# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 21.0000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint 427 551 5.1573 6.4467 9.6700 107.0345 Constraint 427 545 4.3444 5.4306 8.1458 107.0345 Constraint 427 540 8.2813 10.3517 15.5275 107.0345 Constraint 427 533 8.3726 10.4657 15.6986 107.0345 Constraint 427 526 5.8083 7.2604 10.8906 107.0345 Constraint 427 517 8.1249 10.1561 15.2342 107.0345 Constraint 427 512 10.9570 13.6963 20.5444 107.0345 Constraint 418 551 9.3489 11.6861 17.5291 107.0345 Constraint 418 545 7.9544 9.9430 14.9145 107.0345 Constraint 418 540 11.8612 14.8265 22.2398 107.0345 Constraint 418 533 11.9204 14.9005 22.3508 107.0345 Constraint 418 526 8.2992 10.3740 15.5609 107.0345 Constraint 418 517 10.2372 12.7965 19.1948 107.0345 Constraint 418 512 13.6280 17.0350 25.5525 107.0345 Constraint 410 551 10.8925 13.6156 20.4233 107.0345 Constraint 410 545 10.1339 12.6674 19.0011 107.0345 Constraint 410 540 13.5006 16.8757 25.3136 107.0345 Constraint 410 533 12.5787 15.7234 23.5851 107.0345 Constraint 410 526 8.6572 10.8215 16.2323 107.0345 Constraint 410 517 11.0859 13.8574 20.7860 107.0345 Constraint 410 512 13.9305 17.4131 26.1196 107.0345 Constraint 402 551 7.2400 9.0500 13.5750 107.0345 Constraint 402 545 8.0518 10.0647 15.0971 107.0345 Constraint 402 540 10.8657 13.5822 20.3732 107.0345 Constraint 402 533 8.8831 11.1038 16.6558 107.0345 Constraint 402 526 5.7178 7.1472 10.7208 107.0345 Constraint 402 517 9.4447 11.8059 17.7088 107.0345 Constraint 402 512 11.2404 14.0504 21.0757 107.0345 Constraint 374 551 14.3755 17.9694 26.9541 107.0345 Constraint 374 533 14.9159 18.6448 27.9672 107.0345 Constraint 374 526 13.0789 16.3486 24.5229 107.0345 Constraint 369 551 13.3498 16.6873 25.0309 107.0345 Constraint 369 533 13.9986 17.4982 26.2473 107.0345 Constraint 369 526 13.1443 16.4304 24.6456 107.0345 Constraint 358 551 13.7586 17.1983 25.7974 107.0345 Constraint 358 526 14.0926 17.6158 26.4236 107.0345 Constraint 295 551 15.0873 18.8591 28.2886 107.0345 Constraint 295 402 15.6151 19.5189 29.2784 107.0345 Constraint 295 374 13.2889 16.6112 24.9167 107.0345 Constraint 295 369 9.7210 12.1512 18.2268 107.0345 Constraint 295 358 10.3781 12.9727 19.4590 107.0345 Constraint 287 551 11.2266 14.0333 21.0499 107.0345 Constraint 287 533 12.5601 15.7002 23.5502 107.0345 Constraint 287 526 13.9550 17.4437 26.1656 107.0345 Constraint 287 402 12.7118 15.8897 23.8346 107.0345 Constraint 287 374 12.3289 15.4111 23.1167 107.0345 Constraint 287 369 8.8866 11.1082 16.6623 107.0345 Constraint 287 358 10.1242 12.6552 18.9829 107.0345 Constraint 280 551 11.2819 14.1024 21.1535 107.0345 Constraint 280 533 12.9291 16.1614 24.2421 107.0345 Constraint 280 526 12.9314 16.1643 24.2465 107.0345 Constraint 280 427 12.9721 16.2151 24.3227 107.0345 Constraint 280 418 14.8271 18.5339 27.8009 107.0345 Constraint 280 410 13.9825 17.4782 26.2173 107.0345 Constraint 280 402 10.0312 12.5389 18.8084 107.0345 Constraint 280 374 8.1748 10.2185 15.3277 107.0345 