (T0340)A74.CB 12.7729 21.2882 27.6746 96.4137 Constraint (T0340)E61.CB (T0340)A74.CB 10.9348 18.2247 23.6921 96.4136 Constraint (T0340)Q30.CB (T0340)A74.CB 9.4126 15.6877 20.3940 96.4136 Constraint (T0340)S44.CB (T0340)E76.CB 9.8422 16.4036 21.3247 96.1616 Constraint (T0340)R43.CB (T0340)E76.CB 10.5215 17.5359 22.7966 96.1612 Constraint (T0340)D50.CB (T0340)A74.CB 12.4663 20.7772 27.0104 96.1139 Constraint (T0340)I72.CB (T0340)L82.CB 7.9341 13.2236 17.1907 96.0611 Constraint (T0340)S71.CB (T0340)L82.CB 7.6833 12.8056 16.6472 96.0611 Constraint (T0340)A70.CB (T0340)L82.CB 10.6096 17.6826 22.9874 96.0611 Constraint (T0340)V69.CB (T0340)L82.CB 10.1635 16.9392 22.0210 96.0611 Constraint (T0340)V68.CB (T0340)L82.CB 7.5849 12.6414 16.4339 96.0611 Constraint (T0340)E67.CB (T0340)L82.CB 9.5927 15.9878 20.7841 96.0611 Constraint (T0340)A66.CB (T0340)L82.CB 11.8319 19.7198 25.6358 96.0611 Constraint (T0340)N56.CB (T0340)L82.CB 5.6458 9.4097 12.2326 96.0611 Constraint (T0340)V55.CB (T0340)L82.CB 4.7191 7.8651 10.2247 96.0611 Constraint (T0340)E54.CB (T0340)L82.CB 2.4659 4.1099 5.3428 96.0611 Constraint (T0340)I53.CB (T0340)L82.CB 2.9916 4.9859 6.4817 96.0611 Constraint (T0340)L52.CB (T0340)L82.CB 4.4913 7.4856 9.7312 96.0611 Constraint (T0340)Q49.CB (T0340)L82.CB 9.2343 15.3905 20.0076 96.0611 Constraint (T0340)A48.CB (T0340)L82.CB 10.1588 16.9314 22.0108 96.0611 Constraint (T0340)R47.CB (T0340)L82.CB 8.5460 14.2434 18.5164 96.0611 Constraint (T0340)A41.CB (T0340)L82.CB 8.5835 14.3059 18.5977 96.0611 Constraint (T0340)D36.CB (T0340)L82.CB 12.3082 20.5136 26.6677 96.0611 Constraint (T0340)V35.CB (T0340)L82.CB 10.1055 16.8424 21.8952 96.0611 Constraint (T0340)I32.CB (T0340)L82.CB 7.5165 12.5275 16.2857 96.0611 Constraint (T0340)Y31.CB (T0340)L82.CB 8.2295 13.7158 17.8306 96.0611 Constraint (T0340)I53.CB (T0340)D77.CB 12.4988 20.8313 27.0807 96.0610 Constraint (T0340)Q30.CB (T0340)E78.CB 11.6427 19.4045 25.2259 96.0610 Constraint (T0340)H65.CB (T0340)L81.CB 9.3251 15.5419 20.2045 96.0390 Constraint (T0340)S44.CB (T0340)V60.CB 10.9100 18.1834 23.6384 96.0362 Constraint (T0340)Q30.CB (T0340)A41.CB 8.3053 13.8422 17.9949 96.0359 Constraint (T0340)Q30.CB (T0340)N59.CB 6.4673 10.7789 14.0126 96.0348 Constraint (T0340)L21.CB (T0340)R75.CB 8.2094 13.6823 17.7870 95.9919 Constraint (T0340)H22.CB (T0340)V60.CB 7.6268 12.7114 16.5248 95.9918 Constraint (T0340)H22.CB (T0340)N56.CB 11.9834 19.9723 25.9640 95.9918 Constraint (T0340)F19.CB (T0340)R80.CB 8.4880 14.1466 18.3906 95.9918 Constraint (T0340)F19.CB (T0340)A79.CB 6.3462 10.5771 13.7502 95.9918 Constraint (T0340)F19.CB (T0340)A74.CB 9.6068 16.0114 20.8148 95.9918 Constraint (T0340)F19.CB (T0340)I72.CB 5.4190 9.0317 11.7412 95.9918 Constraint (T0340)F19.CB (T0340)S71.CB 8.2503 13.7505 17.8757 95.9918 Constraint (T0340)F19.CB (T0340)A70.CB 9.3001 15.5002 20.1503 95.9918 Constraint (T0340)F19.CB (T0340)V69.CB 6.8752 11.4587 14.8963 95.9918 Constraint (T0340)F19.CB (T0340)V68.CB 7.0513 11.7522 15.2778 95.9918 Constraint (T0340)F19.CB (T0340)E67.CB 10.0577 16.7629 21.7917 95.9918 Constraint (T0340)F19.CB (T0340)A66.CB 9.9344 16.5574 21.5246 95.9918 Constraint (T0340)F19.CB (T0340)H65.CB 8.2704 13.7840 17.9192 95.9918 Constraint (T0340)F19.CB (T0340)V60.CB 8.2746 13.7910 17.9283 95.9918 Constraint (T0340)F19.CB (T0340)N56.CB 9.0988 15.1647 19.7141 95.9918 Constraint (T0340)F19.CB (T0340)V55.CB 7.1127 11.8545 15.4108 95.9918 Constraint (T0340)F19.CB (T0340)E54.CB 9.0984 15.1639 19.7131 95.9918 Constraint (T0340)F19.CB (T0340)I53.CB 8.9361 14.8934 19.3614 95.9918 Constraint (T0340)F19.CB (T0340)L52.CB 5.5854 9.3091 12.1018 95.9918 Constraint (T0340)F19.CB (T0340)R51.CB 7.5809 12.6348 16.4253 95.9918 Constraint (T0340)F19.CB (T0340)D50.CB 5.5266 9.2111 11.9744 95.9918 Constraint (T0340)F19.CB (T0340)Q49.CB 7.0123 11.6872 15.1934 95.9918 Constraint (T0340)F19.CB (T0340)A48.CB 5.2764 8.7941 11.4323 95.9918 Constraint (T0340)F19.CB (T0340)R47.CB 5.8679 9.7799 12.7138 95.9918 Constraint (T0340)F19.CB (T0340)A41.CB 2.8320 4.7200 6.1360 95.9918 Constraint (T0340)F19.CB (T0340)P37.CB 6.6177 11.0295 14.3383 95.9918 Constraint (T0340)F19.CB (T0340)D36.CB 4.0416 6.7359 8.7567 95.9918 Constraint (T0340)F19.CB (T0340)V35.CB 3.1150 5.1917 6.7492 95.9918 Constraint (T0340)F19.CB (T0340)S34.CB 4.0809 6.8014 8.8418 95.9918 Constraint (T0340)F19.CB (T0340)R33.CB 4.7803 7.9672 10.3573 95.9918 Constraint (T0340)F19.CB (T0340)I32.CB 3.2462 5.4103 7.0334 95.9918 Constraint (T0340)F19.CB (T0340)Y31.CB 6.1974 10.3290 13.4277 95.9918 Constraint (T0340)P40.CB (T0340)H65.CB 12.2755 20.4591 26.5969 95.9131 Constraint (T0340)R43.CB (T0340)V84.CB 12.3866 20.6444 26.8377 95.8613 Constraint (T0340)N59.CB (T0340)R75.CB 8.8779 14.7964 19.2354 95.7066 Constraint (T0340)N59.CB (T0340)L81.CB 7.1272 11.8787 15.4423 95.1612 Constraint (T0340)Q58.CB (T0340)L81.CB 6.3973 10.6622 13.8609 95.1612 Constraint (T0340)L46.CB (T0340)L81.CB 4.6203 7.7005 10.0107 95.1612 Constraint (T0340)P40.CB (T0340)L81.CB 6.6631 11.1052 14.4367 95.1612 Constraint (T0340)N56.CB (T0340)D77.CB 6.3854 10.6424 13.8351 95.1609 Constraint (T0340)A41.CB (T0340)D77.CB 8.8596 14.7661 19.1959 95.1609 Constraint (T0340)L63.CB (T0340)R80.CB 9.7283 16.2138 21.0780 95.1140 Constraint (T0340)L63.CB (T0340)A79.CB 9.2947 15.4911 20.1384 95.1140 Constraint (T0340)L63.CB (T0340)A74.CB 8.0517 13.4194 17.4452 95.1140 Constraint (T0340)L63.CB (T0340)I72.CB 6.4352 10.7254 13.9430 95.1140 Constraint (T0340)E54.CB (T0340)L63.CB 6.1252 10.2086 13.2712 95.1140 Constraint (T0340)I53.CB (T0340)L63.CB 6.2690 10.4483 13.5827 95.1140 Constraint (T0340)L52.CB (T0340)L63.CB 5.7173 9.5289 12.3876 95.1140 Constraint (T0340)R51.CB (T0340)L63.CB 7.3969 12.3281 16.0266 95.1140 Constraint (T0340)D50.CB (T0340)L63.CB 9.5386 15.8976 20.6669 95.1140 Constraint (T0340)Q49.CB (T0340)L63.CB 11.2371 18.7285 24.3470 95.1140 Constraint (T0340)A48.CB (T0340)L63.CB 11.9279 19.8798 25.8437 95.1140 Constraint (T0340)L46.CB (T0340)L63.CB 11.0036 18.3393 23.8411 95.1140 Constraint (T0340)S34.CB (T0340)L63.CB 11.7784 19.6307 25.5199 95.1140 Constraint (T0340)R33.CB (T0340)L63.CB 9.6680 16.1133 20.9473 95.1140 Constraint (T0340)I32.CB (T0340)L63.CB 8.8583 14.7639 19.1930 95.1140 Constraint (T0340)Y31.CB (T0340)L63.CB 7.5976 12.6626 16.4614 95.1140 Constraint (T0340)V60.CB (T0340)L82.CB 5.3976 8.9960 11.6948 95.0611 Constraint (T0340)R51.CB (T0340)L82.CB 5.7851 9.6418 12.5343 95.0611 Constraint (T0340)D50.CB (T0340)L82.CB 6.0876 10.1460 13.1898 95.0611 Constraint (T0340)A42.CB (T0340)L82.CB 11.0105 18.3508 23.8560 95.0611 Constraint (T0340)S34.CB (T0340)L82.CB 11.7039 19.5066 25.3585 95.0611 Constraint (T0340)R33.CB (T0340)L82.CB 10.6772 17.7953 23.1339 95.0611 Constraint (T0340)K73.CB (T0340)L82.CB 10.8552 18.0919 23.5195 95.0611 Constraint (T0340)S44.CB (T0340)K73.CB 11.0682 18.4469 23.9810 95.0362 Constraint (T0340)A41.CB (T0340)E61.CB 12.1007 20.1679 26.2183 95.0359 Constraint (T0340)Q30.CB (T0340)S44.CB 10.6149 17.6916 22.9991 95.0348 Constraint (T0340)P37.CB (T0340)K73.CB 12.3950 20.6584 26.8559 95.0345 Constraint (T0340)H22.CB (T0340)Q58.CB 11.1816 18.6360 24.2269 94.9921 Constraint (T0340)H22.CB (T0340)L46.CB 8.2683 13.7805 17.9146 94.9921 Constraint (T0340)H22.CB (T0340)P40.CB 11.2185 18.6974 24.3067 94.9921 Constraint (T0340)H22.CB (T0340)S39.CB 10.1711 16.9518 22.0374 94.9921 Constraint (T0340)F19.CB (T0340)R75.CB 7.8575 13.0958 17.0246 94.9919 Constraint (T0340)H22.CB (T0340)V84.CB 8.9619 14.9365 19.4174 94.9919 Constraint (T0340)F19.CB (T0340)V84.CB 9.0980 15.1633 19.7123 94.9919 Constraint (T0340)Y17.CB (T0340)V84.CB 10.6255 17.7091 23.0218 94.9919 Constraint (T0340)Y17.CB (T0340)R80.CB 6.8758 11.4597 14.8976 94.9919 Constraint (T0340)Y17.CB (T0340)A79.CB 3.9024 6.5040 8.4552 94.9919 Constraint (T0340)Y17.CB (T0340)A74.CB 7.4690 12.4484 16.1829 94.9919 Constraint (T0340)Y17.CB (T0340)I72.CB 4.2543 7.0906 9.2178 94.9919 Constraint (T0340)Y17.CB (T0340)S71.CB 7.1575 11.9292 15.5080 94.9919 Constraint (T0340)Y17.CB (T0340)A70.CB 8.3673 13.9455 18.1292 94.9919 Constraint (T0340)Y17.CB (T0340)V69.CB 6.8803 11.4671 14.9072 94.9919 Constraint (T0340)Y17.CB (T0340)V68.CB 7.4038 12.3397 16.0416 94.9919 Constraint (T0340)Y17.CB (T0340)E67.CB 9.9552 16.5919 21.5695 94.9919 Constraint (T0340)Y17.CB (T0340)A66.CB 10.2313 17.0521 22.1678 94.9919 Constraint (T0340)Y17.CB (T0340)H65.CB 9.4865 15.8108 20.5540 94.9919 Constraint (T0340)Y17.CB (T0340)V60.CB 8.5776 14.2961 18.5849 94.9919 Constraint (T0340)Y17.CB (T0340)N56.CB 7.2379 12.0631 15.6821 94.9919 Constraint (T0340)Y17.CB (T0340)V55.CB 6.1762 10.2937 13.3818 94.9919 Constraint (T0340)Y17.CB (T0340)E54.CB 8.7993 14.6656 19.0652 94.9919 Constraint (T0340)Y17.CB (T0340)I53.CB 9.6502 16.0837 20.9088 94.9919 Constraint (T0340)Y17.CB (T0340)L52.CB 6.6693 11.1155 14.4501 94.9919 Constraint (T0340)Y17.CB (T0340)R51.CB 9.5345 15.8909 20.6582 94.9919 Constraint (T0340)Y17.CB (T0340)D50.CB 7.7342 12.8903 16.7573 94.9919 Constraint (T0340)Y17.CB (T0340)Q49.CB 9.9597 16.5995 21.5794 94.9919 Constraint (T0340)Y17.CB (T0340)A48.CB 8.4247 14.0411 18.2535 94.9919 Constraint (T0340)Y17.CB (T0340)R47.CB 8.2715 13.7858 17.9215 94.9919 Constraint (T0340)Y17.CB (T0340)A41.CB 3.3611 5.6019 7.2825 94.9919 Constraint (T0340)Y17.CB (T0340)P37.CB 7.8789 13.1315 17.0710 94.9919 Constraint (T0340)Y17.CB (T0340)D36.CB 5.2083 8.6805 11.2846 94.9919 Constraint (T0340)Y17.CB (T0340)V35.CB 5.6454 9.4090 12.2317 94.9919 Constraint (T0340)Y17.CB (T0340)S34.CB 7.1018 11.8364 15.3873 94.9919 Constraint (T0340)Y17.CB (T0340)R33.CB 7.8522 13.0869 17.0130 94.9919 Constraint (T0340)Y17.CB (T0340)I32.CB 6.0706 10.1176 13.1529 94.9919 Constraint (T0340)Y17.CB (T0340)Y31.CB 8.8277 14.7129 19.1267 94.9919 Constraint (T0340)L21.CB (T0340)A74.CB 8.8637 14.7729 19.2047 94.9918 Constraint (T0340)L21.CB (T0340)V60.CB 5.7110 9.5184 12.3739 94.9918 Constraint (T0340)L21.CB (T0340)N56.CB 8.9627 14.9378 19.4191 94.9918 Constraint (T0340)L21.CB (T0340)A41.CB 6.5876 10.9793 14.2731 94.9918 Constraint (T0340)N20.CB (T0340)R80.CB 11.2624 18.7707 24.4019 94.9918 Constraint (T0340)N20.CB (T0340)A79.CB 8.9397 14.8995 19.3693 94.9918 Constraint (T0340)N20.CB (T0340)A74.CB 10.4649 17.4416 22.6741 94.9918 Constraint (T0340)N20.CB (T0340)I72.CB 6.4444 10.7406 13.9628 94.9918 Constraint (T0340)N20.CB (T0340)S71.CB 9.0503 15.0839 19.6091 94.9918 Constraint (T0340)N20.CB (T0340)A70.CB 9.1251 15.2085 19.7711 94.9918 Constraint (T0340)N20.CB (T0340)V69.CB 6.1031 10.1719 13.2235 94.9918 Constraint (T0340)N20.CB (T0340)V68.CB 7.0349 11.7249 15.2424 94.9918 Constraint (T0340)N20.CB (T0340)E67.CB 9.7044 16.1741 21.0263 94.9918 Constraint (T0340)N20.CB (T0340)A66.CB 8.6217 14.3694 18.6803 94.9918 Constraint (T0340)N20.CB (T0340)H65.CB 6.7676 11.2793 14.6631 94.9918 Constraint (T0340)N20.CB (T0340)V60.CB 9.0039 15.0065 19.5084 94.9918 Constraint (T0340)N20.CB (T0340)N56.CB 11.2150 18.6917 24.2993 94.9918 Constraint (T0340)N20.CB (T0340)V55.CB 8.8349 14.7249 19.1424 94.9918 Constraint (T0340)N20.CB (T0340)E54.CB 10.9127 18.1878 23.6441 94.9918 Constraint (T0340)N20.CB (T0340)I53.CB 10.3710 17.2850 22.4705 94.9918 Constraint (T0340)N20.CB (T0340)L52.CB 6.8964 11.4940 14.9422 94.9918 Constraint (T0340)N20.CB (T0340)R51.CB 8.3398 13.8997 18.0696 94.9918 Constraint (T0340)N20.CB (T0340)D50.CB 7.0957 11.8261 15.3740 94.9918 Constraint (T0340)N20.CB (T0340)Q49.CB 7.2950 12.1583 15.8058 94.9918 Constraint (T0340)N20.CB (T0340)A48.CB 5.4944 9.1573 11.9045 94.9918 Constraint (T0340)N20.CB (T0340)R47.CB 7.5525 12.5875 16.3637 94.9918 Constraint (T0340)N20.CB (T0340)A41.CB 5.9193 9.8655 12.8251 94.9918 Constraint (T0340)N20.CB (T0340)P37.CB 7.4507 12.4179 16.1432 94.9918 Constraint (T0340)N20.CB (T0340)D36.CB 4.7408 7.9013 10.2717 94.9918 Constraint (T0340)N20.CB (T0340)V35.CB 4.7273 7.8789 10.2425 94.9918 Constraint (T0340)N20.CB (T0340)S34.CB 2.7001 4.5001 5.8502 94.9918 Constraint (T0340)N20.CB (T0340)R33.CB 2.8397 4.7328 6.1526 94.9918 Constraint (T0340)N20.CB (T0340)I32.CB 4.2659 7.1098 9.2427 94.9918 Constraint (T0340)N20.CB (T0340)Y31.CB 5.7541 9.5903 12.4673 94.9918 Constraint (T0340)H22.CB (T0340)K73.CB 9.6284 16.0474 20.8616 94.9918 Constraint (T0340)F19.CB (T0340)K73.CB 7.5350 12.5584 16.3259 94.9918 Constraint (T0340)F19.CB (T0340)A42.CB 5.1071 8.5119 11.0655 94.9918 Constraint (T0340)H22.CB (T0340)E61.CB 9.1098 15.1831 19.7380 94.9918 Constraint (T0340)S39.CB (T0340)H65.CB 11.9491 19.9152 25.8897 94.9133 Constraint (T0340)S44.CB (T0340)V83.CB 6.5751 10.9585 14.2460 94.8615 Constraint (T0340)Q30.CB (T0340)V83.CB 6.0198 10.0330 13.0430 94.8612 Constraint (T0340)E61.CB (T0340)R75.CB 10.5649 17.6082 22.8906 94.7064 Constraint (T0340)Q30.CB (T0340)R75.CB 8.8462 14.7436 19.1667 94.4137 Constraint (T0340)R47.CB (T0340)K73.CB 12.9239 21.5399 28.0018 94.4136 Constraint (T0340)R75.CB (T0340)V84.CB 11.7510 19.5850 25.4605 94.4065 Constraint (T0340)R64.CB (T0340)A74.CB 8.8810 14.8017 19.2422 94.2921 Constraint (T0340)V55.CB (T0340)R64.CB 7.9594 13.2657 17.2454 94.2921 Constraint (T0340)E54.CB (T0340)R64.CB 9.1163 15.1939 19.7521 94.2921 Constraint (T0340)I53.CB (T0340)R64.CB 9.0290 15.0484 19.5629 94.2921 Constraint (T0340)L52.CB (T0340)R64.CB 7.7729 12.9549 16.8414 94.2921 Constraint (T0340)I32.CB (T0340)R64.CB 9.9731 16.6219 21.6084 94.2921 Constraint (T0340)Y31.CB (T0340)R64.CB 8.3638 13.9397 18.1216 94.2921 Constraint (T0340)P37.CB (T0340)E78.CB 12.6534 21.0890 27.4157 94.1666 Constraint (T0340)Q58.CB (T0340)D77.CB 9.5767 15.9611 20.7494 94.1612 Constraint (T0340)L46.CB (T0340)D77.CB 10.3963 17.3271 22.5253 94.1612 Constraint (T0340)P40.CB (T0340)D77.CB 6.7092 11.1821 14.5367 94.1612 Constraint (T0340)S44.CB (T0340)L81.CB 5.7399 9.5665 12.4365 94.1612 Constraint (T0340)R43.CB (T0340)L81.CB 8.3717 13.9528 18.1387 94.1612 Constraint (T0340)S39.CB (T0340)L81.CB 8.2459 13.7432 17.8661 94.1612 Constraint (T0340)V60.CB (T0340)D77.CB 11.3737 18.9562 24.6430 94.1609 Constraint (T0340)A42.CB (T0340)D77.CB 10.7705 17.9508 23.3360 94.1609 Constraint (T0340)E61.CB (T0340)L81.CB 8.0765 13.4609 17.4992 94.1609 Constraint (T0340)L63.CB (T0340)V84.CB 8.9946 14.9910 19.4883 94.1140 Constraint (T0340)L63.CB (T0340)K73.CB 8.0945 13.4908 17.5381 94.1140 Constraint (T0340)A48.CB (T0340)A70.CB 13.1920 21.9867 28.5827 94.0403 Constraint (T0340)Q30.CB (T0340)A42.CB 10.9665 18.2776 23.7608 94.0359 Constraint (T0340)R43.CB (T0340)I53.CB 12.7368 21.2280 27.5964 94.0348 Constraint (T0340)L21.CB (T0340)Q58.CB 8.6483 14.4138 18.7380 93.9921 Constraint (T0340)L21.CB (T0340)L46.CB 6.4774 10.7956 14.0343 93.9921 Constraint (T0340)L21.CB (T0340)P40.CB 8.6174 14.3624 18.6711 93.9921 Constraint (T0340)L21.CB (T0340)S39.CB 8.1837 13.6395 17.7313 93.9921 Constraint (T0340)Y17.CB (T0340)R75.CB 5.3146 8.8576 11.5149 93.9920 Constraint (T0340)N20.CB (T0340)R75.CB 9.6344 16.0573 20.8745 93.9919 Constraint (T0340)L21.CB (T0340)V84.CB 8.2818 13.8029 17.9438 93.9919 Constraint (T0340)N20.CB (T0340)V84.CB 10.5241 17.5401 22.8022 93.9919 Constraint (T0340)Y17.CB (T0340)K73.CB 5.8461 9.7435 12.6666 93.9919 Constraint (T0340)Y17.CB (T0340)A42.CB 5.9449 9.9081 12.8806 93.9919 Constraint (T0340)L21.CB (T0340)E76.CB 11.1279 18.5465 24.1105 93.9918 Constraint (T0340)L21.CB (T0340)K73.CB 6.8736 11.4560 14.8928 93.9918 Constraint (T0340)L21.CB (T0340)A42.CB 8.9651 14.9418 19.4243 93.9918 Constraint (T0340)N20.CB (T0340)K73.CB 7.8285 13.0475 16.9618 93.9918 Constraint (T0340)N20.CB (T0340)A42.CB 7.3657 12.2762 15.9591 93.9918 Constraint (T0340)L21.CB (T0340)E78.CB 11.0122 18.3537 23.8599 93.9918 Constraint (T0340)L21.CB (T0340)E61.CB 8.2367 13.7279 17.8462 93.9918 Constraint (T0340)H22.CB (T0340)A74.CB 11.6992 19.4986 25.3482 93.9918 Constraint (T0340)H65.CB (T0340)L82.CB 10.4348 17.3913 22.6087 93.9392 Constraint (T0340)R43.CB (T0340)V83.CB 9.3345 15.5574 20.2247 93.8615 Constraint (T0340)S44.CB (T0340)A74.CB 11.9204 19.8673 25.8275 93.4152 Constraint (T0340)R64.CB (T0340)A79.CB 11.2080 18.6800 24.2840 93.2922 Constraint (T0340)R51.CB (T0340)R64.CB 9.2057 15.3428 19.9456 93.2921 Constraint (T0340)S34.CB (T0340)R64.CB 11.9099 19.8499 25.8048 93.2921 Constraint (T0340)R33.CB (T0340)R64.CB 9.6538 16.0896 20.9165 93.2921 Constraint (T0340)R64.CB (T0340)K73.CB 8.3205 13.8674 18.0277 93.2921 Constraint (T0340)A48.CB (T0340)R75.CB 12.5268 20.8779 27.1413 93.2919 Constraint (T0340)R64.CB (T0340)R80.CB 12.3132 20.5220 26.6786 93.1922 Constraint (T0340)S44.CB (T0340)D77.CB 8.8421 14.7369 19.1579 93.1612 Constraint (T0340)R43.CB (T0340)D77.CB 9.3342 15.5569 20.2240 93.1612 Constraint (T0340)S39.CB (T0340)D77.CB 9.1471 15.2451 19.8187 93.1612 Constraint (T0340)N59.CB (T0340)L82.CB 5.3700 8.9499 11.6349 93.0614 Constraint (T0340)Q58.CB (T0340)L82.CB 6.0351 10.0584 13.0760 93.0614 Constraint (T0340)L46.CB (T0340)L82.CB 6.8813 11.4689 14.9095 93.0614 Constraint (T0340)P40.CB (T0340)L82.CB 9.8583 16.4305 21.3597 93.0614 Constraint (T0340)V35.CB (T0340)E67.CB 12.5700 20.9500 27.2350 93.0407 Constraint (T0340)P40.CB (T0340)E67.CB 12.7493 21.2488 27.6235 93.0363 Constraint (T0340)H22.CB (T0340)A41.CB 8.6663 14.4438 18.7770 92.9931 Constraint (T0340)R64.CB (T0340)V84.CB 11.3053 18.8421 24.4947 92.9922 Constraint (T0340)H22.CB (T0340)R64.CB 7.5388 12.5646 16.3340 92.9921 Constraint (T0340)H22.CB (T0340)L63.CB 7.9915 13.3192 17.3149 92.9921 Constraint (T0340)H22.CB (T0340)N59.CB 10.8526 18.0877 23.5140 92.9921 Constraint (T0340)F19.CB (T0340)R64.CB 10.7355 17.8926 23.2603 92.9921 Constraint (T0340)F19.CB (T0340)L63.CB 9.8748 16.4580 21.3954 92.9921 Constraint (T0340)F19.CB (T0340)N59.CB 11.2287 18.7146 24.3289 92.9921 Constraint (T0340)F19.CB (T0340)Q58.CB 10.2688 17.1147 22.2491 92.9921 Constraint (T0340)F19.CB (T0340)L46.CB 3.7946 6.3243 