Constraint 280 369 4.9922 6.2402 9.3603 107.0345 Constraint 280 358 5.5931 6.9913 10.4870 107.0345 Constraint 255 551 9.1441 11.4302 17.1453 107.0345 Constraint 255 545 11.7915 14.7393 22.1090 107.0345 Constraint 255 540 13.5571 16.9464 25.4196 107.0345 Constraint 255 533 10.1918 12.7398 19.1097 107.0345 Constraint 255 526 8.8877 11.1096 16.6644 107.0345 Constraint 255 517 13.0113 16.2641 24.3961 107.0345 Constraint 255 512 13.2074 16.5092 24.7638 107.0345 Constraint 255 427 9.7465 12.1831 18.2746 107.0345 Constraint 255 418 10.9157 13.6447 20.4670 107.0345 Constraint 255 410 9.3707 11.7134 17.5701 107.0345 Constraint 255 402 5.3952 6.7440 10.1159 107.0345 Constraint 255 374 5.4505 6.8131 10.2196 107.0345 Constraint 255 369 4.5704 5.7130 8.5694 107.0345 Constraint 255 358 5.6349 7.0436 10.5654 107.0345 Constraint 243 551 10.9062 13.6328 20.4492 107.0345 Constraint 243 545 12.3848 15.4811 23.2216 107.0345 Constraint 243 540 13.7476 17.1845 25.7767 107.0345 Constraint 243 533 10.4635 13.0794 19.6191 107.0345 Constraint 243 526 8.4302 10.5378 15.8066 107.0345 Constraint 243 517 11.9082 14.8853 22.3279 107.0345 Constraint 243 512 11.9897 14.9872 22.4808 107.0345 Constraint 243 427 10.9350 13.6688 20.5031 107.0345 Constraint 243 418 11.2313 14.0391 21.0586 107.0345 Constraint 243 410 8.6712 10.8389 16.2584 107.0345 Constraint 243 402 5.8440 7.3050 10.9575 107.0345 Constraint 243 374 5.3650 6.7063 10.0594 107.0345 Constraint 243 369 6.6409 8.3012 12.4517 107.0345 Constraint 243 358 8.5329 10.6662 15.9993 107.0345 Constraint 545 615 9.5199 11.8999 17.8499 106.1609 Constraint 540 615 13.4106 16.7633 25.1450 106.1609 Constraint 540 610 10.6863 13.3578 20.0367 106.1609 Constraint 533 615 13.5244 16.9054 25.3582 106.1609 Constraint 533 610 10.4329 13.0411 19.5617 106.1609 Constraint 526 615 11.4311 14.2889 21.4333 106.1609 Constraint 526 610 9.6501 12.0626 18.0939 106.1609 Constraint 517 610 12.3282 15.4102 23.1154 106.1609 Constraint 427 615 5.9554 7.4442 11.1663 106.1609 Constraint 427 610 5.3669 6.7087 10.0630 106.1609 Constraint 418 615 6.4589 8.0737 12.1105 106.1609 Constraint 418 610 8.5869 10.7337 16.1005 106.1609 Constraint 410 615 9.3018 11.6272 17.4408 106.1609 Constraint 410 610 11.0454 13.8067 20.7101 106.1609 Constraint 402 615 8.9693 11.2116 16.8173 106.1609 Constraint 402 610 8.6469 10.8086 16.2129 106.1609 Constraint 358 615 13.5810 16.9762 25.4643 106.1609 Constraint 280 615 13.7572 17.1965 25.7947 106.1609 Constraint 280 610 11.6143 14.5179 21.7768 106.1609 Constraint 255 615 12.0781 15.0976 22.6464 106.1609 Constraint 255 610 10.6618 13.3272 19.9909 106.1609 Constraint 391 551 11.6452 14.5565 21.8348 106.0345 Constraint 391 545 12.2496 15.3120 22.9680 106.0345 Constraint 391 533 12.3781 15.4726 23.2089 106.0345 Constraint 391 526 9.1213 11.4016 17.1025 106.0345 Constraint 383 551 11.3229 14.1536 21.2304 106.0345 Constraint 383 533 13.0046 16.2557 24.3836 106.0345 Constraint 383 526 10.6690 13.3363 20.0044 106.0345 Constraint 295 383 13.2007 16.5009 24.7513 106.0345 Constraint 287 391 14.8864 18.6080 27.9120 106.0345 Constraint 287 383 11.6001 14.5001 21.7502 106.0345 Constraint 280 391 11.2578 14.0722 21.1083 106.0345 Constraint 280 383 7.4586 9.3233 13.9849 106.0345 Constraint 274 551 11.6329 14.5411 21.8117 106.0345 Constraint 274 533 11.5881 14.4852 21.7277 106.0345 Constraint 274 526 12.2607 15.3259 22.9888 106.0345 Constraint 274 512 14.7204 18.4006 27.6008 106.0345 Constraint 274 427 14.2013 17.7516 26.6274 106.0345 Constraint 274 410 15.0729 18.8411 28.2617 106.0345 Constraint 274 402 10.7787 13.4734 20.2102 106.0345 Constraint 274 391 11.5707 14.4633 21.6950 106.0345 Constraint 274 383 9.0684 11.3355 17.0033 106.0345 Constraint 274 374 8.2278 10.2848 15.4272 106.0345 Constraint 274 369 4.9792 6.2240 9.3360 106.0345 Constraint 274 358 8.2426 10.3033 15.4549 106.0345 Constraint 263 551 10.9036 13.6295 20.4442 106.0345 Constraint 263 545 13.6523 17.0654 25.5981 106.0345 Constraint 263 540 14.0830 17.6038 26.4056 106.0345 Constraint 263 533 10.0452 12.5565 18.8347 106.0345 Constraint 263 526 10.0064 12.5080 18.7620 106.0345 Constraint 263 517 13.5946 16.9933 25.4899 106.0345 Constraint 263 512 12.3753 15.4691 23.2037 106.0345 Constraint 263 427 12.9033 16.1292 24.1937 106.0345 Constraint 263 418 14.5714 18.2143 27.3215 106.0345 Constraint 263 410 12.8456 16.0570 24.0856 106.0345 Constraint 263 402 8.8045 11.0056 16.5084 106.0345 Constraint 263 391 9.0019 11.2524 16.8786 106.0345 Constraint 263 383 7.9167 9.8959 14.8439 106.0345 Constraint 263 374 6.8068 8.5085 12.7627 106.0345 Constraint 263 369 5.1919 6.4898 9.7347 106.0345 Constraint 263 358 8.7381 10.9226 16.3839 106.0345 Constraint 255 391 6.2447 7.8059 11.7089 106.0345 Constraint 255 383 3.8239 4.7799 7.1698 106.0345 Constraint 243 391 4.4009 5.5011 8.2516 106.0345 Constraint 243 383 5.5785 6.9732 10.4598 106.0345 Constraint 512 610 14.1880 17.7350 26.6025 105.1610 Constraint 295 610 15.0209 18.7761 28.1642 105.1610 Constraint 517 615 13.8513 17.3141 25.9711 105.0610 Constraint 369 615 15.7770 19.7213 29.5820 105.0610 Constraint 358 610 13.2115 16.5143 24.7715 105.0610 Constraint 243 615 14.4448 18.0560 27.0840 105.0610 Constraint 391 615 12.4148 15.5185 23.2777 105.0609 Constraint 434 551 7.4311 9.2888 13.9332 105.0345 Constraint 434 545 6.1666 7.7083 11.5624 105.0345 Constraint 434 540 9.9959 12.4949 18.7423 105.0345 Constraint 434 533 11.2115 14.0144 21.0216 105.0345 Constraint 434 526 9.2940 11.6175 17.4262 105.0345 Constraint 434 517 10.6443 13.3054 19.9581 105.0345 Constraint 434 512 13.7508 17.1885 25.7827 105.0345 Constraint 319 551 9.0596 11.3245 16.9867 105.0345 Constraint 319 434 12.2514 15.3143 22.9714 105.0345 Constraint 319 427 10.4573 13.0716 19.6075 105.0345 Constraint 319 402 9.0658 11.3323 16.9984 105.0345 Constraint 280 434 15.4675 19.3344 29.0016 105.0345 Constraint 255 434 13.0631 16.3289 24.4934 105.0345 Constraint 255 319 6.4921 8.1151 12.1727 105.0345 Constraint 243 434 14.7139 18.3924 