8.2215 92.9921 Constraint (T0340)F19.CB (T0340)P40.CB 5.0273 8.3788 10.8924 92.9921 Constraint (T0340)F19.CB (T0340)S39.CB 4.3376 7.2293 9.3980 92.9921 Constraint (T0340)H22.CB (T0340)V83.CB 8.4117 14.0196 18.2254 92.9921 Constraint (T0340)F19.CB (T0340)V83.CB 6.4395 10.7325 13.9523 92.9921 Constraint (T0340)Y17.CB (T0340)V83.CB 7.5646 12.6077 16.3900 92.9921 Constraint (T0340)H22.CB (T0340)R75.CB 11.2701 18.7835 24.4186 92.9919 Constraint (T0340)F19.CB (T0340)E76.CB 9.9241 16.5402 21.5022 92.9918 Constraint (T0340)F19.CB (T0340)E78.CB 9.1705 15.2842 19.8695 92.9918 Constraint (T0340)F19.CB (T0340)E61.CB 10.9690 18.2817 23.7662 92.9918 Constraint (T0340)V35.CB (T0340)Q58.CB 12.8627 21.4378 27.8691 92.9130 Constraint (T0340)Q30.CB (T0340)L81.CB 6.2701 10.4502 13.5852 92.1609 Constraint (T0340)A41.CB (T0340)L63.CB 11.4996 19.1660 24.9158 92.1153 Constraint (T0340)L63.CB (T0340)V83.CB 8.8989 14.8315 19.2810 92.1142 Constraint (T0340)L63.CB (T0340)R75.CB 8.5397 14.2328 18.5027 92.1140 Constraint (T0340)S44.CB (T0340)L82.CB 8.1262 13.5436 17.6067 92.0614 Constraint (T0340)R43.CB (T0340)L82.CB 11.0653 18.4422 23.9749 92.0614 Constraint (T0340)S39.CB (T0340)L82.CB 11.4239 19.0398 24.7517 92.0614 Constraint (T0340)E61.CB (T0340)L82.CB 6.4889 10.8148 14.0592 92.0611 Constraint (T0340)P37.CB (T0340)V55.CB 13.1192 21.8653 28.4248 92.0403 Constraint (T0340)S23.CB (T0340)R80.CB 12.1274 20.2124 26.2761 91.9978 Constraint (T0340)S23.CB (T0340)A79.CB 11.0588 18.4313 23.9607 91.9978 Constraint (T0340)S23.CB (T0340)I72.CB 7.7821 12.9701 16.8612 91.9978 Constraint (T0340)S23.CB (T0340)S71.CB 8.2619 13.7699 17.9008 91.9978 Constraint (T0340)S23.CB (T0340)A70.CB 8.5142 14.1903 18.4473 91.9978 Constraint (T0340)S23.CB (T0340)V69.CB 6.2310 10.3851 13.5006 91.9978 Constraint (T0340)S23.CB (T0340)V68.CB 4.9779 8.2965 10.7855 91.9978 Constraint (T0340)S23.CB (T0340)E67.CB 6.7746 11.2911 14.6784 91.9978 Constraint (T0340)S23.CB (T0340)A66.CB 6.3401 10.5668 13.7369 91.9978 Constraint (T0340)S23.CB (T0340)H65.CB 3.3986 5.6643 7.3635 91.9978 Constraint (T0340)S23.CB (T0340)Q58.CB 9.7631 16.2718 21.1533 91.9978 Constraint (T0340)S23.CB (T0340)V55.CB 8.4126 14.0210 18.2273 91.9978 Constraint (T0340)S23.CB (T0340)E54.CB 9.1609 15.2682 19.8486 91.9978 Constraint (T0340)S23.CB (T0340)I53.CB 7.7890 12.9817 16.8762 91.9978 Constraint (T0340)S23.CB (T0340)L52.CB 5.7445 9.5741 12.4464 91.9978 Constraint (T0340)S23.CB (T0340)R51.CB 5.7991 9.6651 12.5647 91.9978 Constraint (T0340)S23.CB (T0340)D50.CB 7.5033 12.5056 16.2572 91.9978 Constraint (T0340)S23.CB (T0340)Q49.CB 7.4631 12.4385 16.1700 91.9978 Constraint (T0340)S23.CB (T0340)A48.CB 8.0647 13.4412 17.4735 91.9978 Constraint (T0340)S23.CB (T0340)R47.CB 9.7940 16.3233 21.2203 91.9978 Constraint (T0340)S23.CB (T0340)L46.CB 9.5736 15.9560 20.7427 91.9978 Constraint (T0340)S23.CB (T0340)S39.CB 12.1327 20.2212 26.2876 91.9978 Constraint (T0340)S23.CB (T0340)D36.CB 11.0373 18.3954 23.9141 91.9978 Constraint (T0340)S23.CB (T0340)V35.CB 9.6701 16.1169 20.9519 91.9978 Constraint (T0340)S23.CB (T0340)S34.CB 7.9846 13.3077 17.3000 91.9978 Constraint (T0340)S23.CB (T0340)R33.CB 5.3245 8.8741 11.5363 91.9978 Constraint (T0340)S23.CB (T0340)I32.CB 6.1823 10.3038 13.3949 91.9978 Constraint (T0340)H22.CB (T0340)A42.CB 10.4272 17.3786 22.5922 91.9931 Constraint (T0340)Y17.CB (T0340)R64.CB 11.3723 18.9538 24.6400 91.9922 Constraint (T0340)Y17.CB (T0340)L63.CB 10.2195 17.0325 22.1423 91.9922 Constraint (T0340)Y17.CB (T0340)N59.CB 11.1264 18.5441 24.1073 91.9922 Constraint (T0340)Y17.CB (T0340)Q58.CB 9.2737 15.4562 20.0931 91.9922 Constraint (T0340)Y17.CB (T0340)L46.CB 5.2478 8.7463 11.3702 91.9922 Constraint (T0340)Y17.CB (T0340)P40.CB 3.1422 5.2370 6.8081 91.9922 Constraint (T0340)Y17.CB (T0340)S39.CB 4.1809 6.9682 9.0586 91.9922 Constraint (T0340)L21.CB (T0340)R64.CB 6.9575 11.5959 15.0746 91.9921 Constraint (T0340)L21.CB (T0340)L63.CB 6.5828 10.9713 14.2627 91.9921 Constraint (T0340)L21.CB (T0340)N59.CB 9.0698 15.1163 19.6512 91.9921 Constraint (T0340)N20.CB (T0340)R64.CB 9.7142 16.1904 21.0475 91.9921 Constraint (T0340)N20.CB (T0340)L63.CB 9.8329 16.3882 21.3046 91.9921 Constraint (T0340)N20.CB (T0340)Q58.CB 11.5732 19.2887 25.0753 91.9921 Constraint (T0340)N20.CB (T0340)L46.CB 6.6138 11.0230 14.3299 91.9921 Constraint (T0340)N20.CB (T0340)P40.CB 7.8383 13.0639 16.9830 91.9921 Constraint (T0340)N20.CB (T0340)S39.CB 6.3388 10.5646 13.7340 91.9921 Constraint (T0340)L21.CB (T0340)S44.CB 9.4787 15.7978 20.5372 91.9921 Constraint (T0340)L21.CB (T0340)V83.CB 6.7690 11.2817 14.6662 91.9921 Constraint (T0340)N20.CB (T0340)V83.CB 8.6167 14.3611 18.6694 91.9921 Constraint (T0340)Y17.CB (T0340)E76.CB 6.8570 11.4283 14.8567 91.9919 Constraint (T0340)Y17.CB (T0340)E78.CB 6.3675 10.6125 13.7962 91.9919 Constraint (T0340)Y17.CB (T0340)E61.CB 11.7309 19.5514 25.4169 91.9919 Constraint (T0340)L21.CB (T0340)Q30.CB 3.2039 5.3398 6.9417 91.9918 Constraint (T0340)N20.CB (T0340)E78.CB 11.9600 19.9333 25.9133 91.9918 Constraint (T0340)E67.CB (T0340)E76.CB 10.7846 17.9743 23.3666 91.9612 Constraint (T0340)K73.CB (T0340)V84.CB 13.1724 21.9540 28.5402 91.8668 Constraint (T0340)D24.CB (T0340)E61.CB 6.9761 11.6269 15.1150 91.4524 Constraint (T0340)D24.CB (T0340)I53.CB 8.1254 13.5423 17.6050 91.4524 Constraint (T0340)D24.CB (T0340)L52.CB 6.7224 11.2039 14.5651 91.4524 Constraint (T0340)D24.CB (T0340)R51.CB 6.3579 10.5965 13.7755 91.4524 Constraint (T0340)D24.CB (T0340)Q49.CB 8.3650 13.9416 18.1241 91.4524 Constraint (T0340)D24.CB (T0340)R33.CB 6.8832 11.4721 14.9137 91.4524 Constraint (T0340)L63.CB (T0340)E78.CB 12.1290 20.2150 26.2795 91.1141 Constraint (T0340)N59.CB (T0340)D77.CB 12.4865 20.8109 27.0541 91.0613 Constraint (T0340)R43.CB (T0340)S71.CB 12.7424 21.2374 27.6086 91.0365 Constraint (T0340)Q30.CB (T0340)R43.CB 12.5593 20.9322 27.2119 91.0362 Constraint (T0340)R43.CB (T0340)K73.CB 11.7809 19.6348 25.5252 91.0362 Constraint (T0340)V35.CB (T0340)E61.CB 12.7128 21.1881 27.5445 91.0345 Constraint (T0340)S34.CB (T0340)E61.CB 12.6633 21.1055 27.4372 91.0345 Constraint (T0340)R64.CB (T0340)V83.CB 11.1744 18.6240 24.2112 90.9923 Constraint (T0340)N20.CB (T0340)N59.CB 12.2971 20.4951 26.6436 90.9922 Constraint (T0340)L21.CB (T0340)R43.CB 10.7898 17.9830 23.3778 90.9921 Constraint (T0340)F19.CB (T0340)S44.CB 6.1490 10.2483 13.3227 90.9921 Constraint (T0340)N20.CB (T0340)E61.CB 11.4725 19.1209 24.8572 90.9919 Constraint (T0340)L21.CB (T0340)D77.CB 11.5304 19.2173 24.9825 90.9918 Constraint (T0340)D24.CB (T0340)H65.CB 4.1590 6.9317 9.0112 90.7451 Constraint (T0340)D24.CB (T0340)V69.CB 7.1932 11.9887 15.5853 90.4524 Constraint (T0340)D24.CB (T0340)V68.CB 5.6713 9.4522 12.2879 90.4524 Constraint (T0340)D24.CB (T0340)E67.CB 6.9210 11.5349 14.9954 90.4524 Constraint (T0340)D24.CB (T0340)A66.CB 6.7199 11.1998 14.5597 90.4524 Constraint (T0340)D50.CB (T0340)R64.CB 11.1531 18.5885 24.1651 90.2924 Constraint (T0340)R64.CB (T0340)R75.CB 10.0833 16.8055 21.8472 90.2921 Constraint (T0340)Q30.CB (T0340)D77.CB 12.5159 20.8598 27.1178 90.1610 Constraint (T0340)Q30.CB (T0340)L82.CB 6.9129 11.5215 14.9779 90.0611 Constraint (T0340)S23.CB (T0340)R64.CB 5.4204 9.0339 11.7441 89.9978 Constraint (T0340)S23.CB (T0340)L63.CB 5.8479 9.7465 12.6704 89.9978 Constraint (T0340)S23.CB (T0340)V60.CB 6.0542 10.0903 13.1173 89.9978 Constraint (T0340)S23.CB (T0340)N59.CB 8.9991 14.9985 19.4980 89.9978 Constraint (T0340)S23.CB (T0340)N56.CB 11.2826 18.8044 24.4457 89.9978 Constraint (T0340)H22.CB (T0340)S44.CB 11.6493 19.4156 25.2402 89.9934 Constraint (T0340)Y17.CB (T0340)S44.CB 5.6872 9.4787 12.3223 89.9922 Constraint (T0340)N20.CB (T0340)S44.CB 9.3155 15.5259 20.1836 89.9921 Constraint (T0340)F19.CB (T0340)R43.CB 6.9176 11.5293 14.9881 89.9921 Constraint (T0340)R11.CB (T0340)R80.CB 6.1265 10.2109 13.2742 89.9921 Constraint (T0340)R11.CB (T0340)A79.CB 4.5875 7.6458 9.9396 89.9921 Constraint (T0340)R11.CB (T0340)R75.CB 6.4916 10.8194 14.0652 89.9921 Constraint (T0340)R11.CB (T0340)I72.CB 8.2570 13.7616 17.8901 89.9921 Constraint (T0340)R11.CB (T0340)S71.CB 10.1526 16.9209 21.9972 89.9921 Constraint (T0340)R11.CB (T0340)V69.CB 11.5119 19.1865 24.9424 89.9921 Constraint (T0340)R11.CB (T0340)V68.CB 11.6328 19.3880 25.2044 89.9921 Constraint (T0340)R11.CB (T0340)Q58.CB 10.9419 18.2366 23.7075 89.9921 Constraint (T0340)R11.CB (T0340)V55.CB 8.4983 14.1638 18.4129 89.9921 Constraint (T0340)R11.CB (T0340)E54.CB 10.4108 17.3514 22.5568 89.9921 Constraint (T0340)R11.CB (T0340)I53.CB 12.0228 20.0380 26.0494 89.9921 Constraint (T0340)R11.CB (T0340)L52.CB 10.2310 17.0516 22.1671 89.9921 Constraint (T0340)R11.CB (T0340)R51.CB 12.9681 21.6136 28.0976 89.9921 Constraint (T0340)R11.CB (T0340)D50.CB 10.8915 18.1525 23.5982 89.9921 Constraint (T0340)R11.CB (T0340)A48.CB 12.3424 20.5706 26.7418 89.9921 Constraint (T0340)R11.CB (T0340)R47.CB 10.9657 18.2762 23.7591 89.9921 Constraint (T0340)R11.CB (T0340)L46.CB 7.7942 12.9903 16.8873 89.9921 Constraint (T0340)R11.CB (T0340)P40.CB 3.9580 6.5967 8.5757 89.9921 Constraint (T0340)R11.CB (T0340)S39.CB 6.7296 11.2159 14.5807 89.9921 Constraint (T0340)R11.CB (T0340)P37.CB 10.2883 17.1472 22.2914 89.9921 Constraint (T0340)R11.CB (T0340)D36.CB 8.9252 14.8754 19.3380 89.9921 Constraint (T0340)R11.CB (T0340)V35.CB 9.2784 15.4639 20.1031 89.9921 Constraint (T0340)R11.CB (T0340)S34.CB 11.7607 19.6012 25.4815 89.9921 Constraint (T0340)R11.CB (T0340)I32.CB 10.3380 17.2300 22.3990 89.9921 Constraint (T0340)L10.CB (T0340)R80.CB 4.6204 7.7007 10.0109 89.9921 Constraint (T0340)L10.CB (T0340)A79.CB 2.9534 4.9223 6.3989 89.9921 Constraint (T0340)L10.CB (T0340)R75.CB 5.6700 9.4500 12.2850 89.9921 Constraint (T0340)L10.CB (T0340)I72.CB 6.1811 10.3019 13.3924 89.9921 Constraint (T0340)L10.CB (T0340)S71.CB 8.3087 13.8478 18.0022 89.9921 Constraint (T0340)L10.CB (T0340)A70.CB 10.3549 17.2582 22.4357 89.9921 Constraint (T0340)L10.CB (T0340)V69.CB 9.3965 15.6608 20.3591 89.9921 Constraint (T0340)L10.CB (T0340)V68.CB 9.0597 15.0995 19.6294 89.9921 Constraint (T0340)L10.CB (T0340)E67.CB 11.5931 19.3219 25.1185 89.9921 Constraint (T0340)L10.CB (T0340)H65.CB 11.7346 19.5576 25.4249 89.9921 Constraint (T0340)L10.CB (T0340)Q58.CB 9.1205 15.2009 19.7612 89.9921 Constraint (T0340)L10.CB (T0340)V55.CB 6.1742 10.2903 13.3774 89.9921 Constraint (T0340)L10.CB (T0340)E54.CB 7.9519 13.2532 17.2292 89.9921 Constraint (T0340)L10.CB (T0340)I53.CB 9.1066 15.1777 19.7310 89.9921 Constraint (T0340)L10.CB (T0340)L52.CB 7.0813 11.8021 15.3428 89.9921 Constraint (T0340)L10.CB (T0340)R51.CB 9.7066 16.1777 21.0310 89.9921 Constraint (T0340)L10.CB (T0340)D50.CB 7.6503 12.7505 16.5756 89.9921 Constraint (T0340)L10.CB (T0340)Q49.CB 10.4854 17.4757 22.7185 89.9921 Constraint (T0340)L10.CB (T0340)A48.CB 9.4014 15.6691 20.3698 89.9921 Constraint (T0340)L10.CB (T0340)R47.CB 8.0750 13.4583 17.4958 89.9921 Constraint (T0340)L10.CB (T0340)L46.CB 4.7865 7.9776 10.3708 89.9921 Constraint (T0340)L10.CB (T0340)P40.CB 3.1320 5.2199 6.7859 89.9921 Constraint (T0340)L10.CB (T0340)S39.CB 5.5702 9.2836 12.0687 89.9921 Constraint (T0340)L10.CB (T0340)P37.CB 9.0732 15.1221 19.6587 89.9921 Constraint (T0340)L10.CB (T0340)D36.CB 7.3529 12.2548 15.9312 89.9921 Constraint (T0340)L10.CB (T0340)V35.CB 6.8050 11.3416 14.7441 89.9921 Constraint (T0340)L10.CB (T0340)S34.CB 9.2318 15.3863 20.0021 89.9921 Constraint (T0340)L10.CB (T0340)R33.CB 9.8946 16.4910 21.4383 89.9921 Constraint (T0340)L10.CB (T0340)I32.CB 7.1594 11.9323 15.5120 89.9921 Constraint (T0340)L10.CB (T0340)Y31.CB 10.0177 16.6962 21.7050 89.9921 Constraint (T0340)L10.CB (T0340)H22.CB 10.9395 18.2325 23.7023 89.9921 Constraint (T0340)N20.CB (T0340)Q30.CB 6.4575 10.7624 13.9911 89.9918 Constraint (T0340)F19.CB (T0340)Q30.CB 6.5483 10.9138 14.1879 89.9918 Constraint (T0340)F19.CB (T0340)D77.CB 9.7264 16.2106 21.0738 89.9918 Constraint (T0340)H22.CB (T0340)L81.CB 9.1090 15.1816 19.7361 89.9918 Constraint (T0340)F19.CB (T0340)L81.CB 5.6777 9.4629 12.3017 89.9918 Constraint (T0340)D24.CB (T0340)A70.CB 9.0300 15.0500 19.5650 89.7451 Constraint (T0340)P28.CB (T0340)N59.CB 7.4559 12.4265 16.1544 89.7348 Constraint (T0340)P28.CB (T0340)E54.CB 8.6490 14.4150 18.7395 89.7348 Constraint (T0340)P28.CB (T0340)I53.CB 6.7798 11.2996 14.6895 89.7348 Constraint (T0340)P28.CB (T0340)L52.CB 7.0041 11.6735 15.1756 89.7348 Constraint (T0340)P28.CB (T0340)Q49.CB 9.0640 15.1067 19.6387 89.7348 Constraint (T0340)D24.CB (T0340)V60.CB 6.4251 10.7084 13.9209 89.4524 Constraint (T0340)D24.CB (T0340)D50.CB 8.3469 13.9115 18.0850 89.4524 Constraint (T0340)A42.CB (T0340)A74.CB 13.1832 21.9720 28.5636 89.2921 Constraint (T0340)R47.CB (T0340)L63.CB 12.3835 20.6392 26.8310 89.1200 Constraint (T0340)V35.CB (T0340)L63.CB 12.2795 20.4658 26.6056 89.1143 Constraint (T0340)Q30.CB (T0340)L63.CB 4.3089 7.1815 9.3359 89.1140 Constraint (T0340)L63.CB (T0340)L81.CB 8.1103 13.5172 17.5724 89.1140 Constraint (T0340)D50.CB (T0340)D77.CB 12.7529 21.2548 27.6312 89.0612 Constraint (T0340)S44.CB (T0340)N59.CB 12.5541 20.9235 27.2005 89.0362 Constraint (T0340)S23.CB (T0340)V84.CB 8.4374 14.0624 18.2811 88.9979 Constraint (T0340)S23.CB (T0340)K73.CB 9.6853 16.1421 20.9848 88.9978 Constraint (T0340)S23.CB (T0340)E61.CB 7.0550 11.7583 15.2858 88.9978 Constraint (T0340)S23.CB (T0340)P40.CB 12.5993 20.9989 27.2986 88.9978 Constraint (T0340)H22.CB (T0340)R43.CB 12.8148 21.3580 27.7654 88.9934 Constraint (T0340)Y17.CB (T0340)R43.CB 6.2916 10.4860 13.6318 88.9922 Constraint (T0340)N20.CB (T0340)R43.CB 9.6879 16.1466 20.9905 88.9921 Constraint (T0340)R11.CB (T0340)L21.CB 10.9471 18.2452 23.7188 88.9921 Constraint (T0340)L10.CB (T0340)L21.CB 8.0383 13.3972 17.4164 88.9921 Constraint (T0340)Y17.CB (T0340)Q30.CB 7.9870 13.3116 17.3051 88.9919 Constraint (T0340)Y17.CB (T0340)D77.CB 6.5200 10.8666 14.1266 88.9919 Constraint (T0340)Y17.CB (T0340)L81.CB 5.2540 8.7567 11.3837 88.9919 Constraint (T0340)N20.CB (T0340)E76.CB 11.8527 19.7545 25.6808 88.9918 Constraint (T0340)L21.CB (T0340)L81.CB 6.3993 10.6655 13.8651 88.9918 Constraint (T0340)N20.CB (T0340)L81.CB 8.2982 13.8304 17.9795 88.9918 Constraint (T0340)P28.CB (T0340)V60.CB 6.1430 10.2383 13.3097 88.7348 Constraint (T0340)P28.CB (T0340)R51.CB 5.9225 9.8708 12.8321 88.7348 Constraint (T0340)P28.CB (T0340)D50.CB 8.8517 14.7528 19.1787 88.7348 Constraint (T0340)P28.CB (T0340)V68.CB 6.8937 11.4895 14.9364 88.7348 Constraint (T0340)P28.CB (T0340)E67.CB 7.6900 12.8167 16.6617 88.7348 Constraint (T0340)P28.CB (T0340)A66.CB 8.4425 14.0709 18.2922 88.7348 Constraint (T0340)P28.CB (T0340)V55.CB 9.3086 15.5143 20.1685 88.7348 Constraint (T0340)P28.CB (T0340)A48.CB 10.6243 17.7072 23.0193 88.7348 Constraint (T0340)D24.CB (T0340)V84.CB 8.7058 14.5097 18.8626 88.4525 Constraint (T0340)D24.CB (T0340)N59.CB 8.8312 14.7186 19.1342 88.4524 Constraint (T0340)D24.CB (T0340)Q58.CB 9.9001 16.5002 21.4503 88.4524 Constraint (T0340)D24.CB (T0340)V55.CB 8.9750 14.9583 19.4458 88.4524 Constraint (T0340)D24.CB (T0340)E54.CB 9.3752 15.6253 20.3129 88.4524 Constraint (T0340)Q49.CB (T0340)R64.CB 12.1330 20.2217 26.2882 88.2978 Constraint (T0340)Q30.CB (T0340)R64.CB 5.5657 9.2761 12.0589 88.2921 Constraint (T0340)R64.CB (T0340)L81.CB 10.4441 17.4068 22.6288 88.2921 Constraint (T0340)P37.CB (T0340)R80.CB 13.1559 21.9266 28.5045 88.1666 Constraint (T0340)S23.CB (T0340)A74.CB 11.1624 18.6039 24.1851 87.9978 Constraint (T0340)R11.CB (T0340)A74.CB 9.4511 15.7518 20.4774 87.9921 Constraint (T0340)R11.CB (T0340)K73.CB 9.2707 15.4512 20.0865 87.9921 Constraint (T0340)R11.CB (T0340)V60.CB 11.8111 19.6852 25.5908 87.9921 Constraint (T0340)R11.CB (T0340)N56.CB 7.5984 12.6640 16.4632 87.9921 Constraint (T0340)R11.CB (T0340)A41.CB 6.3386 10.5644 13.7337 87.9921 Constraint (T0340)L10.CB (T0340)A74.CB 8.7527 14.5879 18.9643 87.9921 Constraint (T0340)L10.CB (T0340)K73.CB 8.1540 13.5900 17.6671 87.9921 Constraint (T0340)L10.CB (T0340)L63.CB 11.2084 18.6807 24.2849 87.9921 Constraint (T0340)L10.CB (T0340)V60.CB 9.1153 15.1921 19.7497 87.9921 Constraint (T0340)L10.CB (T0340)N59.CB 10.8201 18.0335 23.4436 87.9921 Constraint (T0340)L10.CB (T0340)N56.CB 6.3340 10.5566 13.7236 87.9921 Constraint (T0340)L10.CB (T0340)A41.CB 3.8783 6.4638 8.4030 87.9921 Constraint (T0340)L10.CB (T0340)F19.CB 5.3447 8.9079 11.5803 87.9921 Constraint (T0340)H9.CB (T0340)R80.CB 3.0357 5.0596 6.5774 87.9921 Constraint (T0340)H9.CB (T0340)A79.CB 4.3285 7.2141 9.3784 87.9921 Constraint (T0340)H9.CB (T0340)R75.CB 6.9401 11.5668 15.0369 87.9921 Constraint (T0340)H9.CB (T0340)A74.CB 10.2017 17.0029 22.1038 87.9921 Constraint (T0340)H9.CB (T0340)K73.CB 10.5260 17.5434 22.8064 87.9921 Constraint (T0340)H9.CB (T0340)I72.CB 8.3572 13.9287 18.1074 87.9921 Constraint (T0340)H9.CB (T0340)S71.CB 9.4963 15.8272 20.5754 87.9921 Constraint (T0340)H9.CB (T0340)A70.CB 12.1277 20.2128 26.2766 87.9921 Constraint (T0340)H9.CB (T0340)V69.CB 11.7319 19.5531 25.4191 87.9921 Constraint (T0340)H9.CB (T0340)V68.CB 10.6620 17.7699 23.1009 87.9921 Constraint (T0340)H9.CB (T0340)L63.CB 12.1411 20.2352 26.3058 87.9921 Constraint (T0340)H9.CB (T0340)V60.CB 9.7885 16.3142 21.2084 87.9921 Constraint (T0340)H9.CB (T0340)N59.CB 10.4221 17.3701 22.5812 87.9921 Constraint (T0340)H9.CB (T0340)Q58.CB 9.0207 15.0345 19.5449 87.9921 Constraint (T0340)H9.CB (T0340)N56.CB 5.9763 9.9604 12.9486 87.9921 Constraint (T0340)H9.CB (T0340)V55.CB 6.8237 11.3728 14.7846 87.9921 Constraint (T0340)H9.CB (T0340)E54.CB 7.3448 12.2413 15.9137 87.9921 Constraint (T0340)H9.CB (T0340)I53.CB 8.8535 14.7558 19.1825 87.9921 Constraint (T0340)H9.CB (T0340)L52.CB 8.1662 13.6104 17.6935 87.9921 Constraint (T0340)H9.CB (T0340)R51.CB 10.3910 17.3183 22.5137 87.9921 Constraint (T0340)H9.CB (T0340)D50.CB 8.7002 14.5004 18.8505 87.9921 Constraint (T0340)H9.CB (T0340)Q49.CB 11.8929 19.8214 25.7679 87.9921 Constraint (T0340)H9.CB (T0340)A48.CB 11.4428 19.0714 24.7928 87.9921 Constraint (T0340)H9.CB (T0340)R47.CB 9.3662 15.6103 20.2934 87.9921 Constraint (T0340)H9.CB (T0340)L46.CB 6.4939 10.8231 14.0701 87.9921 Constraint (T0340)H9.CB (T0340)A41.CB 6.7055 11.1758 14.5286 87.9921 Constraint (T0340)H9.CB (T0340)P40.CB 6.1334 10.2223 13.2890 87.9921 Constraint (T0340)H9.CB (T0340)S39.CB 8.6721 14.4536 18.7896 87.9921 Constraint (T0340)H9.CB (T0340)P37.CB 11.8483 19.7471 25.6712 87.9921 Constraint (T0340)H9.CB (T0340)D36.CB 10.5623 17.6038 22.8849 87.9921 Constraint (T0340)H9.CB (T0340)V35.CB 9.4506 15.7510 20.4763 87.9921 Constraint (T0340)H9.CB (T0340)S34.CB 12.1017 20.1695 26.2203 87.9921 Constraint (T0340)H9.CB (T0340)R33.CB 12.4287 20.7146 26.9289 87.9921 Constraint (T0340)H9.CB (T0340)I32.CB 9.2313 15.3855 20.0011 87.9921 Constraint (T0340)H9.CB (T0340)Y31.CB 11.6914 19.4857 25.3314 87.9921 Constraint (T0340)H9.CB (T0340)F19.CB 8.3166 13.8611 18.0194 87.9921 Constraint (T0340)C8.CB (T0340)R80.CB 4.3068 7.1780 9.3314 87.9921 Constraint (T0340)C8.CB (T0340)A79.CB 5.2054 8.6757 11.2785 87.9921 Constraint (T0340)C8.CB (T0340)R75.CB 7.9228 13.2047 17.1661 87.9921 Constraint (T0340)C8.CB (T0340)A74.CB 10.9326 18.2210 23.6873 87.9921 Constraint (T0340)C8.CB (T0340)K73.CB 10.6177 17.6962 23.0050 87.9921 Constraint (T0340)C8.CB (T0340)I72.CB 7.8507 13.0845 17.0098 87.9921 Constraint (T0340)C8.CB (T0340)S71.CB 9.2711 15.4519 20.0875 87.9921 Constraint (T0340)C8.CB (T0340)A70.CB 11.8775 19.7959 25.7346 87.9921 Constraint (T0340)C8.CB (T0340)V69.CB 10.7606 17.9343 23.3145 87.9921 Constraint (T0340)C8.CB (T0340)V68.CB 9.3211 15.5352 20.1957 87.9921 Constraint (T0340)C8.CB (T0340)E67.CB 12.0664 20.1107 26.1439 87.9921 Constraint (T0340)C8.CB (T0340)H65.CB 12.0053 20.0088 26.0114 87.9921 Constraint (T0340)C8.CB (T0340)L63.CB 10.8641 18.1069 23.5390 87.9921 Constraint (T0340)C8.CB (T0340)V60.CB 8.3287 13.8811 18.0454 87.9921 Constraint (T0340)C8.CB (T0340)N59.CB 9.4819 15.8032 20.5442 87.9921 Constraint (T0340)C8.CB (T0340)Q58.CB 8.9825 14.9709 19.4622 87.9921 Constraint (T0340)C8.CB (T0340)N56.CB 6.9426 11.5710 15.0424 87.9921 Constraint (T0340)C8.CB (T0340)V55.CB 6.3147 10.5245 13.6818 87.9921 Constraint (T0340)C8.CB (T0340)E54.CB 6.3331 10.5552 13.7218 87.9921 Constraint (T0340)C8.CB (T0340)I53.CB 6.7516 11.2526 14.6284 87.9921 Constraint (T0340)C8.CB (T0340)L52.CB 5.8600 9.7667 12.6967 87.9921 Constraint (T0340)C8.CB (T0340)R51.CB 7.4385 12.3974 16.1166 87.9921 Constraint (T0340)C8.CB (T0340)D50.CB 5.4390 9.0651 11.7846 87.9921 Constraint (T0340)C8.CB (T0340)Q49.CB 8.6009 14.3348 18.6353 87.9921 Constraint (T0340)C8.CB (T0340)A48.CB 8.4385 14.0641 18.2834 87.9921 Constraint (T0340)C8.CB (T0340)R47.CB 6.2285 10.3809 13.4952 87.9921 Constraint (T0340)C8.CB (T0340)L46.CB 3.7235 6.2058 8.0676 87.9921 Constraint (T0340)C8.CB (T0340)A41.CB 5.1644 8.6073 11.1895 87.9921 Constraint (T0340)C8.CB (T0340)P40.CB 6.2180 10.3633 13.4723 87.9921 Constraint (T0340)C8.CB (T0340)S39.CB 7.9027 13.1711 17.1224 87.9921 Constraint (T0340)C8.CB (T0340)D36.CB 9.2531 15.4218 20.0484 87.9921 Constraint (T0340)C8.CB (T0340)V35.CB 7.2049 12.0081 15.6106 87.9921 Constraint (T0340)C8.CB (T0340)S34.CB 9.7863 16.3105 21.2037 87.9921 Constraint (T0340)C8.CB (T0340)R33.CB 9.8378 16.3963 21.3152 87.9921 Constraint (T0340)C8.CB (T0340)I32.CB 6.4268 10.7114 13.9248 87.9921 Constraint (T0340)C8.CB (T0340)Y31.CB 8.7938 14.6564 19.0533 87.9921 Constraint (T0340)C8.CB (T0340)H22.CB 10.7349 17.8916 23.2590 87.9921 Constraint (T0340)C8.CB (T0340)F19.CB 6.4554 10.7590 13.9867 87.9921 Constraint (T0340)L7.CB (T0340)R80.CB 3.9241 6.5401 8.5022 87.9921 Constraint (T0340)L7.CB (T0340)A79.CB 6.7328 11.2213 14.5876 87.9921 Constraint (T0340)L7.CB (T0340)R75.CB 9.0000 15.0000 19.5000 87.9921 Constraint (T0340)L7.CB (T0340)I72.CB 9.5223 15.8705 20.6317 87.9921 Constraint (T0340)L7.CB (T0340)S71.CB 9.9126 16.5209 21.4772 87.9921 Constraint (T0340)L7.CB (T0340)V69.CB 12.3891 20.6485 26.8431 87.9921 Constraint (T0340)L7.CB (T0340)V68.CB 10.3302 17.2170 22.3821 87.9921 Constraint (T0340)L7.CB (T0340)Q58.CB 8.3227 13.8711 18.0325 87.9921 Constraint (T0340)L7.CB (T0340)V55.CB 6.7354 11.2257 14.5934 87.9921 Constraint (T0340)L7.CB (T0340)E54.CB 5.2466 8.7443 11.3676 87.9921 Constraint (T0340)L7.CB (T0340)I53.CB 6.0310 10.0517 13.0672 87.9921 Constraint (T0340)L7.CB (T0340)L52.CB 6.9678 11.6130 15.0968 87.9921 Constraint (T0340)L7.CB (T0340)R51.CB 8.0983 13.4971 17.5463 87.9921 Constraint (T0340)L7.CB (T0340)D50.CB 7.2576 12.0961 15.7249 87.9921 Constraint (T0340)L7.CB (T0340)Q49.CB 10.4813 17.4688 22.7095 87.9921 Constraint (T0340)L7.CB (T0340)A48.CB 11.0415 18.4024 23.9232 87.9921 Constraint (T0340)L7.CB (T0340)R47.CB 8.6801 14.4668 18.8069 87.9921 Constraint (T0340)L7.CB (T0340)L46.CB 6.8436 11.4060 14.8278 87.9921 Constraint (T0340)L7.CB (T0340)P40.CB 9.2494 15.4156 20.0403 87.9921 Constraint (T0340)L7.CB (T0340)S39.CB 11.1885 18.6475 24.2418 87.9921 Constraint (T0340)L7.CB (T0340)V35.CB 10.4337 17.3896 22.6065 87.9921 Constraint (T0340)L7.CB (T0340)S34.CB 12.7627 21.2711 27.6524 87.9921 Constraint (T0340)L7.CB (T0340)R33.CB 12.3240 20.5400 26.7020 87.9921 Constraint (T0340)L7.CB (T0340)I32.CB 8.8807 14.8012 19.2416 87.9921 Constraint (T0340)L7.CB (T0340)Y31.CB 10.4061 17.3435 22.5465 87.9921 Constraint (T0340)L7.CB (T0340)H22.CB 12.7346 21.2243 27.5916 87.9921 Constraint (T0340)R6.CB (T0340)R80.CB 6.6719 11.1199 14.4558 87.9921 Constraint (T0340)R6.CB (T0340)A79.CB 8.5268 14.2114 18.4748 87.9921 Constraint (T0340)R6.CB (T0340)I72.CB 10.4953 17.4921 22.7398 87.9921 Constraint (T0340)R6.CB (T0340)S71.CB 11.3732 18.9553 24.6419 87.9921 Constraint (T0340)R6.CB (T0340)V68.CB 10.8112 18.0187 23.4243 87.9921 Constraint (T0340)R6.CB (T0340)Q58.CB 10.2706 17.1176 22.2529 87.9921 Constraint (T0340)R6.CB (T0340)V55.CB 8.2674 13.7789 17.9126 87.9921 Constraint (T0340)R6.CB (T0340)E54.CB 6.7312 11.2187 14.5843 87.9921 Constraint (T0340)R6.CB (T0340)I53.CB 6.0079 10.0131 13.0171 87.9921 Constraint (T0340)R6.CB (T0340)L52.CB 6.7069 11.1782 14.5316 87.9921 Constraint (T0340)R6.CB (T0340)R51.CB 6.5540 10.9233 14.2003 87.9921 Constraint (T0340)R6.CB (T0340)D50.CB 5.1855 8.6424 11.2351 87.9921 Constraint (T0340)R6.CB (T0340)Q49.CB 7.9473 13.2455 17.2192 87.9921 Constraint (T0340)R6.CB (T0340)A48.CB 8.8462 14.7436 19.1667 87.9921 Constraint (T0340)R6.CB (T0340)R47.CB 6.1898 10.3164 13.4113 87.9921 Constraint (T0340)R6.CB (T0340)L46.CB 5.5893 9.3156 12.1102 87.9921 Constraint (T0340)R6.CB (T0340)P40.CB 9.6588 16.0979 20.9273 87.9921 Constraint (T0340)R6.CB (T0340)S39.CB 10.8736 18.1227 23.5595 87.9921 Constraint (T0340)R6.CB (T0340)D36.CB 11.8746 19.7910 25.7283 87.9921 Constraint (T0340)R6.CB (T0340)V35.CB 9.0544 15.0906 19.6178 87.9921 Constraint (T0340)R6.CB (T0340)S34.CB 11.3546 18.9244 24.6017 87.9921 Constraint (T0340)R6.CB (T0340)R33.CB 10.8890 18.1484 23.5929 87.9921 Constraint (T0340)R6.CB (T0340)I32.CB 7.4921 12.4869 16.2329 87.9921 Constraint (T0340)R6.CB (T0340)Y31.CB 8.8732 14.7887 19.2254 87.9921 Constraint (T0340)R6.CB (T0340)H22.CB 11.5582 19.2637 25.0428 87.9921 Constraint (T0340)R11.CB (T0340)S44.CB 5.4444 9.0741 11.7963 87.9921 Constraint (T0340)L10.CB (T0340)S44.CB 3.6496 6.0827 7.9075 87.9921 Constraint (T0340)H22.CB (T0340)L82.CB 10.4946 17.4911 22.7384 87.9920 Constraint (T0340)F19.CB (T0340)L82.CB 8.5982 14.3303 18.6294 87.9920 Constraint (T0340)P28.CB (T0340)V84.CB 7.6875 12.8124 16.6562 87.8613 Constraint (T0340)D24.CB (T0340)I72.CB 8.6553 14.4256 18.7532 87.7451 Constraint (T0340)D24.CB (T0340)S71.CB 8.6540 14.4234 18.7504 87.7451 Constraint (T0340)P28.CB (T0340)R47.CB 11.5758 19.2930 25.0809 87.7348 Constraint (T0340)P28.CB (T0340)I72.CB 10.2478 17.0797 22.2036 87.7348 Constraint (T0340)P28.CB (T0340)S71.CB 9.6145 16.0241 20.8313 87.7348 Constraint (T0340)P28.CB (T0340)A70.CB 10.4121 17.3534 22.5595 87.7348 Constraint (T0340)P28.CB (T0340)V69.CB 9.1626 15.2709 19.8522 87.7348 Constraint (T0340)P28.CB (T0340)Q58.CB 9.4969 15.8281 20.5766 87.7348 Constraint (T0340)P37.CB (T0340)R75.CB 12.6902 21.1504 27.4955 87.4137 Constraint (T0340)L63.CB (T0340)L82.CB 8.0433 13.4056 17.4272 87.1141 Constraint (T0340)S23.CB (T0340)A41.CB 10.2171 17.0286 22.1371 86.9992 Constraint (T0340)S23.CB (T0340)V83.CB 8.4922 14.1536 18.3997 86.9981 Constraint (T0340)R11.CB (T0340)R33.CB 12.7651 21.2752 27.6578 86.9978 Constraint (T0340)L10.CB (T0340)S23.CB 11.7037 19.5061 25.3580 86.9978 Constraint (T0340)S23.CB (T0340)R75.CB 11.0295 18.3826 23.8973 86.9978 Constraint (T0340)Y31.CB (T0340)E78.CB 13.2009 22.0015 28.6020 86.9977 Constraint (T0340)R11.CB (T0340)V84.CB 13.0088 21.6813 28.1856 86.9922 Constraint (T0340)L10.CB (T0340)V84.CB 9.9076 16.5127 21.4665 86.9922 Constraint (T0340)H9.CB (T0340)V84.CB 9.7041 16.1736 21.0256 86.9922 Constraint (T0340)C8.CB (T0340)V84.CB 6.7876 11.3126 14.7064 86.9922 Constraint (T0340)C8.CB (T0340)Y17.CB 6.2023 10.3372 13.4383 86.9922 Constraint (T0340)R11.CB (T0340)N20.CB 10.9771 18.2952 23.7838 86.9921 Constraint (T0340)L10.CB (T0340)N20.CB 8.4580 14.0966 18.3256 86.9921 Constraint (T0340)H9.CB (T0340)L21.CB 10.4074 17.3457 22.5495 86.9921 Constraint (T0340)H9.CB (T0340)N20.CB 11.4628 19.1046 24.8360 86.9921 Constraint (T0340)C8.CB (T0340)L21.CB 8.3423 13.9039 18.0751 86.9921 Constraint (T0340)C8.CB (T0340)N20.CB 9.4961 15.8269 20.5750 86.9921 Constraint (T0340)L7.CB (T0340)L21.CB 10.4375 17.3958 22.6145 86.9921 Constraint (T0340)R6.CB (T0340)L21.CB 9.9414 16.5690 21.5397 86.9921 Constraint (T0340)R11.CB (T0340)E76.CB 5.8256 9.7094 12.6222 86.9921 Constraint (T0340)L10.CB (T0340)E76.CB 6.7026 11.1710 14.5223 86.9921 Constraint (T0340)R11.CB (T0340)A42.CB 7.7110 12.8517 16.7072 86.9921 Constraint (T0340)L10.CB (T0340)A42.CB 6.1623 10.2705 13.3516 86.9921 Constraint (T0340)H9.CB (T0340)A42.CB 8.5040 14.1734 18.4254 86.9921 Constraint (T0340)C8.CB (T0340)A42.CB 7.1060 11.8433 15.3963 86.9921 Constraint (T0340)C8.CB (T0340)P37.CB 10.3889 17.3149 22.5093 86.9921 Constraint (T0340)P14.CB (T0340)A79.CB 8.0470 13.4117 17.4352 86.9921 Constraint (T0340)P14.CB (T0340)R75.CB 7.8081 13.0136 16.9176 86.9921 Constraint (T0340)P14.CB (T0340)A74.CB 9.0980 15.1633 19.7122 86.9921 Constraint (T0340)P14.CB (T0340)I72.CB 8.9134 14.8557 19.3124 86.9921 Constraint (T0340)P14.CB (T0340)S71.CB 11.1672 18.6119 24.1955 86.9921 Constraint (T0340)P14.CB (T0340)V69.CB 10.8551 18.0919 23.5195 86.9921 Constraint (T0340)P14.CB (T0340)N56.CB 10.9164 18.1940 23.6522 86.9921 Constraint (T0340)P14.CB (T0340)V55.CB 11.2800 18.8000 24.4400 86.9921 Constraint (T0340)P14.CB (T0340)A41.CB 8.7554 14.5924 18.9701 86.9921 Constraint (T0340)P14.CB (T0340)P40.CB 6.3229 10.5382 13.6997 86.9921 Constraint (T0340)P14.CB (T0340)S39.CB 7.2180 12.0299 15.6389 86.9921 Constraint (T0340)P14.CB (T0340)P37.CB 10.2727 17.1212 22.2575 86.9921 Constraint (T0340)P14.CB (T0340)D36.CB 8.3651 13.9418 18.1244 86.9921 Constraint (T0340)P14.CB (T0340)V35.CB 10.6780 17.7967 23.1357 86.9921 Constraint (T0340)R6.CB (T0340)R75.CB 10.9318 18.2197 23.6857 86.9921 Constraint (T0340)R11.CB (T0340)E78.CB 3.3902 5.6503 7.3454 86.9921 Constraint (T0340)R11.CB (T0340)R43.CB 5.7691 9.6152 12.4997 86.9921 Constraint (T0340)L10.CB (T0340)E78.CB 4.3200 7.2000 9.3600 86.9921 Constraint (T0340)L10.CB (T0340)E61.CB 11.9016 19.8360 25.7867 86.9921 Constraint (T0340)L10.CB (T0340)R43.CB 5.2945 8.8241 11.4714 86.9921 Constraint (T0340)Y17.CB (T0340)L82.CB 8.6119 14.3531 18.6591 86.9921 Constraint (T0340)L21.CB (T0340)L82.CB 8.3619 13.9366 18.1175 86.9920 Constraint (T0340)N20.CB (T0340)L82.CB 10.8385 18.0641 23.4834 86.9920 Constraint (T0340)D24.CB (T0340)L63.CB 5.7591 9.5986 12.4782 86.7051 Constraint (T0340)P28.CB (T0340)H65.CB 6.1560 10.2600 13.3381 86.6130 Constraint (T0340)D24.CB (T0340)V83.CB 9.2400 15.4000 20.0200 86.4527 Constraint (T0340)D24.CB (T0340)A48.CB 8.9582 14.9303 19.4093 86.4524 Constraint (T0340)D24.CB (T0340)R47.CB 10.5273 17.5454 22.8091 86.4524 Constraint (T0340)D24.CB (T0340)L46.CB 10.4413 17.4021 22.6228 86.4524 Constraint (T0340)D24.CB (T0340)V35.CB 10.7236 17.8727 23.2345 86.4524 Constraint (T0340)D24.CB (T0340)S34.CB 9.1186 15.1976 19.7569 86.4524 Constraint (T0340)R64.CB (T0340)L82.CB 10.8658 18.1096 23.5425 86.1923 Constraint (T0340)S34.CB (T0340)E78.CB 13.0290 21.7151 28.2296 86.0667 Constraint (T0340)S23.CB (T0340)A42.CB 12.4336 20.7226 26.9394 85.9992 Constraint (T0340)D24.CB (T0340)R64.CB 5.2043 8.6739 11.2760 85.9978 Constraint (T0340)L7.CB (T0340)A74.CB 11.8409 19.7349 25.6554 85.9921 Constraint (T0340)L7.CB (T0340)K73.CB 12.3099 20.5166 26.6715 85.9921 Constraint (T0340)L7.CB (T0340)L63.CB 11.0059 18.3431 23.8460 85.9921 Constraint (T0340)L7.CB (T0340)V60.CB 8.4153 14.0254 18.2331 85.9921 Constraint (T0340)L7.CB (T0340)N59.CB 8.2765 13.7942 17.9325 85.9921 Constraint (T0340)L7.CB (T0340)N56.CB 6.6655 11.1092 14.4420 85.9921 Constraint (T0340)L7.CB (T0340)A41.CB 8.4959 14.1598 18.4078 85.9921 Constraint (T0340)L7.CB (T0340)F19.CB 9.4801 15.8002 20.5403 85.9921 Constraint (T0340)R6.CB (T0340)L63.CB 11.6557 19.4262 25.2541 85.9921 Constraint (T0340)R6.CB (T0340)V60.CB 9.0448 15.0747 19.5972 85.9921 Constraint (T0340)R6.CB (T0340)N59.CB 9.5205 15.8675 20.6277 85.9921 Constraint (T0340)R6.CB (T0340)N56.CB 9.1817 15.3028 19.8936 85.9921 Constraint (T0340)R6.CB (T0340)A41.CB 8.0426 13.4044 17.4257 85.9921 Constraint (T0340)R6.CB (T0340)F19.CB 8.9091 14.8485 19.3030 85.9921 Constraint (T0340)R11.CB (T0340)A70.CB 11.8249 19.7081 25.6206 85.9921 Constraint (T0340)R11.CB (T0340)N59.CB 13.1525 21.9208 28.4971 85.9921 Constraint (T0340)H9.CB (T0340)S44.CB 4.7325 7.8874 10.2537 85.9921 Constraint (T0340)H9.CB (T0340)H22.CB 13.2213 22.0355 28.6461 85.9921 Constraint (T0340)C8.CB (T0340)S44.CB 3.7510 6.2517 8.1272 85.9921 Constraint (T0340)Q15.CB (T0340)R80.CB 10.8163 18.0272 23.4353 85.9921 Constraint (T0340)Q15.CB (T0340)A79.CB 7.6276 12.7127 16.5265 85.9921 Constraint (T0340)Q15.CB (T0340)R75.CB 7.4340 12.3900 16.1070 85.9921 Constraint (T0340)Q15.CB (T0340)A74.CB 8.5002 14.1670 18.4172 85.9921 Constraint (T0340)Q15.CB (T0340)I72.CB 7.5422 12.5703 16.3414 85.9921 Constraint (T0340)Q15.CB (T0340)S71.CB 10.1132 16.8553 21.9119 85.9921 Constraint (T0340)Q15.CB (T0340)A70.CB 10.0475 16.7459 21.7696 85.9921 Constraint (T0340)Q15.CB (T0340)V69.CB 9.1217 15.2028 19.7636 85.9921 Constraint (T0340)Q15.CB (T0340)N56.CB 10.6232 17.7053 23.0169 85.9921 Constraint (T0340)Q15.CB (T0340)V55.CB 10.3698 17.2830 22.4679 85.9921 Constraint (T0340)Q15.CB (T0340)A41.CB 7.4711 12.4518 16.1873 85.9921 Constraint (T0340)Q15.CB (T0340)P40.CB 5.6797 9.4662 12.3060 85.9921 Constraint (T0340)Q15.CB (T0340)S39.CB 5.8961 9.8269 12.7750 85.9921 Constraint (T0340)Q15.CB (T0340)P37.CB 8.8453 14.7421 19.1648 85.9921 Constraint (T0340)Q15.CB (T0340)D36.CB 6.5206 10.8677 14.1280 85.9921 Constraint (T0340)Q15.CB (T0340)V35.CB 8.9803 14.9672 19.4574 85.9921 Constraint (T0340)P14.CB (T0340)K73.CB 8.0144 13.3574 17.3646 85.9921 Constraint (T0340)P14.CB (T0340)A42.CB 9.7262 16.2104 21.0735 85.9921 Constraint (T0340)L7.CB (T0340)S44.CB 6.7944 11.3240 14.7212 85.9921 Constraint (T0340)R6.CB (T0340)S44.CB 6.5733 10.9555 14.2421 85.9921 Constraint (T0340)P28.CB (T0340)V83.CB 9.1263 15.2105 19.7737 85.8615 Constraint (T0340)R27.CB (T0340)N59.CB 8.3135 13.8559 18.0127 85.7406 Constraint (T0340)R27.CB (T0340)I53.CB 7.6699 12.7831 16.6181 85.7406 Constraint (T0340)P28.CB (T0340)E61.CB 5.0017 8.3361 10.8369 85.7348 Constraint (T0340)P28.CB (T0340)N56.CB 11.7947 19.6578 25.5551 85.7348 Constraint (T0340)A48.CB (T0340)R64.CB 12.5175 20.8625 27.1212 85.2981 Constraint (T0340)L46.CB (T0340)R64.CB 12.5328 20.8880 27.1544 85.2925 Constraint (T0340)C8.CB (T0340)S23.CB 11.1775 18.6291 24.2178 84.9978 Constraint (T0340)L7.CB (T0340)D36.CB 12.5376 20.8960 27.1648 84.9978 Constraint (T0340)R6.CB (T0340)S23.CB 11.7172 19.5286 25.3872 84.9978 Constraint (T0340)L7.CB (T0340)E67.CB 12.5593 20.9322 27.2119 84.9924 Constraint (T0340)R11.CB (T0340)V83.CB 9.7973 16.3288 21.2275 84.9924 Constraint (T0340)L10.CB (T0340)V83.CB 6.6503 11.0839 14.4090 84.9924 Constraint (T0340)H9.CB (T0340)V83.CB 6.8198 11.3664 14.7763 84.9924 Constraint (T0340)C8.CB (T0340)V83.CB 3.7324 6.2207 8.0869 84.9924 Constraint (T0340)L7.CB (T0340)V84.CB 6.5158 10.8597 14.1176 84.9922 Constraint (T0340)L7.CB (T0340)Y17.CB 8.9930 14.9883 19.4848 84.9922 Constraint (T0340)R6.CB (T0340)V84.CB 4.6854 7.8090 10.1517 84.9922 Constraint (T0340)R6.CB (T0340)Y17.CB 9.5466 15.9110 20.6843 84.9922 Constraint (T0340)L7.CB (T0340)N20.CB 12.2872 20.4786 26.6222 84.9921 Constraint (T0340)R6.CB (T0340)N20.CB 11.4834 19.1390 24.8807 84.9921 Constraint (T0340)H9.CB (T0340)E76.CB 7.5166 12.5277 16.2860 84.9921 Constraint (T0340)C8.CB (T0340)E76.CB 9.5546 15.9243 20.7016 84.9921 Constraint (T0340)L7.CB (T0340)E76.CB 10.5747 17.6245 22.9118 84.9921 Constraint (T0340)L7.CB (T0340)A42.CB 10.4216 17.3694 22.5802 84.9921 Constraint (T0340)R6.CB (T0340)A42.CB 9.4830 15.8051 20.5466 84.9921 Constraint (T0340)H9.CB (T0340)E78.CB 3.8449 6.4081 8.3305 84.9921 Constraint (T0340)H9.CB (T0340)E61.CB 11.9544 19.9239 25.9011 84.9921 Constraint (T0340)H9.CB (T0340)R43.CB 7.0349 11.7249 15.2423 84.9921 Constraint (T0340)C8.CB (T0340)E78.CB 6.6157 11.0262 14.3340 84.9921 Constraint (T0340)C8.CB (T0340)E61.CB 10.1708 16.9513 22.0367 84.9921 Constraint (T0340)C8.CB (T0340)R43.CB 6.7286 11.2143 14.5786 84.9921 Constraint (T0340)Q15.CB (T0340)K73.CB 6.7474 11.2456 14.6193 84.9921 Constraint (T0340)Q15.CB (T0340)S44.CB 9.3871 15.6452 20.3387 84.9921 Constraint (T0340)Q15.CB (T0340)A42.CB 8.5557 14.2596 18.5374 84.9921 Constraint (T0340)P14.CB (T0340)R80.CB 10.9105 18.1842 23.6395 84.9921 Constraint (T0340)P14.CB (T0340)L46.CB 11.0214 18.3690 23.8797 84.9921 Constraint (T0340)P14.CB (T0340)S34.CB 11.8220 19.7033 25.6142 84.9921 Constraint (T0340)P14.CB (T0340)I32.CB 12.2697 20.4494 26.5843 84.9921 Constraint (T0340)K12.CB (T0340)R80.CB 7.1323 11.8872 15.4534 84.9921 Constraint (T0340)K12.CB (T0340)A79.CB 4.1799 6.9665 9.0564 84.9921 Constraint (T0340)K12.CB (T0340)R75.CB 4.8725 8.1208 10.5570 84.9921 Constraint (T0340)K12.CB (T0340)I72.CB 6.2127 10.3545 13.4608 84.9921 Constraint (T0340)K12.CB (T0340)S71.CB 8.4299 14.0498 18.2648 84.9921 Constraint (T0340)K12.CB (T0340)A70.CB 9.5513 15.9188 20.6945 84.9921 Constraint (T0340)K12.CB (T0340)V69.CB 9.1026 15.1710 19.7223 84.9921 Constraint (T0340)K12.CB (T0340)V55.CB 7.7197 12.8661 16.7260 84.9921 Constraint (T0340)K12.CB (T0340)L46.CB 8.0791 13.4651 17.5047 84.9921 Constraint (T0340)K12.CB (T0340)P40.CB 3.8318 6.3863 8.3022 84.9921 Constraint (T0340)K12.CB (T0340)S39.CB 5.9308 9.8846 12.8500 84.9921 Constraint (T0340)K12.CB (T0340)P37.CB 9.7565 16.2609 21.1392 84.9921 Constraint (T0340)K12.CB (T0340)D36.CB 7.6016 12.6694 16.4702 84.9921 Constraint (T0340)K12.CB (T0340)V35.CB 8.7382 14.5637 18.9328 84.9921 Constraint (T0340)K12.CB (T0340)S34.CB 10.4246 17.3743 22.5865 84.9921 Constraint (T0340)K12.CB (T0340)I32.CB 9.5937 15.9894 20.7863 84.9921 Constraint (T0340)L7.CB (T0340)E78.CB 7.4205 12.3674 16.0777 84.9921 Constraint (T0340)L7.CB (T0340)E61.CB 9.4113 15.6855 20.3912 84.9921 Constraint (T0340)L7.CB (T0340)R43.CB 9.7470 16.2450 21.1185 84.9921 Constraint (T0340)R6.CB (T0340)V69.CB 12.8491 21.4152 27.8397 84.9921 Constraint (T0340)R6.CB (T0340)E61.CB 9.5813 15.9688 20.7595 84.9921 Constraint (T0340)R6.CB (T0340)R43.CB 9.5050 15.8416 20.5941 84.9921 Constraint (T0340)Q30.CB (T0340)E76.CB 11.8418 19.7364 25.6573 84.8394 Constraint (T0340)D24.CB (T0340)D36.CB 12.1072 20.1787 26.2323 84.7451 Constraint (T0340)R27.CB (T0340)V60.CB 7.2030 12.0051 15.6066 84.7406 Constraint (T0340)R27.CB (T0340)R51.CB 6.6717 11.1195 14.4553 84.7406 Constraint (T0340)R27.CB (T0340)E54.CB 9.5178 15.8631 20.6220 84.7406 Constraint (T0340)R27.CB (T0340)L52.CB 7.9926 13.3210 17.3174 84.7406 Constraint (T0340)R27.CB (T0340)Q49.CB 9.5315 15.8858 20.6515 84.7406 Constraint (T0340)I53.CB (T0340)E76.CB 11.9664 19.9440 25.9272 84.0925 Constraint (T0340)P40.CB (T0340)N59.CB 13.1825 21.9708 28.5621 84.0406 Constraint (T0340)P37.CB (T0340)V68.CB 12.9651 21.6084 28.0910 84.0404 Constraint (T0340)D36.CB (T0340)E67.CB 12.9473 21.5788 28.0524 84.0404 Constraint (T0340)S23.CB (T0340)L81.CB 9.1917 15.3195 19.9154 83.9978 Constraint (T0340)R6.CB (T0340)E78.CB 9.8200 16.3667 21.2767 83.9922 Constraint (T0340)Q15.CB (T0340)V68.CB 10.9015 18.1692 23.6200 83.9921 Constraint (T0340)R11.CB (T0340)Q30.CB 12.3742 20.6237 26.8109 83.9921 Constraint (T0340)L10.CB (T0340)Q30.CB 9.3146 15.5243 20.1816 83.9921 Constraint (T0340)K12.CB (T0340)L21.CB 9.2915 15.4858 20.1315 83.9921 Constraint (T0340)P14.CB (T0340)E76.CB 6.6625 11.1042 14.4354 83.9921 Constraint (T0340)R11.CB (T0340)D77.CB 4.0745 6.7908 8.8280 83.9921 Constraint (T0340)L10.CB (T0340)D77.CB 5.7835 9.6392 12.5309 83.9921 Constraint (T0340)Q15.CB (T0340)E78.CB 8.5647 14.2744 18.5567 83.9921 Constraint (T0340)Q15.CB (T0340)L46.CB 9.7550 16.2583 21.1358 83.9921 Constraint (T0340)Q15.CB (T0340)R43.CB 8.4253 14.0422 18.2549 83.9921 Constraint (T0340)Q15.CB (T0340)S34.CB 9.6439 16.0732 20.8952 83.9921 Constraint (T0340)Q15.CB (T0340)I32.CB 10.4644 17.4407 22.6729 83.9921 Constraint (T0340)P14.CB (T0340)E78.CB 7.9800 13.3000 17.2900 83.9921 Constraint (T0340)P14.CB (T0340)A70.CB 11.1968 18.6613 24.2597 83.9921 Constraint (T0340)P14.CB (T0340)R43.CB 8.8336 14.7227 19.1396 83.9921 Constraint (T0340)K12.CB (T0340)V68.CB 9.8789 16.4648 21.4042 83.9921 Constraint (T0340)K12.CB (T0340)L52.CB 9.5341 15.8902 20.6573 83.9921 Constraint (T0340)K12.CB (T0340)D50.CB 10.8549 18.0915 23.5189 83.9921 Constraint (T0340)K12.CB (T0340)R47.CB 11.2147 18.6911 24.2985 83.9921 Constraint (T0340)K12.CB (T0340)R33.CB 11.3793 18.9654 24.6551 83.9921 Constraint (T0340)A42.CB (T0340)H65.CB 12.7289 21.2149 27.5793 83.9199 Constraint (T0340)R27.CB (T0340)V84.CB 8.2746 13.7909 17.9282 83.8670 Constraint (T0340)D24.CB (T0340)A79.CB 11.6555 19.4258 25.2536 83.7452 Constraint (T0340)R27.CB (T0340)D50.CB 9.5516 15.9193 20.6950 83.7406 Constraint (T0340)R27.CB (T0340)S71.CB 10.5627 17.6045 22.8858 83.7406 Constraint (T0340)R27.CB (T0340)V69.CB 10.0819 16.8032 21.8442 83.7406 Constraint (T0340)R27.CB (T0340)V68.CB 7.8574 13.0956 17.0243 83.7406 Constraint (T0340)R27.CB (T0340)E67.CB 8.3740 13.9567 18.1437 83.7406 Constraint (T0340)R27.CB (T0340)A66.CB 9.0773 15.1288 19.6674 83.7406 Constraint (T0340)R27.CB (T0340)Q58.CB 10.4589 17.4315 22.6609 83.7406 Constraint (T0340)R27.CB (T0340)V55.CB 10.3320 17.2201 22.3861 83.7406 Constraint (T0340)P28.CB (T0340)L46.CB 11.4042 19.0071 24.7092 83.7348 Constraint (T0340)P40.CB (T0340)L63.CB 12.8510 21.4183 27.8438 83.1200 Constraint (T0340)P28.CB (T0340)L63.CB 5.9714 9.9524 12.9381 83.1140 Constraint (T0340)N59.CB (T0340)E76.CB 11.3182 18.8637 24.5228 83.0924 Constraint (T0340)R43.CB (T0340)V68.CB 12.5932 20.9886 27.2852 83.0366 Constraint (T0340)N20.CB (T0340)D77.CB 11.9413 19.9021 25.8727 82.9975 Constraint (T0340)L7.CB (T0340)V83.CB 4.7270 7.8783 10.2418 82.9924 Constraint (T0340)R6.CB (T0340)V83.CB 3.3261 5.5435 7.2065 82.9924 Constraint (T0340)Q15.CB (T0340)E76.CB 7.4004 12.3340 16.0341 82.9921 Constraint (T0340)K12.CB (T0340)A74.CB 7.2860 12.1433 15.7863 82.9921 Constraint (T0340)K12.CB (T0340)K73.CB 6.5376 10.8961 14.1649 82.9921 Constraint (T0340)K12.CB (T0340)N56.CB 7.4102 12.3504 16.0555 82.9921 Constraint (T0340)K12.CB (T0340)A41.CB 6.1114 10.1857 13.2414 82.9921 Constraint (T0340)P14.CB (T0340)S44.CB 9.8192 16.3654 21.2750 82.9921 Constraint (T0340)K12.CB (T0340)Q58.CB 10.1279 16.8798 21.9437 82.9921 Constraint (T0340)K12.CB (T0340)E54.CB 10.3502 17.2502 22.4253 82.9921 Constraint (T0340)K12.CB (T0340)I53.CB 11.9176 19.8627 25.8215 82.9921 Constraint (T0340)K12.CB (T0340)R51.CB 12.5687 20.9479 27.2323 82.9921 Constraint (T0340)K12.CB (T0340)A48.CB 11.7897 19.6496 25.5444 82.9921 Constraint (T0340)K12.CB (T0340)S44.CB 6.9506 11.5844 15.0597 82.9921 Constraint (T0340)K12.CB (T0340)Y31.CB 12.2316 20.3861 26.5019 82.9921 Constraint (T0340)K12.CB (T0340)H22.CB 12.2274 20.3790 26.4927 82.9921 Constraint (T0340)R6.CB (T0340)H65.CB 13.1251 21.8752 28.4377 82.9921 Constraint (T0340)N59.CB (T0340)P86.CB 11.0558 18.4263 23.9542 82.8631 Constraint (T0340)V55.CB (T0340)P86.CB 11.0407 18.4012 23.9216 82.8631 Constraint (T0340)E54.CB (T0340)P86.CB 9.6829 16.1382 20.9797 82.8631 Constraint (T0340)I53.CB (T0340)P86.CB 7.2563 12.0939 15.7221 82.8631 Constraint (T0340)L52.CB (T0340)P86.CB 7.4179 12.3631 16.0721 82.8631 Constraint (T0340)Q49.CB (T0340)P86.CB 4.1178 6.8630 8.9219 82.8631 Constraint (T0340)A48.CB (T0340)P86.CB 6.5891 10.9818 14.2763 82.8631 Constraint (T0340)R47.CB (T0340)P86.CB 5.8360 9.7266 12.6446 82.8631 Constraint (T0340)L46.CB (T0340)P86.CB 7.7617 12.9362 16.8170 82.8631 Constraint (T0340)I32.CB (T0340)P86.CB 6.8051 11.3419 14.7444 82.8631 Constraint (T0340)Y31.CB (T0340)P86.CB 6.0385 10.0642 13.0835 82.8631 Constraint (T0340)D24.CB (T0340)K73.CB 10.2118 17.0196 22.1255 82.7451 Constraint (T0340)S26.CB (T0340)E61.CB 7.6531 12.7552 16.5818 82.7408 Constraint (T0340)S26.CB (T0340)I53.CB 9.4559 15.7598 20.4877 82.7408 Constraint (T0340)S26.CB (T0340)R51.CB 8.1732 13.6220 17.7085 82.7408 Constraint (T0340)R27.CB (T0340)I72.CB 11.2474 18.7457 24.3694 82.7406 Constraint (T0340)R27.CB (T0340)H65.CB 6.9975 11.6625 15.1613 82.6187 Constraint (T0340)D24.CB (T0340)A41.CB 11.1403 18.5672 24.1373 82.4537 Constraint (T0340)A41.CB (T0340)R64.CB 12.6952 21.1587 27.5063 82.2939 Constraint (T0340)R43.CB (T0340)V69.CB 12.5563 20.9272 27.2053 82.0363 Constraint (T0340)K25.CB (T0340)E61.CB 7.6754 12.7923 16.6300 82.0335 Constraint (T0340)K25.CB (T0340)I53.CB 9.4674 15.7790 20.5127 82.0335 Constraint (T0340)K25.CB (T0340)L52.CB 8.8118 14.6864 19.0923 82.0335 Constraint (T0340)K25.CB (T0340)R51.CB 8.0425 13.4041 17.4253 82.0335 Constraint (T0340)K25.CB (T0340)D50.CB 10.4279 17.3798 22.5937 82.0335 Constraint (T0340)K25.CB (T0340)Q49.CB 10.0282 16.7136 21.7277 82.0335 Constraint (T0340)S23.CB (T0340)L82.CB 9.8562 16.4270 21.3551 81.9980 Constraint (T0340)P5.CB (T0340)R80.CB 7.7270 12.8784 16.7419 81.9924 Constraint (T0340)P5.CB (T0340)V55.CB 8.3440 13.9066 18.0786 81.9924 Constraint (T0340)P5.CB (T0340)E54.CB 5.7270 9.5451 12.4086 81.9924 Constraint (T0340)P5.CB (T0340)I53.CB 4.3098 7.1831 9.3380 81.9924 Constraint (T0340)P5.CB (T0340)L52.CB 6.6725 11.1209 14.4571 81.9924 Constraint (T0340)P5.CB (T0340)R51.CB 5.7556 9.5927 12.4705 81.9924 Constraint (T0340)P5.CB (T0340)D50.CB 6.2024 10.3373 13.4385 81.9924 Constraint (T0340)P5.CB (T0340)Q49.CB 8.6546 14.4243 18.7516 81.9924 Constraint (T0340)P5.CB (T0340)A48.CB 10.2986 17.1644 22.3137 81.9924 Constraint (T0340)P5.CB (T0340)R47.CB 8.2281 13.7134 17.8275 81.9924 Constraint (T0340)P5.CB (T0340)L46.CB 8.0083 13.3472 17.3514 81.9924 Constraint (T0340)P5.CB (T0340)P40.CB 12.2641 20.4402 26.5723 81.9924 Constraint (T0340)P5.CB (T0340)V35.CB 11.3234 18.8723 24.5340 81.9924 Constraint (T0340)P5.CB (T0340)R33.CB 11.7354 19.5591 25.4268 81.9924 Constraint (T0340)P5.CB (T0340)I32.CB 8.6540 14.4233 18.7502 81.9924 Constraint (T0340)P5.CB (T0340)Y31.CB 8.8423 14.7372 19.1584 81.9924 Constraint (T0340)P5.CB (T0340)H22.CB 11.7240 19.5399 25.4019 81.9924 Constraint (T0340)H9.CB (T0340)Q30.CB 10.7886 17.9809 23.3752 81.9921 Constraint (T0340)C8.CB (T0340)Q30.CB 8.5746 14.2910 18.5783 81.9921 Constraint (T0340)L7.CB (T0340)Q30.CB 9.6876 16.1461 20.9899 81.9921 Constraint (T0340)R6.CB (T0340)Q30.CB 9.2503 15.4172 20.0424 81.9921 Constraint (T0340)H9.CB (T0340)D77.CB 6.5268 10.8781 14.1415 81.9921 Constraint (T0340)C8.CB (T0340)D77.CB 8.9199 14.8665 19.3264 81.9921 Constraint (T0340)K12.CB (T0340)E76.CB 4.7388 7.8979 10.2673 81.9921 Constraint (T0340)L7.CB (T0340)D77.CB 10.1285 16.8808 21.9451 81.9921 Constraint (T0340)K12.CB (T0340)A42.CB 7.8740 13.1234 17.0604 81.9921 Constraint (T0340)R11.CB (T0340)L81.CB 7.1077 11.8462 15.4000 81.9921 Constraint (T0340)L10.CB (T0340)L81.CB 4.1659 6.9432 9.0261 81.9921 Constraint (T0340)H9.CB (T0340)L81.CB 4.6344 7.7240 10.0412 81.9921 Constraint (T0340)C8.CB (T0340)L81.CB 3.0123 5.0205 6.5266 81.9921 Constraint (T0340)Q15.CB (T0340)L52.CB 11.4037 19.0062 24.7081 81.9921 Constraint (T0340)K12.CB (T0340)E78.CB 4.6620 7.7699 10.1009 81.9921 Constraint (T0340)K12.CB (T0340)R43.CB 6.9047 11.5079 14.9603 81.9921 Constraint (T0340)V60.CB (T0340)P86.CB 9.7212 16.2019 21.0625 81.8631 Constraint (T0340)R51.CB (T0340)P86.CB 4.5828 7.6380 9.9294 81.8631 Constraint (T0340)D50.CB (T0340)P86.CB 4.7272 7.8787 10.2423 81.8631 Constraint (T0340)R33.CB (T0340)P86.CB 8.5667 14.2778 18.5611 81.8631 Constraint (T0340)P28.CB (T0340)L81.CB 10.2329 17.0549 22.1713 81.8612 Constraint (T0340)D24.CB (T0340)N56.CB 11.5004 19.1674 24.9176 81.7451 Constraint (T0340)S26.CB (T0340)V68.CB 8.3164 13.8606 18.0188 81.7408 Constraint (T0340)S26.CB (T0340)L52.CB 9.1895 15.3159 19.9107 81.7408 Constraint (T0340)S26.CB (T0340)D50.CB 10.7168 17.8613 23.2197 81.7408 Constraint (T0340)S26.CB (T0340)Q49.CB 10.3759 17.2931 22.4811 81.7408 Constraint (T0340)R27.CB (T0340)E61.CB 5.7613 9.6022 12.4829 81.7406 Constraint (T0340)R27.CB (T0340)A48.CB 11.1709 18.6182 24.2037 81.7406 Constraint (T0340)P28.CB (T0340)K73.CB 12.2340 20.3899 26.5069 81.7348 Constraint (T0340)P40.CB (T0340)A66.CB 12.9598 21.5996 28.0795 81.0363 Constraint (T0340)K25.CB (T0340)V68.CB 7.5868 12.6446 16.4380 81.0335 Constraint (T0340)K25.CB (T0340)E67.CB 7.8999 13.1664 17.1164 81.0335 Constraint (T0340)L10.CB (T0340)A66.CB 12.4212 20.7020 26.9126 80.9978 Constraint (T0340)A48.CB (T0340)Q58.CB 13.3760 22.2934 28.9814 80.9978 Constraint (T0340)P5.CB (T0340)I72.CB 11.1166 18.5277 24.0860 80.9925 Constraint (T0340)P5.CB (T0340)S71.CB 11.1540 18.5901 24.1671 80.9925 Constraint (T0340)P5.CB (T0340)V68.CB 10.3872 17.3121 22.5057 80.9925 Constraint (T0340)P5.CB (T0340)H65.CB 12.6799 21.1332 27.4732 80.9925 Constraint (T0340)P5.CB (T0340)Q58.CB 9.3713 15.6188 20.3044 80.9925 Constraint (T0340)L7.CB (T0340)A70.CB 12.8233 21.3721 27.7837 80.9924 Constraint (T0340)Q49.CB (T0340)R75.CB 13.1337 21.8896 28.4564 80.9924 Constraint (T0340)P5.CB (T0340)L21.CB 10.4642 17.4404 22.6725 80.9924 Constraint (T0340)Q15.CB (T0340)D77.CB 6.9056 11.5093 14.9620 80.9921 Constraint (T0340)P14.CB (T0340)D77.CB 5.8503 9.7505 12.6756 80.9921 Constraint (T0340)K12.CB (T0340)V60.CB 10.7702 17.9504 23.3355 80.9921 Constraint (T0340)Q15.CB (T0340)L81.CB 10.2274 17.0456 22.1593 80.9921 Constraint (T0340)P28.CB (T0340)R64.CB 6.2268 10.3780 13.4914 80.9921 Constraint (T0340)R27.CB (T0340)V83.CB 9.9844 16.6406 21.6328 80.8672 Constraint (T0340)V68.CB (T0340)P86.CB 10.9259 18.2098 23.6727 80.8633 Constraint (T0340)V35.CB (T0340)P86.CB 9.1225 15.2042 19.7655 80.8633 Constraint (T0340)Q30.CB (T0340)P86.CB 8.2555 13.7592 17.8870 80.8631 Constraint (T0340)P28.CB (T0340)L82.CB 9.5010 15.8351 20.5856 80.8614 Constraint (T0340)S26.CB (T0340)E67.CB 8.5408 14.2346 18.5050 80.7408 Constraint (T0340)S26.CB (T0340)V60.CB 8.4419 14.0699 18.2908 80.7408 Constraint (T0340)S26.CB (T0340)N59.CB 9.8725 16.4542 21.3904 80.7408 Constraint (T0340)R27.CB (T0340)A70.CB 11.1440 18.5734 24.1454 80.7406 Constraint (T0340)A66.CB (T0340)E76.CB 11.6628 19.4381 25.2695 80.0924 Constraint (T0340)R43.CB (T0340)V60.CB 13.1273 21.8789 28.4425 80.0362 Constraint (T0340)S26.CB (T0340)V69.CB 9.8560 16.4267 21.3547 80.0335 Constraint (T0340)S26.CB (T0340)A66.CB 8.4496 14.0827 18.3075 80.0335 Constraint (T0340)K25.CB (T0340)V60.CB 8.0205 13.3675 17.3777 80.0335 Constraint (T0340)K25.CB (T0340)N59.CB 9.8093 16.3488 21.2534 80.0335 Constraint (T0340)P5.CB (T0340)A79.CB 9.8649 16.4415 21.3740 79.9926 Constraint (T0340)L63.CB (T0340)E76.CB 11.2871 18.8118 24.4553 79.9924 Constraint (T0340)P5.CB (T0340)V84.CB 3.2516 5.4194 7.0452 79.9924 Constraint (T0340)P5.CB (T0340)V83.CB 4.3159 7.1931 9.3510 79.9924 Constraint (T0340)P5.CB (T0340)V60.CB 8.0200 13.3666 17.3766 79.9924 Constraint (T0340)P5.CB (T0340)N59.CB 7.6719 12.7866 16.6225 79.9924 Constraint (T0340)P5.CB (T0340)A41.CB 10.5011 17.5018 22.7523 79.9924 Constraint (T0340)P5.CB (T0340)F19.CB 10.6584 17.7640 23.0932 79.9924 Constraint (T0340)P5.CB (T0340)Y17.CB 11.4387 19.0645 24.7839 79.9924 Constraint (T0340)P5.CB (T0340)S44.CB 9.6708 16.1180 20.9534 79.9924 Constraint (T0340)R11.CB (T0340)L82.CB 9.7795 16.2992 21.1889 79.9923 Constraint (T0340)L10.CB (T0340)L82.CB 7.1703 11.9505 15.5357 79.9923 Constraint (T0340)H9.CB (T0340)L82.CB 6.1707 10.2845 13.3699 79.9923 Constraint (T0340)C8.CB (T0340)L82.CB 4.6067 7.6778 9.9811 79.9923 Constraint (T0340)R6.CB (T0340)D77.CB 12.3178 20.5297 26.6886 79.9922 Constraint (T0340)H9.CB (T0340)E67.CB 12.8113 21.3521 27.7578 79.9922 Constraint (T0340)K12.CB (T0340)E67.CB 11.6431 19.4051 25.2266 79.9921 Constraint (T0340)L7.CB (T0340)L81.CB 4.3928 7.3214 9.5178 79.9921 Constraint (T0340)R6.CB (T0340)L81.CB 5.3330 8.8883 11.5547 79.9921 Constraint (T0340)Q15.CB (T0340)R33.CB 10.9217 18.2028 23.6637 79.9921 Constraint (T0340)R6.CB (T0340)P37.CB 12.4393 20.7321 26.9517 79.9921 Constraint (T0340)A41.CB (T0340)P86.CB 10.0651 16.7751 21.8076 79.8644 Constraint (T0340)S34.CB (T0340)P86.CB 9.7168 16.1947 21.0531 79.8633 Constraint (T0340)S44.CB (T0340)P86.CB 10.6484 17.7473 23.0714 79.8631 Constraint (T0340)P28.CB (T0340)A41.CB 12.6336 21.0560 27.3728 79.7361 Constraint (T0340)K25.CB (T0340)H65.CB 5.6060 9.3433 12.1463 79.6189 Constraint (T0340)S26.CB (T0340)H65.CB 6.5008 10.8347 14.0851 79.6189 Constraint (T0340)D24.CB (T0340)L81.CB 9.7885 16.3141 21.2084 79.4524 Constraint (T0340)R27.CB (T0340)L63.CB 6.6647 11.1079 14.4402 79.1197 Constraint (T0340)L63.CB (T0340)D77.CB 12.6524 21.0874 27.4136 79.1141 Constraint (T0340)K25.CB (T0340)E54.CB 10.8252 18.0421 23.4547 79.0335 Constraint (T0340)P5.CB (T0340)S23.CB 11.1521 18.5868 24.1628 78.9981 Constraint (T0340)L7.CB (T0340)S23.CB 12.4340 20.7233 26.9403 78.9980 Constraint (T0340)P5.CB (T0340)L63.CB 10.3672 17.2786 22.4622 78.9925 Constraint (T0340)P5.CB (T0340)N56.CB 9.3532 15.5886 20.2652 78.9925 Constraint (T0340)D50.CB (T0340)E76.CB 12.7087 21.1812 27.5355 78.9925 Constraint (T0340)P5.CB (T0340)N20.CB 12.7049 21.1749 27.5274 78.9924 Constraint (T0340)K12.CB (T0340)V83.CB 10.1324 16.8874 21.9536 78.9924 Constraint (T0340)P5.CB (T0340)A42.CB 12.3209 20.5348 26.6952 78.9924 Constraint (T0340)P5.CB (T0340)S34.CB 12.8741 21.4568 27.8939 78.9924 Constraint (T0340)P5.CB (T0340)E61.CB 7.3733 12.2888 15.9754 78.9924 Constraint (T0340)P14.CB (T0340)V68.CB 12.4016 20.6694 26.8702 78.9921 Constraint (T0340)K12.CB (T0340)D77.CB 3.6275 6.0458 7.8595 78.9921 Constraint (T0340)P14.CB (T0340)L81.CB 11.0337 18.3896 23.9064 78.9921 Constraint (T0340)S26.CB (T0340)V84.CB 10.0418 16.7363 21.7572 78.8672 Constraint (T0340)E61.CB (T0340)P86.CB 9.4791 15.7985 20.5381 78.8631 Constraint (T0340)S26.CB (T0340)V55.CB 11.3508 18.9180 24.5934 78.7408 Constraint (T0340)R27.CB (T0340)R47.CB 12.1154 20.1924 26.2501 78.7406 Constraint (T0340)K25.CB (T0340)S71.CB 10.3005 17.1675 22.3177 78.6189 Constraint (T0340)K25.CB (T0340)V69.CB 8.8348 14.7246 19.1420 78.6189 Constraint (T0340)K25.CB (T0340)A66.CB 7.4756 12.4594 16.1972 78.6189 Constraint (T0340)D24.CB (T0340)L82.CB 10.1364 16.8941 21.9623 78.4526 Constraint (T0340)K25.CB (T0340)V84.CB 10.1420 16.9034 21.9744 78.1599 Constraint (T0340)K25.CB (T0340)V83.CB 11.1861 18.6436 