27.5886 105.0345 Constraint 427 502 10.3319 12.9148 19.3722 104.9127 Constraint 418 502 12.3546 15.4433 23.1650 104.9127 Constraint 410 502 11.6736 14.5921 21.8881 104.9127 Constraint 402 502 8.6605 10.8256 16.2384 104.9127 Constraint 374 502 13.2159 16.5199 24.7798 104.9127 Constraint 369 502 13.2420 16.5525 24.8288 104.9127 Constraint 287 427 14.3050 17.8813 26.8219 104.9127 Constraint 280 502 14.0005 17.5007 26.2510 104.9127 Constraint 255 502 9.9730 12.4662 18.6994 104.9127 Constraint 243 502 8.1071 10.1339 15.2008 104.9127 Constraint 383 615 11.3538 14.1922 21.2884 104.1610 Constraint 434 615 4.4399 5.5499 8.3248 104.1609 Constraint 434 610 5.0027 6.2534 9.3801 104.1609 Constraint 319 615 10.3670 12.9587 19.4380 104.1609 Constraint 319 610 8.0082 10.0103 15.0155 104.1609 Constraint 243 610 13.4964 16.8705 25.3058 104.0611 Constraint 391 610 12.8560 16.0700 24.1050 104.0610 Constraint 383 610 11.3755 14.2194 21.3290 104.0610 Constraint 274 610 13.8861 17.3576 26.0364 104.0610 Constraint 280 545 14.8612 18.5764 27.8647 104.0348 Constraint 446 551 8.3231 10.4038 15.6057 104.0348 Constraint 446 545 5.1155 6.3943 9.5915 104.0348 Constraint 446 540 8.7013 10.8766 16.3150 104.0348 Constraint 446 533 10.3759 12.9699 19.4549 104.0348 Constraint 446 526 7.4871 9.3589 14.0384 104.0348 Constraint 446 517 7.6196 9.5245 14.2868 104.0348 Constraint 350 551 10.1666 12.7083 19.0624 104.0348 Constraint 350 545 13.1037 16.3797 24.5695 104.0348 Constraint 350 533 12.9462 16.1828 24.2742 104.0348 Constraint 350 526 11.7125 14.6406 21.9609 104.0348 Constraint 350 446 14.2513 17.8141 26.7212 104.0348 Constraint 350 427 10.0418 12.5523 18.8284 104.0348 Constraint 312 551 9.6002 12.0003 18.0004 104.0348 Constraint 312 545 13.2258 16.5323 24.7984 104.0348 Constraint 312 540 15.0644 18.8305 28.2458 104.0348 Constraint 312 533 13.1552 16.4440 24.6660 104.0348 Constraint 312 526 13.6891 17.1114 25.6671 104.0348 Constraint 312 427 11.3360 14.1700 21.2551 104.0348 Constraint 312 418 14.1650 17.7063 26.5594 104.0348 Constraint 312 410 15.2794 19.0992 28.6488 104.0348 Constraint 312 402 11.7735 14.7169 22.0753 104.0348 Constraint 312 374 14.6090 18.2612 27.3918 104.0348 Constraint 295 350 9.8184 12.2730 18.4095 104.0348 Constraint 287 350 8.4112 10.5140 15.7710 104.0348 Constraint 280 350 4.7849 5.9812 8.9718 104.0348 Constraint 255 446 13.5757 16.9696 25.4544 104.0348 Constraint 255 350 4.9044 6.1304 9.1957 104.0348 Constraint 243 446 13.7270 17.1587 25.7381 104.0348 Constraint 243 350 9.0028 11.2536 16.8803 104.0348 Constraint 243 312 14.4851 18.1063 27.1595 104.0348 Constraint 463 551 7.5290 9.4112 14.1168 104.0345 Constraint 463 545 5.8445 7.3056 10.9583 104.0345 Constraint 463 540 8.6850 10.8562 16.2843 104.0345 Constraint 463 533 8.2698 10.3372 15.5058 104.0345 Constraint 391 463 7.3645 9.2056 13.8085 104.0345 Constraint 383 463 9.8052 12.2565 18.3847 104.0345 Constraint 374 463 12.7930 15.9912 23.9869 104.0345 Constraint 369 463 13.8074 17.2593 25.8889 104.0345 