24.2366 78.1599 Constraint (T0340)Q49.CB (T0340)K73.CB 13.1869 21.9782 28.5717 78.1140 Constraint (T0340)V35.CB (T0340)N59.CB 13.2864 22.1439 28.7871 78.0406 Constraint (T0340)K25.CB (T0340)V55.CB 10.8279 18.0466 23.4605 78.0335 Constraint (T0340)P5.CB (T0340)R75.CB 11.6520 19.4200 25.2460 77.9927 Constraint (T0340)L7.CB (T0340)L82.CB 3.2658 5.4429 7.0758 77.9923 Constraint (T0340)R6.CB (T0340)L82.CB 4.4275 7.3792 9.5930 77.9923 Constraint (T0340)F19.CB (T0340)P28.CB 10.9611 18.2685 23.7491 77.9922 Constraint (T0340)K12.CB (T0340)N59.CB 12.6157 21.0261 27.3339 77.9921 Constraint (T0340)S26.CB (T0340)V83.CB 11.4160 19.0267 24.7348 77.8672 Constraint (T0340)P28.CB (T0340)R80.CB 12.5374 20.8957 27.1644 77.8613 Constraint (T0340)S26.CB (T0340)A48.CB 11.6818 19.4697 25.3105 77.7412 Constraint (T0340)S26.CB (T0340)E54.CB 10.9135 18.1892 23.6459 77.7408 Constraint (T0340)L63.CB (T0340)P86.CB 11.5400 19.2334 25.0034 77.1159 Constraint (T0340)K25.CB (T0340)A48.CB 11.0189 18.3648 23.8743 77.0335 Constraint (T0340)K25.CB (T0340)S34.CB 11.2564 18.7607 24.3889 77.0335 Constraint (T0340)R27.CB (T0340)R64.CB 6.7419 11.2364 14.6073 76.9978 Constraint (T0340)P5.CB (T0340)E78.CB 11.4122 19.0204 24.7265 76.9926 Constraint (T0340)P5.CB (T0340)V69.CB 12.9894 21.6490 28.1437 76.9925 Constraint (T0340)K12.CB (T0340)L63.CB 12.1044 20.1739 26.2261 76.9922 Constraint (T0340)K12.CB (T0340)A66.CB 12.0772 20.1287 26.1673 76.9921 Constraint (T0340)K12.CB (T0340)H65.CB 12.0992 20.1653 26.2149 76.9921 Constraint (T0340)K12.CB (T0340)Q30.CB 11.0197 18.3662 23.8761 76.9921 Constraint (T0340)K12.CB (T0340)L81.CB 7.3516 12.2527 15.9285 76.9921 Constraint (T0340)P37.CB (T0340)D77.CB 12.5623 20.9371 27.2182 76.1667 Constraint (T0340)S26.CB (T0340)L63.CB 7.4883 12.4805 16.2247 76.1199 Constraint (T0340)D36.CB (T0340)P86.CB 12.2333 20.3889 26.5056 76.1174 Constraint (T0340)H65.CB (T0340)E76.CB 12.3734 20.6223 26.8089 76.0934 Constraint (T0340)S39.CB (T0340)A66.CB 12.8403 21.4005 27.8207 76.0411 Constraint (T0340)S23.CB (T0340)S44.CB 12.7003 21.1672 27.5173 75.9993 Constraint (T0340)D24.CB (T0340)R75.CB 11.4579 19.0965 24.8255 75.9978 Constraint (T0340)P5.CB (T0340)Q30.CB 8.7520 14.5867 18.9627 75.9924 Constraint (T0340)R27.CB (T0340)L82.CB 10.4154 17.3590 22.5666 75.8671 Constraint (T0340)R27.CB (T0340)L81.CB 11.2781 18.7968 24.4359 75.8670 Constraint (T0340)A42.CB (T0340)P86.CB 10.9433 18.2388 23.7105 75.8646 Constraint (T0340)P28.CB (T0340)P86.CB 8.9883 14.9804 19.4746 75.8631 Constraint (T0340)P28.CB (T0340)A79.CB 12.4141 20.6901 26.8972 75.8614 Constraint (T0340)H65.CB (T0340)P86.CB 11.4547 19.0911 24.8184 75.7414 Constraint (T0340)K25.CB (T0340)L63.CB 6.8162 11.3603 14.7684 75.4126 Constraint (T0340)I72.CB (T0340)P86.CB 12.0489 20.0815 26.1060 75.1161 Constraint (T0340)S26.CB (T0340)I72.CB 11.4217 19.0361 24.7469 75.0335 Constraint (T0340)H22.CB (T0340)P86.CB 8.5853 14.3088 18.6014 74.9940 Constraint (T0340)L21.CB (T0340)P86.CB 9.0984 15.1640 19.7132 74.9940 Constraint (T0340)F19.CB (T0340)P86.CB 9.5968 15.9947 20.7931 74.9940 Constraint (T0340)K12.CB (T0340)V84.CB 13.1855 21.9758 28.5685 74.9922 Constraint (T0340)Q15.CB (T0340)H65.CB 12.0580 20.0967 26.1257 74.9922 Constraint (T0340)K25.CB (T0340)I72.CB 10.5621 17.6035 22.8845 74.7453 Constraint (T0340)R43.CB (T0340)A74.CB 12.8738 21.4563 27.8932 74.4157 Constraint (T0340)S39.CB (T0340)E67.CB 13.1267 21.8779 28.4413 74.0410 Constraint (T0340)S44.CB (T0340)A70.CB 12.7432 21.2387 27.6103 74.0366 Constraint (T0340)S26.CB (T0340)R64.CB 6.4547 10.7578 13.9851 73.9980 Constraint (T0340)K25.CB (T0340)R64.CB 5.6105 9.3508 12.1560 73.9980 Constraint (T0340)C8.CB (T0340)R64.CB 13.0633 21.7721 28.3038 73.9936 Constraint (T0340)P5.CB (T0340)L82.CB 3.8498 6.4163 8.3411 73.9924 Constraint (T0340)P5.CB (T0340)L81.CB 6.5105 10.8508 14.1061 73.9924 Constraint (T0340)R27.CB (T0340)L46.CB 12.1713 20.2854 26.3711 73.7406 Constraint (T0340)K25.CB (T0340)Q58.CB 10.9188 18.1979 23.6573 73.6189 Constraint (T0340)D24.CB (T0340)P86.CB 9.3547 15.5912 20.2686 73.4524 Constraint (T0340)V35.CB (T0340)R64.CB 12.9360 21.5600 28.0280 73.2983 Constraint (T0340)R64.CB (T0340)E76.CB 12.6742 21.1236 27.4607 73.0935 Constraint (T0340)S39.CB (T0340)Q58.CB 12.9424 21.5707 28.0419 73.0407 Constraint (T0340)S26.CB (T0340)S71.CB 10.7592 17.9320 23.3116 73.0335 Constraint (T0340)P5.CB (T0340)E67.CB 12.4654 20.7757 27.0084 72.9997 Constraint (T0340)L10.CB (T0340)R64.CB 12.8789 21.4648 27.9042 72.9980 Constraint (T0340)S23.CB (T0340)P86.CB 8.8748 14.7914 19.2288 72.9978 Constraint (T0340)N20.CB (T0340)P86.CB 10.2510 17.0850 22.2105 72.9942 Constraint (T0340)P5.CB (T0340)R43.CB 12.5033 20.8389 27.0906 72.9924 Constraint (T0340)K12.CB (T0340)L82.CB 10.3061 17.1768 22.3299 72.9923 Constraint (T0340)Q15.CB (T0340)A48.CB 11.6684 19.4474 25.2816 71.9960 Constraint (T0340)Y17.CB (T0340)P86.CB 11.9367 19.8945 25.8628 71.9943 Constraint (T0340)Q15.CB (T0340)A66.CB 11.7536 19.5894 25.4662 71.9922 Constraint (T0340)R27.CB (T0340)P86.CB 9.2695 15.4491 20.0839 71.8669 Constraint (T0340)P40.CB (T0340)P86.CB 12.7482 21.2471 27.6212 71.8633 Constraint (T0340)D36.CB (T0340)L63.CB 13.1056 21.8427 28.3956 71.1198 Constraint (T0340)P5.CB (T0340)D24.CB 11.3105 18.8509 24.5061 70.9981 Constraint (T0340)R11.CB (T0340)Y31.CB 13.0881 21.8136 28.3577 70.9978 Constraint (T0340)Y17.CB (T0340)P28.CB 12.4652 20.7753 27.0078 70.9924 Constraint (T0340)S39.CB (T0340)P86.CB 12.3997 20.6662 26.8661 70.7429 Constraint (T0340)S44.CB (T0340)E61.CB 12.7828 21.3047 27.6961 70.4210 Constraint (T0340)S34.CB (T0340)D77.CB 13.1941 21.9902 28.5872 70.1669 Constraint (T0340)S26.CB (T0340)Q58.CB 11.1717 18.6194 24.2053 70.0335 Constraint (T0340)C8.CB (T0340)D24.CB 11.5231 19.2052 24.9668 69.9992 Constraint (T0340)L10.CB (T0340)P86.CB 11.7349 19.5582 25.4256 69.9940 Constraint (T0340)H9.CB (T0340)P86.CB 12.1606 20.2676 26.3479 69.9940 Constraint (T0340)C8.CB (T0340)P86.CB 8.8794 14.7991 19.2388 69.9940 Constraint (T0340)R6.CB (T0340)P28.CB 11.8237 19.7062 25.6181 69.9921 Constraint (T0340)P28.CB (T0340)R75.CB 12.6706 21.1176 27.4529 69.9921 Constraint (T0340)S26.CB (T0340)A70.CB 10.6592 17.7653 23.0949 69.6189 Constraint (T0340)K25.CB (T0340)L82.CB 11.7491 19.5819 25.4564 69.1600 Constraint (T0340)D24.CB (T0340)A74.CB 11.0305 18.3842 23.8995 68.9978 Constraint (T0340)Q15.CB (T0340)R47.CB 11.9408 19.9013 25.8716 68.9960 Constraint (T0340)L7.CB (T0340)P28.CB 12.5901 20.9835 27.2786 68.9921 Constraint (T0340)C8.CB (T0340)P28.CB 12.2332 20.3886 26.5052 68.9921 Constraint (T0340)D24.CB (T0340)R80.CB 12.1330 20.2216 26.2881 68.7465 Constraint (T0340)K25.CB (T0340)A70.CB 9.7246 16.2077 21.0700 68.7453 Constraint (T0340)K25.CB (T0340)L46.CB 12.5834 20.9723 27.2640 68.0338 Constraint (T0340)C8.CB (T0340)A66.CB 13.2698 22.1163 28.7511 67.9993 Constraint (T0340)R6.CB (T0340)D24.CB 11.8216 19.7026 25.6134 67.9978 Constraint (T0340)L7.CB (T0340)P86.CB 9.6215 16.0358 20.8466 67.9940 Constraint (T0340)R6.CB (T0340)P86.CB 6.8574 11.4291 14.8578 67.9940 Constraint (T0340)P5.CB (T0340)P28.CB 10.2875 17.1458 22.2895 67.9924 Constraint (T0340)A66.CB (T0340)D77.CB 12.9060 21.5100 27.9630 67.1669 Constraint (T0340)K25.CB (T0340)L81.CB 11.8949 19.8248 25.7723 67.1598 Constraint (T0340)L10.CB (T0340)D24.CB 12.1198 20.1996 26.2595 66.9978 Constraint (T0340)Q15.CB (T0340)V83.CB 12.1155 20.1925 26.2503 66.9963 Constraint (T0340)L7.CB (T0340)H65.CB 13.1033 21.8389 28.3905 66.9924 Constraint (T0340)Q15.CB (T0340)Q30.CB 11.8405 19.7342 25.6544 66.9921 Constraint (T0340)R43.CB (T0340)P86.CB 12.5268 20.8779 27.1413 66.8646 Constraint (T0340)D24.CB (T0340)S39.CB 12.6880 21.1466 27.4906 66.7467 Constraint (T0340)R47.CB (T0340)E67.CB 13.2492 22.0820 28.7066 66.0407 Constraint (T0340)P5.CB (T0340)S39.CB 13.2403 22.0671 28.6872 65.9984 Constraint (T0340)Q15.CB (T0340)D50.CB 11.9363 19.8938 25.8619 65.9960 Constraint (T0340)P5.CB (T0340)R64.CB 12.9815 21.6358 28.1266 65.9940 Constraint (T0340)Q15.CB (T0340)E67.CB 12.0732 20.1220 26.1585 65.9922 Constraint (T0340)K12.CB (T0340)Q49.CB 13.0957 21.8262 28.3741 65.9921 Constraint (T0340)A66.CB (T0340)E78.CB 13.1527 21.9211 28.4974 65.8685 Constraint (T0340)S26.CB (T0340)L82.CB 11.6257 19.3761 25.1890 65.8672 Constraint (T0340)R27.CB (T0340)N56.CB 12.4287 20.7145 26.9288 65.7406 Constraint (T0340)R6.CB (T0340)E67.CB 13.2474 22.0791 28.7028 64.9999 Constraint (T0340)A48.CB (T0340)E78.CB 13.1505 21.9175 28.4928 64.1977 Constraint (T0340)K25.CB (T0340)P86.CB 10.3361 17.2268 22.3949 64.1600 Constraint (T0340)A74.CB (T0340)V84.CB 13.2875 22.1458 28.7895 64.1212 Constraint (T0340)S23.CB (T0340)P37.CB 13.1510 21.9183 28.4938 63.9982 Constraint (T0340)P5.CB (T0340)P86.CB 6.6517 11.0862 14.4120 63.9943 Constraint (T0340)R6.CB (T0340)E76.CB 12.4370 20.7283 26.9467 63.9935 Constraint (T0340)P28.CB (T0340)A74.CB 12.6248 21.0413 27.3537 63.9924 Constraint (T0340)S26.CB (T0340)L81.CB 12.1899 20.3164 26.4114 63.8677 Constraint (T0340)Q49.CB (T0340)A70.CB 13.4664 22.4440 29.1772 63.7406 Constraint (T0340)P5.CB (T0340)R27.CB 10.7682 17.9470 23.3311 62.9981 Constraint (T0340)R4.CB (T0340)V84.CB 4.5481 7.5802 9.8542 62.9981 Constraint (T0340)R4.CB (T0340)V83.CB 5.8999 9.8331 12.7831 62.9981 Constraint (T0340)R4.CB (T0340)I53.CB 6.9904 11.6507 15.1460 62.9981 Constraint (T0340)R4.CB (T0340)L52.CB 8.7513 14.5855 18.9611 62.9981 Constraint (T0340)R4.CB (T0340)R51.CB 7.0574 11.7623 15.2910 62.9981 Constraint (T0340)R4.CB (T0340)D50.CB 6.8860 11.4767 14.9197 62.9981 Constraint (T0340)R4.CB (T0340)Q49.CB 8.4653 14.1088 18.3414 62.9981 Constraint (T0340)R4.CB (T0340)A48.CB 10.2990 17.1651 22.3146 62.9981 Constraint (T0340)R4.CB (T0340)R47.CB 7.9718 13.2863 17.2721 62.9981 Constraint (T0340)R4.CB (T0340)L46.CB 8.7633 14.6054 18.9871 62.9981 Constraint (T0340)R4.CB (T0340)A41.CB 11.4532 19.0886 24.8152 62.9981 Constraint (T0340)R4.CB (T0340)V35.CB 11.7538 19.5897 25.4666 62.9981 Constraint (T0340)R4.CB (T0340)I32.CB 9.6260 16.0434 20.8564 62.9981 Constraint (T0340)R4.CB (T0340)Y31.CB 9.8566 16.4277 21.3560 62.9981 Constraint (T0340)R4.CB (T0340)F19.CB 11.7876 19.6460 25.5399 62.9981 Constraint (T0340)R11.CB (T0340)L63.CB 13.4619 22.4365 29.1674 62.9922 Constraint (T0340)K25.CB (T0340)V35.CB 12.6986 21.1643 27.5136 62.0335 Constraint (T0340)R4.CB (T0340)V68.CB 12.6316 21.0527 27.3685 61.9982 Constraint (T0340)R4.CB (T0340)E61.CB 9.7520 16.2534 21.1294 61.9982 Constraint (T0340)R4.CB (T0340)V60.CB 10.5248 17.5414 22.8038 61.9982 Constraint (T0340)R4.CB (T0340)N59.CB 10.5085 17.5142 22.7684 61.9982 Constraint (T0340)R4.CB (T0340)Q58.CB 12.2516 20.4194 26.5452 61.9982 Constraint (T0340)R4.CB (T0340)N56.CB 12.0752 20.1253 26.1629 61.9982 Constraint (T0340)R4.CB (T0340)V55.CB 10.9275 18.2125 23.6763 61.9982 Constraint (T0340)R4.CB (T0340)E54.CB 8.6121 14.3534 18.6595 61.9982 Constraint (T0340)R4.CB (T0340)L21.CB 11.9955 19.9926 25.9903 61.9982 Constraint (T0340)R4.CB (T0340)Y17.CB 12.9729 21.6215 28.1080 61.9982 Constraint (T0340)Q15.CB (T0340)Y31.CB 12.4068 20.6781 26.8815 61.9963 Constraint (T0340)P14.CB (T0340)L52.CB 12.4410 20.7350 26.9555 61.9924 Constraint (T0340)R4.CB (T0340)R80.CB 9.9712 16.6186 21.6042 60.9983 Constraint (T0340)R4.CB (T0340)A79.CB 12.0143 20.0238 26.0310 60.9983 Constraint (T0340)R4.CB (T0340)S44.CB 10.2357 17.0595 22.1774 60.9981 Constraint (T0340)R33.CB (T0340)E78.CB 13.2241 22.0402 28.6523 60.9980 Constraint (T0340)S71.CB (T0340)P86.CB 12.7535 21.2558 27.6325 60.9955 Constraint (T0340)H65.CB (T0340)E78.CB 12.9861 21.6435 28.1366 60.9464 Constraint (T0340)Q58.CB (T0340)P86.CB 12.5086 20.8477 27.1020 60.8634 Constraint (T0340)R47.CB (T0340)D77.CB 13.3422 22.2370 28.9081 60.0670 Constraint (T0340)R6.CB (T0340)K73.CB 13.2255 22.0424 28.6552 59.9984 Constraint (T0340)R4.CB (T0340)L63.CB 12.7843 21.3071 27.6993 59.9982 Constraint (T0340)R4.CB (T0340)Q30.CB 10.6327 17.7212 23.0376 59.9981 Constraint (T0340)P37.CB (T0340)P86.CB 12.4347 20.7245 26.9418 59.9955 Constraint (T0340)Q15.CB (T0340)V60.CB 12.2271 20.3785 26.4920 59.9925 Constraint (T0340)S44.CB (T0340)L63.CB 12.6752 21.1254 27.4630 59.1215 Constraint (T0340)K25.CB (T0340)R47.CB 12.0988 20.1647 26.2141 59.0338 Constraint (T0340)R6.CB (T0340)A74.CB 13.3983 22.3305 29.0297 58.9997 Constraint (T0340)L7.CB (T0340)D24.CB 12.4079 20.6798 26.8837 58.9995 Constraint (T0340)R4.CB (T0340)A42.CB 12.5467 20.9111 27.1845 58.9981 Constraint (T0340)N56.CB (T0340)P86.CB 12.8759 21.4598 27.8977 58.8636 Constraint (T0340)K25.CB (T0340)K73.CB 11.2802 18.8004 24.4405 58.7453 Constraint (T0340)R6.CB (T0340)R27.CB 12.2003 20.3337 26.4339 57.9978 Constraint (T0340)D24.CB (T0340)P40.CB 12.9999 21.6665 28.1665 57.7467 Constraint (T0340)R4.CB (T0340)L82.CB 6.7478 11.2463 14.6201 56.9981 Constraint (T0340)R4.CB (T0340)L81.CB 8.7487 14.5812 18.9556 56.9981 Constraint (T0340)S34.CB (T0340)Q58.CB 13.1762 21.9603 28.5484 56.9980 Constraint (T0340)V69.CB (T0340)P86.CB 12.4566 20.7610 26.9893 56.9942 Constraint (T0340)R11.CB (T0340)E67.CB 13.3953 22.3256 29.0232 56.9922 Constraint (T0340)S44.CB (T0340)H65.CB 12.6823 21.1372 27.4784 56.9205 Constraint (T0340)R4.CB (T0340)S23.CB 12.2370 20.3950 26.5135 55.9982 Constraint (T0340)L3.CB (T0340)V84.CB 4.4082 7.3469 9.5510 55.9982 Constraint (T0340)L3.CB (T0340)V83.CB 6.6687 11.1144 14.4488 55.9982 Constraint (T0340)L3.CB (T0340)I53.CB 7.2696 12.1161 15.7509 55.9982 Constraint (T0340)L3.CB (T0340)L52.CB 8.9824 14.9707 19.4619 55.9982 Constraint (T0340)L3.CB (T0340)R51.CB 6.5456 10.9093 14.1821 55.9982 Constraint (T0340)L3.CB (T0340)D50.CB 6.9293 11.5489 15.0135 55.9982 Constraint (T0340)L3.CB (T0340)Q49.CB 7.6794 12.7991 16.6388 55.9982 Constraint (T0340)L3.CB (T0340)R47.CB 8.1457 13.5762 17.6490 55.9982 Constraint (T0340)L3.CB (T0340)L46.CB 9.5138 15.8564 20.6133 55.9982 Constraint (T0340)L3.CB (T0340)I32.CB 9.5873 15.9788 20.7725 55.9982 Constraint (T0340)L3.CB (T0340)Y31.CB 9.1631 15.2719 19.8535 55.9982 Constraint (T0340)K12.CB (T0340)S23.CB 12.4973 20.8288 27.0774 55.9979 Constraint (T0340)S26.CB (T0340)P86.CB 9.5184 15.8640 20.6232 55.8673 Constraint (T0340)D24.CB (T0340)S44.CB 12.9373 21.5622 28.0309 55.4540 Constraint (T0340)L3.CB (T0340)R80.CB 11.5234 19.2057 24.9674 54.9983 Constraint (T0340)L3.CB (T0340)E61.CB 9.3752 15.6254 20.3130 54.9983 Constraint (T0340)L3.CB (T0340)V60.CB 10.6488 17.7480 23.0724 54.9983 Constraint (T0340)L3.CB (T0340)N59.CB 10.8774 18.1290 23.5676 54.9983 Constraint (T0340)L3.CB (T0340)V55.CB 11.6724 19.4540 25.2901 54.9983 Constraint (T0340)L3.CB (T0340)E54.CB 9.4165 15.6941 20.4023 54.9983 Constraint (T0340)R4.CB (T0340)R33.CB 12.3040 20.5067 26.6587 54.9981 Constraint (T0340)D24.CB (T0340)A42.CB 12.8621 21.4368 27.8679 54.7467 Constraint (T0340)L3.CB (T0340)A48.CB 9.7874 16.3124 21.2061 53.9982 Constraint (T0340)L3.CB (T0340)F19.CB 12.0196 20.0327 26.0425 53.9982 Constraint (T0340)P14.CB (T0340)R33.CB 12.6452 21.0753 27.3979 53.9924 Constraint (T0340)Q49.CB (T0340)S87.CB 6.2895 10.4825 13.6273 53.8653 Constraint (T0340)R47.CB (T0340)S87.CB 7.6136 12.6893 16.4961 53.8653 Constraint (T0340)S39.CB (T0340)L63.CB 13.0621 21.7701 28.3012 53.1202 Constraint (T0340)L3.CB (T0340)L21.CB 11.7016 19.5026 25.3534 52.9983 Constraint (T0340)L3.CB (T0340)S44.CB 11.4912 19.1520 24.8977 52.9983 Constraint (T0340)P5.CB (T0340)K25.CB 12.7215 21.2024 27.5632 52.9982 Constraint (T0340)R11.CB (T0340)Q49.CB 13.3469 22.2448 28.9182 52.9978 Constraint (T0340)Q15.CB (T0340)Q58.CB 11.8136 19.6894 25.5962 52.9925 Constraint (T0340)K12.CB (T0340)R64.CB 13.1292 21.8820 28.4466 52.9923 Constraint (T0340)A48.CB (T0340)S87.CB 8.5241 14.2068 18.4688 52.8654 Constraint (T0340)I53.CB (T0340)S87.CB 8.7453 14.5756 18.9483 52.8653 Constraint (T0340)L52.CB (T0340)S87.CB 9.3638 15.6063 20.2882 52.8653 Constraint (T0340)I32.CB (T0340)S87.CB 8.9685 14.9476 19.4318 52.8653 Constraint (T0340)Y31.CB (T0340)S87.CB 8.1980 13.6633 17.7623 52.8653 Constraint (T0340)D36.CB (T0340)R64.CB 13.3422 22.2371 28.9082 52.2980 Constraint (T0340)R27.CB (T0340)K73.CB 12.4787 20.7979 27.0372 51.9994 Constraint (T0340)R4.CB (T0340)I72.CB 13.1328 21.8879 28.4543 51.9984 Constraint (T0340)R4.CB (T0340)P40.CB 13.1327 21.8878 28.4542 51.9982 Constraint (T0340)R51.CB (T0340)S87.CB 6.5626 10.9377 14.2190 51.8653 Constraint (T0340)D50.CB (T0340)S87.CB 6.8174 11.3624 14.7711 51.8653 Constraint (T0340)L46.CB (T0340)S87.CB 9.5311 15.8852 20.6508 51.8653 Constraint (T0340)Q30.CB (T0340)S87.CB 10.1486 16.9143 21.9886 51.8653 Constraint (T0340)L3.CB (T0340)V35.CB 11.7962 19.6603 25.5583 50.9982 Constraint (T0340)R4.CB (T0340)H22.CB 12.4716 20.7859 27.0217 50.9982 Constraint (T0340)L3.CB (T0340)Q30.CB 10.2262 17.0436 22.1567 50.9982 Constraint (T0340)Q15.CB (T0340)E54.CB 12.4372 20.7287 26.9473 50.9925 Constraint (T0340)R33.CB (T0340)S87.CB 10.5307 17.5512 22.8166 50.8654 Constraint (T0340)A42.CB (T0340)A70.CB 13.3473 22.2455 28.9191 50.0421 Constraint (T0340)R4.CB (T0340)R43.CB 12.8052 21.3420 27.7446 49.9984 Constraint (T0340)L3.CB (T0340)D24.CB 11.9510 19.9184 25.8939 49.9983 Constraint (T0340)L7.CB (T0340)R27.CB 12.8265 21.3776 27.7908 49.9981 Constraint (T0340)H9.CB (T0340)H65.CB 13.2855 22.1424 28.7852 49.9980 Constraint (T0340)S26.CB (T0340)K73.CB 12.1765 20.2942 26.3824 49.8722 Constraint (T0340)R27.CB (T0340)R80.CB 12.9681 21.6135 28.0976 49.8675 Constraint (T0340)V35.CB (T0340)S87.CB 10.9183 18.1972 23.6563 49.8654 Constraint (T0340)E54.CB (T0340)S87.CB 10.8480 18.0799 23.5039 49.8653 Constraint (T0340)E67.CB (T0340)P86.CB 12.8820 21.4700 27.9110 49.8648 Constraint (T0340)L3.CB (T0340)A41.CB 11.8721 19.7869 25.7229 48.9996 Constraint (T0340)L3.CB (T0340)H22.CB 11.6954 19.4924 25.3401 48.9984 Constraint (T0340)L3.CB (T0340)Q58.CB 12.8138 21.3564 27.7633 48.9983 Constraint (T0340)L3.CB (T0340)L82.CB 7.7391 12.8984 16.7680 48.9983 Constraint (T0340)L3.CB (T0340)L81.CB 9.6865 16.1442 20.9875 48.9983 Constraint (T0340)H9.CB (T0340)S23.CB 12.7930 21.3217 27.7182 48.9982 Constraint (T0340)R4.CB (T0340)P28.CB 11.8232 19.7054 25.6170 48.9982 Constraint (T0340)R4.CB (T0340)P86.CB 5.9658 9.9430 12.9258 48.9981 Constraint (T0340)S34.CB (T0340)S87.CB 11.6637 19.4396 25.2714 48.8654 Constraint (T0340)V60.CB (T0340)S87.CB 11.1267 18.5446 24.1080 48.8653 Constraint (T0340)E61.CB (T0340)E76.CB 12.6195 21.0325 27.3423 47.9993 Constraint (T0340)C8.CB (T0340)R27.CB 12.6568 21.0947 27.4231 47.9987 Constraint (T0340)L3.CB (T0340)V68.CB 12.3491 20.5818 26.7564 47.9985 Constraint (T0340)L3.CB (T0340)S23.CB 11.0228 18.3713 23.8827 47.9985 Constraint (T0340)L3.CB (T0340)R33.CB 11.5889 19.3147 25.1092 47.9984 Constraint (T0340)S34.CB (T0340)E76.CB 13.1065 21.8442 28.3975 47.9983 Constraint (T0340)K25.CB (T0340)A74.CB 11.8383 19.7305 25.6496 47.9982 Constraint (T0340)R64.CB (T0340)P86.CB 12.3460 20.5766 26.7496 47.9944 Constraint (T0340)P28.CB (T0340)S87.CB 10.1125 16.8542 21.9105 47.8653 Constraint (T0340)L3.CB (T0340)A79.CB 13.0738 21.7896 28.3265 46.9997 Constraint (T0340)R47.CB (T0340)E76.CB 13.4581 22.4301 29.1592 46.9987 Constraint (T0340)R4.CB (T0340)S71.CB 13.3361 22.2268 28.8949 45.9997 Constraint (T0340)P5.CB (T0340)S26.CB 12.0884 20.1474 26.1916 45.9982 Constraint (T0340)P14.CB (T0340)Q58.CB 12.1868 20.3113 26.4047 45.9924 Constraint (T0340)A41.CB (T0340)S87.CB 11.6422 19.4037 25.2249 45.8668 Constraint (T0340)S44.CB (T0340)S87.CB 11.8639 19.7732 25.7052 45.8654 Constraint (T0340)P37.CB (T0340)V84.CB 13.4133 22.3556 29.0622 45.8628 Constraint (T0340)R27.CB (T0340)A41.CB 12.9668 21.6113 28.0947 45.7419 Constraint (T0340)Y17.CB (T0340)R27.CB 13.0438 21.7396 28.2615 44.9994 Constraint (T0340)L3.CB (T0340)L63.CB 12.1522 20.2536 26.3297 44.9986 Constraint (T0340)L3.CB (T0340)P28.CB 10.5781 17.6302 22.9193 44.9983 Constraint (T0340)K25.CB (T0340)R75.CB 12.4307 20.7178 26.9332 44.9982 Constraint (T0340)L3.CB (T0340)P86.CB 5.1515 8.5858 11.1616 44.9982 Constraint (T0340)Q15.CB (T0340)L82.CB 12.4976 20.8293 27.0782 44.9962 Constraint (T0340)S23.CB (T0340)S87.CB 10.9241 18.2069 23.6689 43.9981 Constraint (T0340)E61.CB (T0340)S87.CB 10.6935 17.8225 23.1692 43.8653 Constraint (T0340)V55.CB (T0340)S87.CB 12.3587 20.5979 26.7772 43.8653 Constraint (T0340)K25.CB (T0340)N56.CB 12.1512 20.2521 26.3277 43.7455 Constraint (T0340)L3.CB (T0340)N56.CB 12.9898 21.6497 28.1446 42.9983 Constraint (T0340)H22.CB (T0340)S87.CB 10.4579 17.4299 22.6589 42.9963 Constraint (T0340)L21.CB (T0340)S87.CB 11.1993 18.6655 24.2652 42.9963 Constraint (T0340)P37.CB (T0340)H65.CB 12.9761 21.6268 28.1149 42.9199 Constraint (T0340)N59.CB (T0340)S87.CB 11.7562 19.5937 25.4718 42.8653 Constraint (T0340)R51.CB (T0340)E76.CB 12.8589 21.4315 27.8609 41.9999 Constraint (T0340)L3.CB (T0340)S34.CB 12.6516 21.0861 27.4119 41.9997 Constraint (T0340)R4.CB (T0340)E78.CB 13.2505 22.0841 28.7093 41.9987 Constraint (T0340)R27.CB (T0340)A79.CB 12.8402 21.4003 27.8204 41.8732 Constraint (T0340)R27.CB (T0340)S87.CB 9.5328 15.8881 20.6545 41.8672 Constraint (T0340)A42.CB (T0340)S87.CB 12.2416 20.4026 26.5234 41.8668 Constraint (T0340)S44.CB (T0340)E67.CB 12.8386 21.3976 27.8169 41.0424 Constraint (T0340)P40.CB (T0340)E61.CB 13.5156 22.5260 29.2838 41.0422 Constraint (T0340)D24.CB (T0340)E76.CB 12.8892 21.4820 27.9265 41.0000 Constraint (T0340)L7.CB (T0340)R64.CB 13.4860 22.4766 29.2196 40.9986 Constraint (T0340)L3.CB (T0340)R27.CB 10.4294 17.3824 22.5971 40.9983 Constraint (T0340)P14.CB (T0340)A48.CB 13.1113 21.8521 28.4078 40.9983 Constraint (T0340)L7.CB (T0340)P37.CB 13.2364 22.0606 28.6788 40.9982 Constraint (T0340)R4.CB (T0340)R27.CB 11.5542 19.2570 25.0341 40.9982 Constraint (T0340)F19.CB (T0340)S87.CB 11.4214 19.0356 24.7463 40.9963 Constraint (T0340)K25.CB (T0340)A41.CB 13.1144 21.8573 28.4144 40.6207 Constraint (T0340)P5.CB (T0340)E76.CB 12.8206 21.3677 27.7780 39.9999 Constraint (T0340)C8.CB (T0340)S87.CB 10.4183 17.3639 22.5731 39.9962 Constraint (T0340)R6.CB (T0340)S87.CB 7.9656 13.2759 17.2587 39.9962 Constraint (T0340)S26.CB (T0340)L46.CB 12.1569 20.2614 26.3398 39.7424 Constraint (T0340)D24.CB (T0340)S87.CB 9.9650 16.6083 21.5908 39.4527 Constraint (T0340)P37.CB (T0340)E76.CB 12.4236 20.7060 26.9179 39.1670 Constraint (T0340)R33.CB (T0340)E76.CB 13.2209 22.0348 28.6452 38.9999 Constraint (T0340)S23.CB (T0340)E76.CB 13.0189 21.6982 28.2077 38.9998 Constraint (T0340)Q15.CB (T0340)Q49.CB 13.0569 21.7615 28.2899 38.9982 Constraint (T0340)P5.CB (T0340)S87.CB 7.7822 12.9704 16.8615 38.9964 Constraint (T0340)N20.CB (T0340)S87.CB 12.1307 20.2179 26.2833 38.9963 Constraint (T0340)L7.CB (T0340)S87.CB 10.7741 17.9569 23.3440 38.9962 Constraint (T0340)V68.CB (T0340)S87.CB 12.2858 20.4763 26.6192 38.8654 Constraint (T0340)R47.CB (T0340)T88.CB 8.2602 13.7669 17.8970 38.5791 Constraint (T0340)K12.CB (T0340)D24.CB 12.9501 21.5834 28.0585 37.9998 Constraint (T0340)R4.CB (T0340)S34.CB 12.9477 21.5796 28.0535 37.9997 Constraint (T0340)L3.CB (T0340)A42.CB 12.8162 21.3604 27.7685 37.9995 Constraint (T0340)R51.CB (T0340)T88.CB 8.2187 13.6979 17.8072 37.5791 Constraint (T0340)D50.CB (T0340)T88.CB 7.9904 13.3173 17.3124 37.5791 Constraint (T0340)Q49.CB (T0340)T88.CB 7.0387 11.7312 15.2505 37.5791 Constraint (T0340)I32.CB (T0340)T88.CB 9.9408 16.5680 21.5385 37.5791 Constraint (T0340)Y31.CB (T0340)T88.CB 9.3249 15.5415 20.2040 37.5791 Constraint (T0340)Q30.CB (T0340)T88.CB 11.6233 19.3721 25.1837 37.5791 Constraint (T0340)H65.CB (T0340)D77.CB 12.9376 21.5626 28.0314 37.0465 Constraint (T0340)A48.CB (T0340)T88.CB 8.8272 14.7119 19.1255 36.5791 Constraint (T0340)P14.CB (T0340)R47.CB 12.9969 21.6615 28.1599 35.9983 Constraint (T0340)Q15.CB (T0340)L63.CB 12.2005 20.3342 26.4345 35.9945 Constraint (T0340)R33.CB (T0340)T88.CB 11.0645 18.4408 23.9730 35.5791 Constraint (T0340)L52.CB (T0340)T88.CB 10.6346 17.7243 23.0416 35.5791 Constraint (T0340)S26.CB (T0340)N56.CB 12.4917 20.8195 27.0654 35.0351 Constraint (T0340)P5.CB (T0340)A74.CB 13.3911 22.3185 29.0140 34.9999 Constraint (T0340)L3.CB (T0340)N20.CB 12.9483 21.5806 28.0547 34.9998 Constraint (T0340)R4.CB (T0340)D24.CB 11.9202 19.8670 25.8270 34.9995 Constraint (T0340)P14.CB (T0340)V60.CB 12.8548 21.4247 27.8520 34.9926 Constraint (T0340)H22.CB (T0340)T88.CB 11.6073 19.3455 25.1492 33.9982 Constraint (T0340)R6.CB (T0340)Q15.CB 13.3016 22.1693 28.8201 33.9980 Constraint (T0340)P14.CB (T0340)V83.CB 12.9627 21.6046 28.0859 33.9947 Constraint (T0340)P14.CB (T0340)E67.CB 12.5113 20.8522 27.1079 33.9928 Constraint (T0340)P14.CB (T0340)Q30.CB 12.9372 21.5620 28.0307 33.9927 Constraint (T0340)S26.CB (T0340)S87.CB 9.8878 16.4797 21.4236 33.8675 Constraint (T0340)V35.CB (T0340)T88.CB 11.1978 18.6630 24.2619 33.5792 Constraint (T0340)I53.CB (T0340)T88.CB 10.0918 16.8197 21.8655 33.5791 Constraint (T0340)P5.CB (T0340)A70.CB 13.4131 22.3551 29.0616 32.9999 Constraint (T0340)R27.CB (T0340)A74.CB 12.4110 20.6849 26.8904 32.9997 Constraint (T0340)R4.CB (T0340)S87.CB 6.2246 10.3744 13.4867 32.9983 Constraint (T0340)R4.CB (T0340)N20.CB 13.2164 22.0273 28.6355 32.9982 Constraint (T0340)P14.CB (T0340)A66.CB 12.3368 20.5614 26.7298 32.9966 Constraint (T0340)K25.CB (T0340)A79.CB 12.8060 21.3433 27.7462 32.7457 Constraint (T0340)S26.CB (T0340)R47.CB 11.1611 18.6018 24.1823 32.7424 Constraint (T0340)K25.CB (T0340)S87.CB 10.4169 17.3616 22.5700 32.1603 Constraint (T0340)S34.CB (T0340)T88.CB 11.8494 19.7489 25.6736 31.5805 Constraint (T0340)L46.CB (T0340)T88.CB 10.0928 16.8213 21.8677 31.5794 Constraint (T0340)R47.CB (T0340)R64.CB 13.2498 22.0830 28.7080 31.2983 Constraint (T0340)R43.CB (T0340)Q58.CB 13.5113 22.5188 29.2745 31.1199 Constraint (T0340)D36.CB (T0340)Q58.CB 12.9609 21.6014 28.0819 30.9983 Constraint (T0340)L21.CB (T0340)T88.CB 12.4257 20.7095 26.9223 30.9982 Constraint (T0340)P14.CB (T0340)D50.CB 13.0563 21.7604 28.2886 30.9948 Constraint (T0340)H65.CB (T0340)S87.CB 12.4492 20.7486 26.9732 30.7436 Constraint (T0340)L63.CB (T0340)S87.CB 12.5782 20.9637 27.2528 30.1181 Constraint (T0340)Y31.CB (T0340)E76.CB 13.0294 21.7156 28.2303 29.9999 Constraint (T0340)L3.CB (T0340)S87.CB 6.2022 10.3371 13.4382 29.9984 Constraint (T0340)Q15.CB (T0340)D24.CB 12.5142 20.8569 27.1140 29.9982 Constraint (T0340)R47.CB (T0340)A70.CB 13.5434 22.5723 29.3440 29.9980 Constraint (T0340)R27.CB (T0340)R75.CB 12.4987 20.8312 27.0806 28.9998 Constraint (T0340)M2.CB (T0340)V84.CB 6.2791 10.4652 13.6048 28.9997 Constraint (T0340)M2.CB (T0340)V83.CB 7.2924 12.1540 15.8002 28.9997 Constraint (T0340)M2.CB (T0340)R51.CB 8.1778 13.6296 17.7185 28.9997 Constraint (T0340)M2.CB (T0340)D50.CB 7.3536 12.2560 15.9327 28.9997 Constraint (T0340)M2.CB (T0340)Q49.CB 8.0622 13.4370 17.4681 28.9997 Constraint (T0340)M2.CB (T0340)A48.CB 9.8405 16.4009 21.3211 28.9997 Constraint (T0340)M2.CB (T0340)R47.CB 7.6079 12.6799 16.4839 28.9997 Constraint (T0340)M2.CB (T0340)L46.CB 9.1029 15.1715 19.7230 28.9997 Constraint (T0340)M2.CB (T0340)I32.CB 10.0360 16.7267 21.7447 28.9997 Constraint (T0340)M2.CB (T0340)Y31.CB 10.3468 17.2447 22.4181 28.9997 Constraint (T0340)Q15.CB (T0340)R51.CB 13.0602 21.7671 28.2972 28.9982 Constraint (T0340)P14.CB (T0340)E54.CB 12.7762 21.2937 27.6818 28.9945 Constraint (T0340)R33.CB (T0340)D77.CB 13.5951 22.6585 29.4561 28.7467 Constraint (T0340)S26.CB (T0340)V35.CB 12.2168 20.3613 26.4697 28.7426 Constraint (T0340)P37.CB (T0340)L82.CB 13.2410 22.0683 28.6888 28.3197 Constraint (T0340)M2.CB (T0340)V60.CB 12.2995 20.4991 26.6488 27.9998 Constraint (T0340)M2.CB (T0340)E54.CB 10.4921 17.4868 22.7328 27.9998 Constraint (T0340)M2.CB (T0340)I53.CB 8.6632 14.4387 18.7703 27.9998 Constraint (T0340)M2.CB (T0340)L52.CB 10.0021 16.6702 21.6712 27.9998 Constraint (T0340)M2.CB (T0340)S44.CB 10.3788 17.2980 22.4874 27.9998 Constraint (T0340)M2.CB (T0340)A41.CB 11.5565 19.2608 25.0391 27.9998 Constraint (T0340)M2.CB (T0340)F19.CB 12.0645 20.1075 26.1398 27.9998 Constraint (T0340)H22.CB (T0340)E78.CB 13.3636 22.2727 28.9544 27.9996 Constraint (T0340)R6.CB (T0340)T88.CB 9.1969 15.3281 19.9266 27.9985 Constraint (T0340)P5.CB (T0340)T88.CB 9.3690 15.6150 20.2995 27.9985 Constraint (T0340)S23.CB (T0340)T88.CB 12.1773 20.2955 26.3841 27.9985 Constraint (T0340)R51.CB (T0340)R89.CB 8.8811 14.8018 19.2423 27.8055 Constraint (T0340)D50.CB (T0340)R89.CB 8.8171 14.6952 19.1037 27.8055 Constraint (T0340)Q49.CB (T0340)R89.CB 8.1406 13.5677 17.6381 27.8055 Constraint (T0340)V60.CB (T0340)T88.CB 12.2342 20.3904 26.5075 27.5791 Constraint (T0340)Y31.CB (T0340)R89.CB 9.9961 16.6601 21.6582 27.0982 Constraint (T0340)R47.CB (T0340)A66.CB 13.2300 22.0500 28.6650 27.0409 Constraint (T0340)R64.CB (T0340)E78.CB 13.5105 22.5175 29.2727 26.9999 Constraint (T0340)H9.CB (T0340)D24.CB 13.0549 21.7581 28.2855 26.9998 Constraint (T0340)L3.CB (T0340)Y17.CB 13.1727 21.9545 28.5409 26.9998 Constraint (T0340)F19.CB (T0340)T88.CB 12.2565 20.4275 26.5558 26.9982 Constraint (T0340)R11.CB (T0340)H22.CB 12.9915 21.6525 28.1482 26.9980 Constraint (T0340)A66.CB (T0340)P86.CB 13.0946 21.8243 28.3716 26.9960 Constraint (T0340)K12.CB (T0340)E61.CB 13.1551 21.9252 28.5027 26.9925 Constraint (T0340)A48.CB (T0340)R89.CB 9.7616 16.2694 21.1502 26.8056 Constraint (T0340)A41.CB (T0340)T88.CB 11.7549 19.5916 25.4690 26.5804 Constraint (T0340)P28.CB (T0340)T88.CB 11.6198 19.3663 25.1761 26.5794 Constraint (T0340)H22.CB (T0340)E76.CB 13.2070 22.0117 28.6152 25.9998 Constraint (T0340)M2.CB (T0340)E61.CB 11.0136 18.3561 23.8629 25.9998 Constraint (T0340)M2.CB (T0340)V55.CB 12.2940 20.4900 26.6370 25.9998 Constraint (T0340)M2.CB (T0340)V35.CB 11.2428 18.7380 24.3594 25.9998 Constraint (T0340)L10.CB (T0340)P28.CB 12.5255 20.8759 27.1386 25.9982 Constraint (T0340)P5.CB (T0340)D77.CB 13.4014 22.3356 29.0363 25.9928 Constraint (T0340)R47.CB (T0340)R89.CB 8.6809 14.4682 18.8087 25.8055 Constraint (T0340)I32.CB (T0340)R89.CB 10.4654 17.4424 22.6751 25.8055 Constraint (T0340)S26.CB (T0340)R75.CB 12.8336 21.3893 27.8060 24.9999 Constraint (T0340)M2.CB (T0340)N59.CB 12.3404 20.5674 26.7376 24.9999 Constraint (T0340)M2.CB (T0340)L21.CB 12.3946 20.6577 26.8551 24.9998 Constraint (T0340)M2.CB (T0340)L82.CB 8.5871 14.3119 18.6054 24.9998 Constraint (T0340)M2.CB (T0340)L81.CB 10.1838 16.9731 22.0650 24.9998 Constraint (T0340)S26.CB (T0340)A74.CB 12.1330 20.2217 26.2882 24.9990 Constraint (T0340)R4.CB (T0340)T88.CB 8.4008 14.0013 18.2017 24.9985 Constraint (T0340)R11.CB (T0340)H65.CB 13.3889 22.3148 29.0092 24.9983 Constraint (T0340)E54.CB (T0340)T88.CB 11.7347 19.5579 25.4253 24.5804 Constraint (T0340)M2.CB (T0340)R80.CB 11.2897 18.8162 24.4611 24.0000 Constraint (T0340)R6.CB (T0340)A70.CB 13.6290 22.7149 29.5294 23.9999 Constraint (T0340)P5.CB (T0340)K73.CB 13.5035 22.5058 29.2576 23.9999 Constraint (T0340)C8.CB (T0340)T88.CB 11.1572 18.5953 24.1739 23.9985 Constraint (T0340)Q15.CB (T0340)R64.CB 11.8992 19.8319 25.7815 23.9945 Constraint (T0340)P14.CB (T0340)L82.CB 12.8799 21.4666 27.9066 23.9944 Constraint (T0340)D24.CB (T0340)T88.CB 11.3272 18.8787 24.5423 23.8721 Constraint (T0340)R33.CB (T0340)R89.CB 11.6429 19.4049 25.2264 23.8056 Constraint (T0340)I53.CB (T0340)R89.CB 10.1561 16.9269 22.0050 23.8055 Constraint (T0340)L52.CB (T0340)R89.CB 10.6200 17.7000 23.0100 23.8055 Constraint (T0340)K25.CB (T0340)R80.CB 13.0479 21.7464 28.2704 23.7459 Constraint (T0340)S44.CB (T0340)T88.CB 11.5322 19.2203 24.9864 23.5794 Constraint (T0340)S34.CB (T0340)N59.CB 13.2512 22.0853 28.7109 23.0408 Constraint (T0340)S26.CB (T0340)A41.CB 12.6407 21.0678 27.3881 23.0353 Constraint (T0340)M2.CB (T0340)S23.CB 12.6108 21.0179 27.3233 22.9999 Constraint (T0340)L3.CB (T0340)I72.CB 12.9715 21.6192 28.1050 22.9998 Constraint (T0340)N20.CB (T0340)T88.CB 12.9238 21.5397 28.0017 22.9997 Constraint (T0340)L7.CB (T0340)T88.CB 11.7882 19.6470 25.5412 22.9985 Constraint (T0340)L3.CB (T0340)T88.CB 8.1952 13.6587 17.7563 22.9985 Constraint (T0340)E61.CB (T0340)T88.CB 11.7457 19.5762 25.4491 22.5791 Constraint (T0340)P40.CB (T0340)R64.CB 13.5665 22.6109 29.3941 22.2996 Constraint (T0340)E61.CB (T0340)D77.CB 13.3007 22.1678 28.8181 22.0672 Constraint (T0340)C8.CB (T0340)K25.CB 13.1891 21.9818 28.5763 21.9999 Constraint (T0340)M2.CB (T0340)Q30.CB 11.5562 19.2604 25.0385 21.9998 Constraint (T0340)M2.CB (T0340)S34.CB 12.6168 21.0281 27.3365 21.9998 Constraint (T0340)M2.CB (T0340)R33.CB 11.9737 19.9561 25.9429 21.9998 Constraint (T0340)R6.CB (T0340)S26.CB 12.2698 20.4496 26.5845 21.9997 Constraint (T0340)R6.CB (T0340)R89.CB 9.6488 16.0813 20.9056 21.9985 Constraint (T0340)L3.CB (T0340)H65.CB 12.9496 21.5827 28.0575 21.9985 Constraint (T0340)P14.CB (T0340)H65.CB 12.6684 21.1140 27.4482 21.9967 Constraint (T0340)I72.CB (T0340)S87.CB 13.2222 22.0370 28.6481 21.8668 Constraint (T0340)M2.CB (T0340)H22.CB 12.7621 21.2702 27.6512 20.9999 Constraint (T0340)R4.CB (T0340)R75.CB 13.3141 22.1901 28.8471 20.9999 Constraint (T0340)M2.CB (T0340)R43.CB 12.1563 20.2604 26.3385 20.9999 Constraint (T0340)M2.CB (T0340)A42.CB 11.5096 19.1827 24.9375 20.9999 Constraint (T0340)M2.CB (T0340)P86.CB 6.8378 11.3963 14.8151 20.9997 Constraint (T0340)L10.CB (T0340)S87.CB 12.6610 21.1016 27.4321 20.9978 Constraint (T0340)R27.CB (T0340)T88.CB 11.4580 19.0966 24.8256 20.8721 Constraint (T0340)L3.CB (T0340)K25.CB 11.8780 19.7966 25.7356 19.9999 Constraint (T0340)P14.CB (T0340)L63.CB 13.0641 21.7734 28.3054 19.9987 Constraint (T0340)P5.CB (T0340)R89.CB 9.2211 15.3685 19.9790 19.9985 Constraint (T0340)H22.CB (T0340)R89.CB 11.7461 19.5768 25.4498 19.9983 Constraint (T0340)H9.CB (T0340)S87.CB 12.5698 20.9497 27.2346 19.9977 Constraint (T0340)L46.CB (T0340)R89.CB 10.5981 17.6635 22.9625 19.8058 Constraint (T0340)V35.CB (T0340)R89.CB 11.0791 18.4651 24.0047 19.8056 Constraint (T0340)S34.CB (T0340)R89.CB 12.2289 20.3815 26.4959 19.8056 Constraint (T0340)Q30.CB (T0340)R89.CB 11.1485 18.5808 24.1550 19.8055 Constraint (T0340)S26.CB (T0340)A79.CB 12.6548 21.0914 27.4188 19.1618 Constraint (T0340)S23.CB (T0340)E78.CB 13.2336 22.0561 28.6729 18.9997 Constraint (T0340)D24.CB (T0340)R89.CB 11.4563 19.0939 24.8220 18.9985 Constraint (T0340)L3.CB (T0340)S26.CB 11.2479 18.7466 24.3705 18.9984 Constraint (T0340)Q15.CB (T0340)I53.CB 12.6455 21.0758 27.3986 18.9984 Constraint (T0340)R75.CB (T0340)P86.CB 13.0703 21.7838 28.3190 18.9960 Constraint (T0340)S26.CB (T0340)R80.CB 12.7047 21.1744 27.5268 18.1618 Constraint (T0340)P5.CB (T0340)D36.CB 13.5847 22.6412 29.4335 17.9999 Constraint (T0340)R4.CB (T0340)S39.CB 13.5130 22.5216 29.2781 17.9986 Constraint (T0340)R4.CB (T0340)R89.CB 8.7836 14.6393 19.0311 17.9985 Constraint (T0340)F19.CB (T0340)R89.CB 12.1747 20.2912 26.3785 17.9983 Constraint (T0340)R43.CB (T0340)S87.CB 12.5981 20.9968 27.2959 17.8669 Constraint (T0340)A42.CB (T0340)T88.CB 11.2899 18.8165 24.4615 17.5809 Constraint (T0340)R51.CB (T0340)D77.CB 13.3453 22.2421 28.9148 17.0685 Constraint (T0340)S44.CB (T0340)A66.CB 13.1019 21.8364 28.3874 17.0427 Constraint (T0340)P37.CB (T0340)S71.CB 12.9387 21.5645 28.0339 17.0421 Constraint (T0340)Y17.CB (T0340)S26.CB 12.8250 21.3750 27.7875 17.0000 Constraint (T0340)D24.CB (T0340)E78.CB 13.2604 22.1006 28.7308 17.0000 Constraint (T0340)L3.CB (T0340)R89.CB 8.7364 14.5606 18.9288 16.9985 Constraint (T0340)C8.CB (T0340)R89.CB 11.1798 18.6330 24.2228 16.9985 Constraint (T0340)Q15.CB (T0340)N59.CB 12.5146 20.8577 27.1149 16.9984 Constraint (T0340)L21.CB (T0340)R89.CB 12.0034 20.0057 26.0074 16.9982 Constraint (T0340)D24.CB (T0340)P37.CB 13.0375 21.7291 28.2479 16.7471 Constraint (T0340)S26.CB (T0340)T88.CB 11.1501 18.5834 24.1584 16.5808 Constraint (T0340)P28.CB (T0340)S44.CB 12.6197 21.0328 27.3427 16.1217 Constraint (T0340)E61.CB (T0340)R89.CB 10.6976 17.8294 23.1782 16.0982 Constraint (T0340)M2.CB (T0340)A79.CB 12.3359 20.5599 26.7279 16.0000 Constraint (T0340)M2.CB (T0340)N56.CB 12.9172 21.5286 27.9872 16.0000 Constraint (T0340)M2.CB (T0340)P28.CB 12.4279 20.7132 26.9272 15.9998 Constraint (T0340)P14.CB (T0340)Y31.CB 13.2867 22.1445 28.7878 15.9987 Constraint (T0340)Y31.CB (T0340)L90.CB 11.4458 19.0764 24.7993 15.7064 Constraint (T0340)Q49.CB (T0340)E78.CB 13.5038 22.5063 29.2582 14.9999 Constraint (T0340)M2.CB (T0340)P40.CB 12.7721 21.2868 27.6729 14.9999 Constraint (T0340)M2.CB (T0340)N20.CB 13.3448 22.2413 28.9137 14.9999 Constraint (T0340)R4.CB (T0340)H65.CB 13.5385 22.5642 29.3335 14.9998 Constraint (T0340)R4.CB (T0340)K25.CB 12.1355 20.2258 26.2936 14.9998 Constraint (T0340)R6.CB (T0340)K25.CB 12.7898 21.3162 27.7111 14.9998 Constraint (T0340)S26.CB (T0340)R89.CB 12.3210 20.5349 26.6954 14.9995 Constraint (T0340)Q49.CB (T0340)L90.CB 9.0760 15.1267 19.6647 14.9991 Constraint (T0340)R27.CB (T0340)R89.CB 11.4646 19.1077 24.8401 14.9985 Constraint (T0340)S23.CB (T0340)R89.CB 11.6994 19.4990 25.3487 14.9985 Constraint (T0340)N20.CB (T0340)R89.CB 12.9383 21.5639 28.0330 14.9983 Constraint (T0340)K25.CB (T0340)T88.CB 11.0598 18.4330 23.9629 14.8735 Constraint (T0340)Q58.CB (T0340)S87.CB 12.5863 20.9771 27.2702 14.8687 Constraint (T0340)A41.CB (T0340)R89.CB 11.8129 19.6882 25.5947 14.8069 Constraint (T0340)V60.CB (T0340)R89.CB 10.8739 18.1232 23.5602 14.8055 Constraint (T0340)E54.CB (T0340)R89.CB 10.4065 17.3441 22.5473 14.8055 Constraint (T0340)R51.CB (T0340)L90.CB 10.3754 17.2923 22.4799 14.7064 Constraint (T0340)D50.CB (T0340)L90.CB 10.0122 16.6870 21.6932 14.7064 Constraint (T0340)A48.CB (T0340)L90.CB 10.4873 17.4788 22.7225 14.7064 Constraint (T0340)R47.CB (T0340)L90.CB 9.7249 16.2081 21.0706 14.7064 Constraint (T0340)R43.CB (T0340)A70.CB 13.1909 21.9848 28.5802 14.4217 Constraint (T0340)S39.CB (T0340)S87.CB 12.9840 21.6400 28.1320 14.1198 Constraint (T0340)A42.CB (T0340)A66.CB 13.3611 22.2685 28.9491 14.0425 Constraint (T0340)M2.CB (T0340)I72.CB 13.4977 22.4962 29.2451 14.0000 Constraint (T0340)M2.CB (T0340)V68.CB 13.1130 21.8550 28.4115 13.9999 Constraint (T0340)R64.CB (T0340)S87.CB 13.4650 22.4417 29.1743 13.9997 Constraint (T0340)P28.CB (T0340)R89.CB 10.6233 17.7055 23.0171 13.9985 Constraint (T0340)L7.CB (T0340)R89.CB 10.8642 18.1071 23.5392 13.9985 Constraint (T0340)Y17.CB (T0340)S87.CB 12.8454 21.4089 27.8316 13.9978 Constraint (T0340)A42.CB (T0340)R89.CB 12.0369 20.0615 26.0799 13.8069 Constraint (T0340)S44.CB (T0340)R89.CB 11.5105 19.1841 24.9394 13.8059 Constraint (T0340)V55.CB (T0340)R89.CB 11.9860 19.9767 25.9698 13.8055 Constraint (T0340)K25.CB (T0340)D36.CB 12.4226 20.7044 26.9157 13.7469 Constraint (T0340)I32.CB (T0340)L90.CB 11.5547 19.2578 25.0351 13.7064 Constraint (T0340)P37.CB (T0340)T88.CB 12.3599 20.5999 26.7799 13.5809 Constraint (T0340)L10.CB (T0340)R27.CB 13.1830 21.9717 28.5632 13.0000 Constraint (T0340)K25.CB (T0340)R89.CB 12.3864 20.6440 26.8372 12.9999 Constraint (T0340)L3.CB (T0340)S71.CB 12.5482 20.9137 27.1878 12.9999 Constraint (T0340)H9.CB (T0340)T88.CB 13.0207 21.7012 28.2115 12.9999 Constraint (T0340)M2.CB (T0340)Y17.CB 12.6375 21.0625 27.3812 12.9999 Constraint (T0340)D36.CB (T0340)S87.CB 12.7042 21.1737 27.5258 12.9979 Constraint (T0340)L46.CB (T0340)L90.CB 11.7418 19.5697 25.4406 12.7064 Constraint (T0340)R43.CB (T0340)T88.CB 12.1151 20.1919 26.2495 12.5809 Constraint (T0340)S39.CB (T0340)R64.CB 13.5470 22.5783 29.3518 12.2997 Constraint (T0340)M2.CB (T0340)S39.CB 13.2109 22.0182 28.6236 12.0000 Constraint (T0340)M2.CB (T0340)R11.CB 13.3727 22.2878 28.9741 12.0000 Constraint (T0340)S1.CB (T0340)V84.CB 7.4406 12.4009 16.1212 11.9999 Constraint (T0340)S1.CB (T0340)V83.CB 8.4068 14.0113 18.2146 11.9999 Constraint (T0340)S1.CB (T0340)L82.CB 10.1601 16.9335 22.0135 11.9999 Constraint (T0340)S1.CB (T0340)L81.CB 11.5726 19.2876 25.0739 11.9999 Constraint (T0340)S1.CB (T0340)I53.CB 10.2325 17.0542 22.1704 11.9999 Constraint (T0340)S1.CB (T0340)L52.CB 11.4259 19.0432 24.7562 11.9999 Constraint (T0340)S1.CB (T0340)R51.CB 9.3047 15.5078 20.1601 11.9999 Constraint (T0340)S1.CB (T0340)D50.CB 8.2724 13.7874 17.9236 11.9999 Constraint (T0340)S1.CB (T0340)Q49.CB 8.3172 13.8620 18.0205 11.9999 Constraint (T0340)S1.CB (T0340)A48.CB 9.9731 16.6219 21.6084 11.9999 Constraint (T0340)S1.CB (T0340)R47.CB 7.8692 13.1154 17.0500 11.9999 Constraint (T0340)S1.CB (T0340)L46.CB 9.9701 16.6169 21.6020 11.9999 Constraint (T0340)S1.CB (T0340)I32.CB 10.7372 17.8953 23.2639 11.9999 Constraint (T0340)S1.CB (T0340)Y31.CB 10.9725 18.2875 23.7738 11.9999 Constraint (T0340)L7.CB (T0340)K25.CB 13.4287 22.3812 29.0956 11.9999 Constraint (T0340)L10.CB (T0340)T88.CB 13.1199 21.8665 28.4264 11.9999 Constraint (T0340)C8.CB (T0340)S26.CB 12.1814 20.3023 26.3930 11.9998 Constraint (T0340)R4.CB (T0340)S26.CB 10.5140 17.5233 22.7803 11.9998 Constraint (T0340)A42.CB (T0340)Q58.CB 13.0433 21.7388 28.2605 11.9984 Constraint (T0340)Q15.CB (T0340)K25.CB 13.2173 22.0288 28.6374 11.9984 Constraint (T0340)R11.CB (T0340)S23.CB 12.5269 20.8782 27.1417 11.9983 Constraint (T0340)P40.CB (T0340)S87.CB 12.8248 21.3747 27.7871 11.8669 Constraint (T0340)V55.CB (T0340)T88.CB 11.7437 19.5729 25.4447 11.5805 Constraint (T0340)P37.CB (T0340)A74.CB 12.6332 21.0554 27.3720 11.4202 Constraint (T0340)A42.CB (T0340)E67.CB 12.9535 21.5891 28.0658 11.0425 Constraint (T0340)M2.CB (T0340)D36.CB 13.5816 22.6360 29.4268 11.0000 Constraint (T0340)M2.CB (T0340)D24.CB 11.0977 18.4962 24.0451 10.9999 Constraint (T0340)A70.CB (T0340)P86.CB 13.3709 22.2849 28.9703 10.9999 Constraint (T0340)H9.CB (T0340)P28.CB 12.2877 20.4794 26.6233 10.9995 Constraint (T0340)R6.CB (T0340)L90.CB 10.0349 16.7248 21.7422 10.9991 Constraint (T0340)P5.CB (T0340)L90.CB 10.3875 17.3125 22.5063 10.9991 Constraint (T0340)L3.CB (T0340)P40.CB 13.0480 21.7467 28.2707 10.9985 Constraint (T0340)P14.CB (T0340)S23.CB 13.1604 21.9340 28.5142 10.9985 Constraint (T0340)P37.CB (T0340)S87.CB 12.2492 20.4153 26.5399 10.9981 Constraint (T0340)R27.CB (T0340)D36.CB 13.4900 22.4833 29.2283 10.8736 Constraint (T0340)R43.CB (T0340)R89.CB 12.9366 21.5609 28.0292 10.8059 Constraint (T0340)V68.CB (T0340)R89.CB 11.9303 19.8839 25.8490 10.8057 Constraint (T0340)H65.CB (T0340)R89.CB 12.5889 20.9815 27.2759 10.0984 Constraint (T0340)S1.CB (T0340)S44.CB 10.6800 17.7999 23.1399 10.0000 Constraint (T0340)M2.CB (T0340)P37.CB 13.4852 22.4753 29.2179 10.0000 Constraint (T0340)S1.CB (T0340)E61.CB 12.0092 20.0153 26.0199 9.9999 Constraint (T0340)S1.CB (T0340)E54.CB 11.6888 19.4813 25.3257 9.9999 Constraint (T0340)S1.CB (T0340)A41.CB 12.0076 20.0127 26.0165 9.9999 Constraint (T0340)S1.CB (T0340)V35.CB 11.5617 19.2694 25.0503 9.9999 Constraint (T0340)R6.CB (T0340)R64.CB 13.5482 22.5804 29.3545 9.9999 Constraint (T0340)L7.CB (T0340)S26.CB 12.1814 20.3023 26.3930 9.9999 Constraint (T0340)P28.CB (T0340)E78.CB 13.3098 22.1831 28.8380 9.9998 Constraint (T0340)R4.CB (T0340)L90.CB 9.6782 16.1303 20.9693 9.9991 Constraint (T0340)P14.CB (T0340)R64.CB 13.3357 22.2262 28.8941 9.9987 Constraint (T0340)L10.CB (T0340)R89.CB 12.9574 21.5957 28.0744 9.9986 Constraint (T0340)N56.CB (T0340)S87.CB 12.2234 20.3723 26.4840 9.8688 Constraint (T0340)R80.CB (T0340)R89.CB 11.2355 18.7259 24.3437 9.8069 Constraint (T0340)P37.CB (T0340)R89.CB 12.9932 21.6554 28.1520 9.8060 Constraint (T0340)V35.CB (T0340)L90.CB 12.2622 20.4370 26.5681 9.7064 Constraint (T0340)P37.CB (T0340)N56.CB 11.7238 19.5397 25.4016 9.4202 Constraint (T0340)R64.CB (T0340)D77.CB 13.1705 21.9508 28.5361 9.1998 Constraint (T0340)P14.CB (T0340)D24.CB 13.6799 22.7999 29.6398 9.0000 Constraint (T0340)S1.CB (T0340)P86.CB 5.7934 9.6557 12.5525 8.9999 Constraint (T0340)L3.CB (T0340)E67.CB 12.6424 21.0707 27.3918 8.9999 Constraint (T0340)L3.CB (T0340)R64.CB 12.6476 21.0793 27.4031 8.9999 Constraint (T0340)M2.CB (T0340)L63.CB 12.8398 21.3997 27.8196 8.9999 Constraint (T0340)P28.CB (T0340)A42.CB 13.1080 21.8466 28.4006 8.9998 Constraint (T0340)P28.CB (T0340)S39.CB 13.2736 22.1227 28.7594 8.9998 Constraint (T0340)Y17.CB (T0340)T88.CB 13.3954 22.3257 29.0235 8.9997 Constraint (T0340)A48.CB (T0340)D77.CB 13.6673 22.7788 29.6125 8.9997 Constraint (T0340)Y17.CB (T0340)R89.CB 13.1914 21.9857 28.5814 8.9983 Constraint (T0340)R43.CB (T0340)H65.CB 12.7690 21.2817 27.6662 8.9209 Constraint (T0340)S71.CB (T0340)S87.CB 13.2065 22.0109 28.6141 8.8690 Constraint (T0340)N59.CB (T0340)R89.CB 10.9358 18.2263 23.6942 8.8071 Constraint (T0340)D24.CB (T0340)R43.CB 13.4768 22.4614 29.1998 8.7472 Constraint (T0340)S34.CB (T0340)L90.CB 12.7725 21.2876 27.6738 8.7064 Constraint (T0340)D36.CB (T0340)T88.CB 12.0558 20.0929 26.1208 8.5809 Constraint (T0340)S39.CB (T0340)T88.CB 11.7930 19.6550 25.5516 8.5809 Constraint (T0340)P37.CB (T0340)A70.CB 12.3923 20.6538 26.8499 8.4202 Constraint (T0340)A42.CB (T0340)L63.CB 13.1548 21.9247 28.5021 8.1216 Constraint (T0340)S39.CB (T0340)N59.CB 13.2011 22.0018 28.6024 8.1205 Constraint (T0340)P37.CB (T0340)V60.CB 12.1328 20.2214 26.2878 8.0425 Constraint (T0340)L7.CB (T0340)A66.CB 13.6894 22.8156 29.6603 8.0000 Constraint (T0340)M2.CB (T0340)Q58.CB 12.7291 21.2151 27.5797 8.0000 Constraint (T0340)S1.CB (T0340)R80.CB 12.3799 20.6332 26.8231 8.0000 Constraint (T0340)S1.CB (T0340)R43.CB 12.3416 20.5693 26.7401 8.0000 Constraint (T0340)S1.CB (T0340)A42.CB 11.8461 19.7435 25.6665 8.0000 Constraint (T0340)S1.CB (T0340)V60.CB 13.1708 21.9513 28.5367 7.9999 Constraint (T0340)S1.CB (T0340)V55.CB 13.2861 22.1436 28.7866 7.9999 Constraint (T0340)S1.CB (T0340)S34.CB 12.6308 21.0514 27.3668 7.9999 Constraint (T0340)S1.CB (T0340)R33.CB 12.1581 20.2636 26.3426 7.9999 Constraint (T0340)S1.CB (T0340)L21.CB 12.6268 21.0447 27.3581 7.9999 Constraint (T0340)S1.CB (T0340)F19.CB 12.1909 20.3181 26.4135 7.9999 Constraint (T0340)S23.CB (T0340)R43.CB 12.8050 21.3416 27.7441 7.9999 Constraint (T0340)K73.CB (T0340)P86.CB 13.5714 22.6190 29.4047 7.9999 Constraint (T0340)H9.CB (T0340)R89.CB 12.7959 21.3265 27.7245 7.9998 Constraint (T0340)L3.CB (T0340)R43.CB 12.0779 20.1298 26.1687 7.9998 Constraint (T0340)L3.CB (T0340)S39.CB 13.3356 22.2260 28.8939 7.9998 Constraint (T0340)Q15.CB (T0340)V84.CB 13.3740 22.2899 28.9769 7.9997 Constraint (T0340)L3.CB (T0340)L90.CB 9.2526 15.4210 20.0473 7.9991 Constraint (T0340)R33.CB (T0340)L90.CB 11.6406 19.4011 25.2214 7.7064 Constraint (T0340)N59.CB (T0340)T88.CB 11.2746 18.7911 24.4284 7.5808 Constraint (T0340)V68.CB (T0340)T88.CB 11.3023 18.8372 24.4883 7.5806 Constraint (T0340)S26.CB (T0340)S44.CB 12.6164 21.0273 27.3354 7.1218 Constraint (T0340)A48.CB (T0340)A74.CB 13.6045 22.6741 29.4764 6.9999 Constraint (T0340)R11.CB (T0340)D24.CB 13.0996 21.8327 28.3824 6.9999 Constraint (T0340)M2.CB (T0340)S87.CB 8.2756 13.7927 17.9305 6.9999 Constraint (T0340)P28.CB (T0340)P40.CB 12.7800 21.3001 27.6901 6.9998 Constraint (T0340)K12.CB (T0340)P86.CB 13.5945 22.6575 29.4547 6.9998 Constraint (T0340)R27.CB (T0340)L90.CB 11.0693 18.4488 23.9834 6.9991 Constraint (T0340)H22.CB (T0340)L90.CB 11.9198 19.8663 25.8262 6.9991 Constraint (T0340)C8.CB (T0340)L90.CB 11.6419 19.4031 25.2241 6.9991 Constraint (T0340)L7.CB (T0340)L90.CB 11.8735 19.7892 25.7260 6.9991 Constraint (T0340)L10.CB (T0340)K25.CB 12.9700 21.6167 28.1017 6.9986 Constraint (T0340)K12.CB (T0340)P28.CB 12.9403 21.5671 28.0372 6.9986 Constraint (T0340)R11.CB (T0340)A66.CB 13.2040 22.0067 28.6087 6.9984 Constraint (T0340)V69.CB (T0340)S87.CB 13.3129 22.1882 28.8447 6.9978 Constraint (T0340)S26.CB (T0340)D36.CB 12.7418 21.2364 27.6073 6.8735 Constraint (T0340)H65.CB (T0340)T88.CB 12.3982 20.6636 26.8627 6.8733 Constraint (T0340)E67.CB (T0340)S87.CB 12.9077 21.5128 27.9666 6.8690 Constraint (T0340)Y31.CB (T0340)D77.CB 13.5265 22.5442 29.3075 6.8688 Constraint (T0340)S71.CB (T0340)R89.CB 12.5720 20.9534 27.2394 6.8070 Constraint (T0340)K25.CB (T0340)A42.CB 12.7114 21.1857 27.5414 6.7472 Constraint (T0340)K25.CB (T0340)S39.CB 12.9034 21.5057 27.9574 6.7472 Constraint (T0340)L63.CB (T0340)R89.CB 12.0001 20.0002 26.0003 6.7072 Constraint (T0340)E67.CB (T0340)R89.CB 12.7227 21.2044 27.5658 6.7070 Constraint (T0340)Q15.CB (T0340)S26.CB 13.0081 21.6802 28.1842 6.0000 Constraint (T0340)M2.CB (T0340)E78.CB 13.4350 22.3917 29.1093 6.0000 Constraint (T0340)S1.CB (T0340)L10.CB 12.2092 20.3487 26.4533 6.0000 Constraint (T0340)S1.CB (T0340)Q30.CB 11.7193 19.5321 25.3918 5.9999 Constraint (T0340)S1.CB (T0340)S23.CB 12.4850 20.8083 27.0507 5.9999 Constraint (T0340)S1.CB (T0340)N59.CB 13.1676 21.9459 28.5297 5.9999 Constraint (T0340)S1.CB (T0340)D24.CB 11.3873 18.9788 24.6725 5.9999 Constraint (T0340)R4.CB (T0340)P37.CB 13.5135 22.5225 29.2792 5.9999 Constraint (T0340)R4.CB (T0340)D36.CB 13.5775 22.6292 29.4180 5.9999 Constraint (T0340)L3.CB (T0340)R75.CB 13.2439 22.0732 28.6952 5.9999 Constraint (T0340)M2.CB (T0340)S26.CB 9.9215 16.5359 21.4966 5.9999 Constraint (T0340)M2.CB (T0340)K25.CB 12.0716 20.1194 26.1552 5.9999 Constraint (T0340)Q15.CB (T0340)E61.CB 13.0545 21.7575 28.2848 5.9997 Constraint (T0340)S23.CB (T0340)L90.CB 11.7175 19.5291 25.3878 5.9991 Constraint (T0340)P14.CB (T0340)N59.CB 13.3151 22.1919 28.8494 5.9987 Constraint (T0340)P14.CB (T0340)I53.CB 13.5429 22.5716 29.3430 5.9987 Constraint (T0340)P37.CB (T0340)Q58.CB 12.9124 21.5207 27.9769 5.9984 Constraint (T0340)D36.CB (T0340)N59.CB 13.1133 21.8556 28.4122 5.9984 Constraint (T0340)D36.CB (T0340)E61.CB 12.9973 21.6622 28.1609 5.9206 Constraint (T0340)Q58.CB (T0340)R89.CB 12.0361 20.0602 26.0783 5.8072 Constraint (T0340)A79.CB (T0340)R89.CB 11.4035 19.0059 24.7076 5.8070 Constraint (T0340)N56.CB (T0340)R89.CB 11.5602 19.2671 25.0472 5.8070 Constraint (T0340)V69.CB (T0340)R89.CB 13.3038 22.1730 28.8249 5.8060 Constraint (T0340)S44.CB (T0340)L90.CB 11.4613 19.1021 24.8327 5.7064 Constraint (T0340)I53.CB (T0340)L90.CB 9.7513 16.2521 21.1277 5.7064 Constraint (T0340)L52.CB (T0340)L90.CB 9.6922 16.1536 20.9997 5.7064 Constraint (T0340)Q30.CB (T0340)L90.CB 10.7940 17.9900 23.3871 5.7064 Constraint (T0340)P40.CB (T0340)T88.CB 11.2010 18.6683 24.2688 5.5809 Constraint (T0340)Q58.CB (T0340)T88.CB 12.4846 20.8077 27.0500 5.5808 Constraint (T0340)S71.CB (T0340)T88.CB 12.2329 20.3882 26.5046 5.5806 Constraint (T0340)E67.CB (T0340)T88.CB 11.6600 19.4334 25.2634 5.5806 Constraint (T0340)N56.CB (T0340)T88.CB 11.5047 19.1744 24.9267 5.5806 Constraint (T0340)P37.CB (T0340)A66.CB 11.9352 19.8920 25.8596 5.4216 Constraint (T0340)P37.CB (T0340)E54.CB 12.2526 20.4210 26.5472 5.4216 Constraint (T0340)P37.CB (T0340)I53.CB 12.2101 20.3502 26.4553 5.4216 Constraint (T0340)R43.CB (T0340)E67.CB 12.8970 21.4949 27.9434 5.1218 Constraint (T0340)D24.CB (T0340)L90.CB 10.5017 17.5029 22.7537 5.0000 Constraint (T0340)D24.CB (T0340)D77.CB 13.5569 22.5948 29.3732 5.0000 Constraint (T0340)L10.CB (T0340)S26.CB 12.6132 21.0220 27.3286 4.9999 Constraint (T0340)M2.CB (T0340)R89.CB 11.5694 19.2823 25.0670 4.9999 Constraint (T0340)M2.CB (T0340)T88.CB 10.0703 16.7838 21.8190 4.9999 Constraint (T0340)R11.CB (T0340)P86.CB 12.7832 21.3053 27.6968 4.9996 Constraint (T0340)P28.CB (T0340)L90.CB 10.6298 17.7164 23.0313 4.9991 Constraint (T0340)L21.CB (T0340)L90.CB 12.2207 20.3679 26.4783 4.9991 Constraint (T0340)N20.CB (T0340)L90.CB 13.4620 22.4367 29.1677 4.9991 Constraint (T0340)S26.CB (T0340)A42.CB 12.7938 21.3229 27.7198 4.8735 Constraint (T0340)K25.CB (T0340)P37.CB 13.4061 22.3435 29.0466 4.7473 Constraint (T0340)L81.CB (T0340)L90.CB 10.0864 16.8107 21.8539 4.7064 Constraint (T0340)R80.CB (T0340)L90.CB 12.2041 20.3402 26.4423 4.7064 Constraint (T0340)E61.CB (T0340)L90.CB 10.1007 16.8346 21.8849 4.7064 Constraint (T0340)V60.CB (T0340)L90.CB 10.7068 17.8447 23.1981 4.7064 Constraint (T0340)V55.CB (T0340)L90.CB 11.8077 19.6795 25.5834 4.7064 Constraint (T0340)E54.CB (T0340)L90.CB 10.7001 17.8336 23.1836 4.7064 Constraint (T0340)A66.CB (T0340)T88.CB 13.1262 21.8770 28.4401 4.5806 Constraint (T0340)S1.CB (T0340)S87.CB 7.0543 11.7572 15.2844 4.0000 Constraint (T0340)S26.CB (T0340)L90.CB 11.1945 18.6575 24.2548 4.0000 Constraint (T0340)K25.CB (T0340)L90.CB 11.1485 18.5809 24.1551 4.0000 Constraint (T0340)R64.CB (T0340)R89.CB 12.8253 21.3756 27.7882 4.0000 Constraint (T0340)S1.CB (T0340)A79.CB 13.4526 22.4211 29.1474 4.0000 Constraint (T0340)S1.CB (T0340)P28.CB 11.6263 19.3771 25.1903 3.9999 Constraint (T0340)S1.CB (T0340)H22.CB 11.2176 18.6961 24.3049 3.9999 Constraint (T0340)S1.CB (T0340)N20.CB 12.8621 21.4368 27.8679 3.9999 Constraint (T0340)R47.CB (T0340)A74.CB 13.5143 22.5238 29.2809 3.9999 Constraint (T0340)M2.CB (T0340)R27.CB 9.2390 15.3984 20.0179 3.9999 Constraint (T0340)H9.CB (T0340)K25.CB 13.5946 22.6576 29.4549 3.9999 Constraint (T0340)K25.CB (T0340)E76.CB 13.3492 22.2487 28.9234 3.9999 Constraint (T0340)L3.CB (T0340)P37.CB 13.1575 21.9292 28.5080 3.9998 Constraint (T0340)L3.CB (T0340)D36.CB 12.8902 21.4837 27.9289 3.9998 Constraint (T0340)S23.CB (T0340)D77.CB 11.9995 19.9991 25.9988 3.9997 Constraint (T0340)R11.CB (T0340)E61.CB 13.1652 21.9419 28.5245 3.9997 Constraint (T0340)F19.CB (T0340)L90.CB 12.4961 20.8268 27.0748 3.9991 Constraint (T0340)E78.CB (T0340)S87.CB 12.8507 21.4179 27.8433 3.8691 Constraint (T0340)P40.CB (T0340)R89.CB 10.3555 17.2591 22.4368 3.8060 Constraint (T0340)S39.CB (T0340)R89.CB 12.1986 20.3311 26.4304 3.8060 Constraint (T0340)D36.CB (T0340)R89.CB 12.6198 21.0330 27.3429 3.8060 Constraint (T0340)K25.CB (T0340)P40.CB 13.4348 22.3913 29.1087 3.7472 Constraint (T0340)A42.CB (T0340)L90.CB 12.4647 20.7745 27.0069 3.7073 Constraint (T0340)L63.CB (T0340)T88.CB 12.8332 21.3886 27.8052 3.7072 Constraint (T0340)K25.CB (T0340)S44.CB 13.4166 22.3610 29.0693 3.4145 Constraint (T0340)S44.CB (T0340)R64.CB 13.3842 22.3071 28.9992 3.2999 Constraint (T0340)R27.CB (T0340)S44.CB 12.6857 21.1428 27.4857 3.1219 Constraint (T0340)E76.CB (T0340)P86.CB 13.6210 22.7017 29.5121 3.0000 Constraint (T0340)Q49.CB (T0340)E76.CB 13.2391 22.0652 28.6847 3.0000 Constraint (T0340)A48.CB (T0340)E76.CB 11.8871 19.8118 25.7554 3.0000 Constraint (T0340)H9.CB (T0340)R27.CB 12.9849 21.6414 28.1339 3.0000 Constraint (T0340)P5.CB (T0340)A66.CB 13.3655 22.2759 28.9586 3.0000 Constraint (T0340)R4.CB (T0340)E76.CB 13.7192 22.8654 29.7250 3.0000 Constraint (T0340)M2.CB (T0340)L90.CB 13.0802 21.8003 28.3404 3.0000 Constraint (T0340)M2.CB (T0340)K12.CB 13.6708 22.7847 29.6201 3.0000 Constraint (T0340)S1.CB (T0340)R89.CB 11.0771 18.4618 24.0003 3.0000 Constraint (T0340)S1.CB (T0340)T88.CB 9.4674 15.7790 20.5128 3.0000 Constraint (T0340)M2.CB (T0340)R75.CB 13.5281 22.5469 29.3110 3.0000 Constraint (T0340)Q49.CB (T0340)A74.CB 13.4810 22.4683 29.2087 2.9999 Constraint (T0340)R4.CB (T0340)R64.CB 13.7827 22.9712 29.8626 2.9999 Constraint (T0340)L3.CB (T0340)A70.CB 13.7987 22.9978 29.8971 2.9999 Constraint (T0340)L3.CB (T0340)V69.CB 12.2308 20.3846 26.5000 2.9999 Constraint (T0340)L3.CB (T0340)A66.CB 13.2372 22.0620 28.6805 2.9999 Constraint (T0340)M2.CB (T0340)H65.CB 13.4604 22.4339 29.1641 2.9999 Constraint (T0340)M2.CB (T0340)R64.CB 13.5652 22.6087 29.3913 2.9999 Constraint (T0340)H22.CB (T0340)D77.CB 12.5238 20.8730 27.1348 2.9999 Constraint (T0340)A42.CB (T0340)E61.CB 13.5329 22.5549 29.3213 2.9997 Constraint (T0340)A42.CB (T0340)N59.CB 13.7696 22.9494 29.8342 2.9997 Constraint (T0340)P14.CB (T0340)R51.CB 13.7755 22.9592 29.8469 2.9987 Constraint (T0340)P14.CB (T0340)Q49.CB 12.7972 21.3287 27.7273 2.9987 Constraint (T0340)S26.CB (T0340)S39.CB 12.5922 20.9870 27.2831 2.8735 Constraint (T0340)I72.CB (T0340)R89.CB 11.1399 18.5664 24.1364 2.8073 Constraint (T0340)S71.CB (T0340)L90.CB 11.8460 19.7434 25.6664 2.7073 Constraint (T0340)V68.CB (T0340)L90.CB 10.5006 17.5010 22.7513 2.7073 Constraint (T0340)E67.CB (T0340)L90.CB 12.3061 20.5102 26.6632 2.7073 Constraint (T0340)L63.CB (T0340)L90.CB 10.8367 18.0611 23.4794 2.7073 Constraint (T0340)N59.CB (T0340)L90.CB 9.9762 16.6269 21.6150 2.7073 Constraint (T0340)Q58.CB (T0340)L90.CB 11.8241 19.7069 25.6189 2.7073 Constraint (T0340)R43.CB (T0340)L90.CB 10.5986 17.6643 22.9636 2.7064 Constraint (T0340)P40.CB (T0340)L90.CB 9.5989 15.9981 20.7976 2.7064 Constraint (T0340)S39.CB (T0340)L90.CB 11.4048 19.0079 24.7103 2.7064 Constraint (T0340)A79.CB (T0340)T88.CB 8.5475 14.2458 18.5196 2.5809 Constraint (T0340)E78.CB (T0340)T88.CB 9.9506 16.5843 21.5596 2.5809 Constraint (T0340)P37.CB (T0340)E67.CB 11.6151 19.3586 25.1661 2.4219 Constraint (T0340)R43.CB (T0340)A66.CB 13.3761 22.2936 28.9816 2.1219 Constraint (T0340)R43.CB (T0340)L63.CB 12.1230 20.2050 26.2665 2.1219 Constraint (T0340)S39.CB (T0340)E61.CB 13.4753 22.4588 29.1964 2.1219 Constraint (T0340)P37.CB (T0340)L63.CB 9.3834 15.6389 20.3306 2.1219 Constraint (T0340)R27.CB (T0340)E78.CB 13.7742 22.9569 29.8440 2.0000 Constraint (T0340)R27.CB (T0340)E76.CB 13.6900 22.8167 29.6617 2.0000 Constraint (T0340)Q15.CB (T0340)P28.CB 13.6388 22.7313 29.5507 2.0000 Constraint (T0340)K12.CB (T0340)R27.CB 12.8200 21.3667 27.7766 2.0000 Constraint (T0340)R11.CB (T0340)P28.CB 13.5830 22.6384 29.4299 2.0000 Constraint (T0340)M2.CB (T0340)S71.CB 13.1282 21.8803 28.4444 2.0000 Constraint (T0340)H65.CB (T0340)L90.CB 12.1355 20.2258 26.2936 2.0000 Constraint (T0340)R64.CB (T0340)L90.CB 12.2561 20.4268 26.5549 2.0000 Constraint (T0340)S1.CB (T0340)P40.CB 12.4887 20.8145 27.0588 2.0000 Constraint (T0340)S1.CB (T0340)S39.CB 12.7000 21.1667 27.5167 2.0000 Constraint (T0340)S1.CB (T0340)P37.CB 12.1858 20.3097 26.4026 2.0000 Constraint (T0340)S1.CB (T0340)D36.CB 12.6432 21.0721 27.3937 2.0000 Constraint (T0340)S1.CB (T0340)Y17.CB 12.7414 21.2357 27.6064 2.0000 Constraint (T0340)S26.CB (T0340)E78.CB 13.0605 21.7675 28.2978 2.0000 Constraint (T0340)S26.CB (T0340)E76.CB 13.1095 21.8492 28.4039 2.0000 Constraint (T0340)K12.CB (T0340)S26.CB 12.4818 20.8030 27.0439 2.0000 Constraint (T0340)H9.CB (T0340)S26.CB 12.3897 20.6495 26.8443 2.0000 Constraint (T0340)S26.CB (T0340)P37.CB 13.6823 22.8039 29.6450 2.0000 Constraint (T0340)S1.CB (T0340)V68.CB 12.6553 21.0921 27.4198 1.9999 Constraint (T0340)S1.CB (T0340)H65.CB 12.8193 21.3656 27.7752 1.9999 Constraint (T0340)S1.CB (T0340)R64.CB 13.3934 22.3224 29.0191 1.9999 Constraint (T0340)S1.CB (T0340)L63.CB 12.7505 21.2508 27.6260 1.9999 Constraint (T0340)S1.CB (T0340)R27.CB 7.6479 12.7465 16.5705 1.9999 Constraint (T0340)S1.CB (T0340)S26.CB 7.0023 11.6705 15.1716 1.9999 Constraint (T0340)S1.CB (T0340)K25.CB 10.2191 17.0318 22.1413 1.9999 Constraint (T0340)S26.CB (T0340)P40.CB 12.7377 21.2295 27.5983 1.9999 Constraint (T0340)A66.CB (T0340)S87.CB 13.7472 22.9120 29.7856 1.9998 Constraint (T0340)Y17.CB (T0340)L90.CB 13.5025 22.5041 29.2553 1.9991 Constraint (T0340)L10.CB (T0340)L90.CB 12.3586 20.5977 26.7770 1.9991 Constraint (T0340)H9.CB (T0340)L90.CB 12.7161 21.1935 27.5515 1.9991 Constraint (T0340)P37.CB (T0340)L90.CB 11.1722 18.6204 24.2065 1.7073 Constraint (T0340)D77.CB (T0340)T88.CB 8.7210 14.5350 18.8955 1.5809 Constraint (T0340)I72.CB (T0340)T88.CB 8.3253 13.8755 18.0382 1.5809 Constraint (T0340)A70.CB (T0340)T88.CB 11.7185 19.5308 25.3900 1.5809 Constraint (T0340)V69.CB (T0340)T88.CB 10.5926 17.6544 22.9507 1.5809 Constraint (T0340)P28.CB (T0340)R43.CB 13.3069 22.1781 28.8315 1.0000 Constraint (T0340)R27.CB (T0340)A42.CB 12.9157 21.5261 27.9839 1.0000 Constraint (T0340)R27.CB (T0340)S39.CB 13.6626 22.7710 29.6023 1.0000 Constraint (T0340)Q15.CB (T0340)R27.CB 12.5677 20.9462 27.2300 1.0000 Constraint (T0340)R11.CB (T0340)R64.CB 12.5797 20.9662 27.2561 1.0000 Constraint (T0340)H9.CB (T0340)A66.CB 12.8163 21.3605 27.7687 1.0000 Constraint (T0340)H9.CB (T0340)R64.CB 12.6758 21.1263 27.4642 1.0000 Constraint (T0340)S1.CB (T0340)L90.CB 11.5670 19.2783 25.0617 1.0000 Constraint (T0340)S1.CB (T0340)R11.CB 13.3736 22.2893 28.9761 1.0000 Constraint (T0340)L3.CB (T0340)E78.CB 13.3626 22.2710 28.9522 1.0000 Constraint (T0340)S26.CB (T0340)D77.CB 13.4742 22.4569 29.1940 1.0000 Constraint (T0340)S26.CB (T0340)R43.CB 13.6027 22.6711 29.4725 1.0000 Constraint (T0340)R11.CB (T0340)S26.CB 13.2106 22.0177 28.6230 1.0000 Constraint (T0340)P28.CB (T0340)E76.CB 13.6881 22.8135 29.6575 0.9999 Constraint (T0340)K12.CB (T0340)K25.CB 13.4577 22.4295 29.1584 0.9999 Constraint (T0340)Q15.CB (T0340)P86.CB 13.6055 22.6758 29.4786 0.9999 Constraint (T0340)L3.CB (T0340)K12.CB 13.7390 22.8984 29.7679 0.9999 Constraint (T0340)E78.CB (T0340)R89.CB 4.2327 7.0545 9.1709 0.8073 Constraint (T0340)D77.CB (T0340)R89.CB 5.0895 8.4824 11.0272 0.8073 Constraint (T0340)R75.CB (T0340)R89.CB 7.3393 12.2322 15.9019 0.8073 Constraint (T0340)A79.CB (T0340)L90.CB 4.7570 7.9284 10.3069 0.7073 Constraint (T0340)E78.CB (T0340)L90.CB 4.8890 8.1484 10.5929 0.7073 Constraint (T0340)D77.CB (T0340)L90.CB 2.5457 4.2428 5.5157 0.7073 Constraint (T0340)E76.CB (T0340)L90.CB 3.2040 5.3400 6.9419 0.7073 Constraint (T0340)E76.CB (T0340)R89.CB 3.7669 6.2782 8.1616 0.7073 Constraint (T0340)E76.CB (T0340)T88.CB 5.9855 9.9758 12.9686 0.7073 Constraint (T0340)R75.CB (T0340)L90.CB 3.8897 6.4829 8.4277 0.7073 Constraint (T0340)R75.CB (T0340)T88.CB 5.5458 9.2430 12.0159 0.7073 Constraint (T0340)A74.CB (T0340)L90.CB 6.8010 11.3350 14.7354 0.7073 Constraint (T0340)A74.CB (T0340)R89.CB 9.8583 16.4305 21.3596 0.7073 Constraint (T0340)A74.CB (T0340)T88.CB 8.4581 14.0968 18.3259 0.7073 Constraint (T0340)K73.CB (T0340)L90.CB 5.9925 9.9875 12.9838 0.7073 Constraint (T0340)K73.CB (T0340)R89.CB 9.1171 15.1952 19.7537 0.7073 Constraint (T0340)K73.CB (T0340)T88.CB 7.3464 12.2439 15.9171 0.7073 Constraint (T0340)I72.CB (T0340)L90.CB 5.4082 9.0137 11.7178 0.7073 Constraint (T0340)A70.CB (T0340)L90.CB 8.8524 14.7541 19.1803 0.7073 Constraint (T0340)A70.CB (T0340)R89.CB 11.5675 19.2792 25.0630 0.7073 Constraint (T0340)V69.CB (T0340)L90.CB 8.5971 14.3285 18.6270 0.7073 Constraint (T0340)A66.CB (T0340)L90.CB 11.1424 18.5707 24.1420 0.7073 Constraint (T0340)A66.CB (T0340)R89.CB 13.5114 22.5190 29.2747 0.7073 Constraint (T0340)N56.CB (T0340)L90.CB 8.1527 13.5878 17.6642 0.7073 Constraint (T0340)A41.CB (T0340)L90.CB 7.3451 12.2418 15.9144 0.7073 Constraint (T0340)D36.CB (T0340)L90.CB 11.1016 18.5027 24.0535 0.7073 Constraint (T0340)A42.CB (T0340)R64.CB 13.3676 22.2793 28.9630 0.3000 Constraint (T0340)P37.CB (T0340)R64.CB 11.5167 19.1946 24.9529 0.3000 Constraint (T0340)P37.CB (T0340)E61.CB 13.1690 21.9484 28.5329 0.3000 Constraint (T0340)R89.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)T88.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S87.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P86.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V84.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V83.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L82.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L81.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R80.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A79.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E78.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D77.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E76.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)V83.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R75.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L82.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A74.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)L81.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K73.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R80.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I72.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A79.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S71.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A70.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V69.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V68.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E67.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A66.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H65.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R64.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L63.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E61.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)V68.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V60.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N59.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)H65.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q58.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N56.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)L63.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V55.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)E54.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I53.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V60.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L52.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R51.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D50.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q49.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A48.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)V55.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R47.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)E54.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)I53.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L46.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L52.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S44.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R64.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R51.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R43.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)D50.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A42.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)Q49.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)A41.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A48.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P40.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R47.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)L46.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S39.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)N59.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P37.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S44.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D36.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)V35.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A42.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S34.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)A41.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R33.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)I32.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S39.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y31.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q30.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)D36.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P28.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P40.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)V35.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R27.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)S34.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S26.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R43.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R33.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K25.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)I32.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)D24.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Y31.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S23.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)Q30.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H22.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L21.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)N20.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)F19.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)D24.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Y17.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)S23.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)Q15.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P86.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)V84.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)E61.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)P28.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)S26.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)H22.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)L21.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P14.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)N20.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)K12.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)L90.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R89.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)T88.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)S87.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)R27.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K25.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)F19.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R11.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L10.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Y17.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)H9.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)C8.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L7.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R6.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P37.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)P5.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)R4.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R11.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)L3.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L10.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)M2.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E78.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)D77.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E76.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R75.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A74.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K73.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)I72.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)S71.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A70.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)V69.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)E67.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)A66.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q58.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)N56.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)Q15.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P14.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)K12.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)H9.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)C8.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L7.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R6.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)P5.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)R4.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)L3.CB 0.6000 1.0000 1.3000 0.0000 Constraint (T0340)S1.CB (T0340)M2.CB 0.6000 1.0000 1.3000 0.0000 Done printing distance constraints # command: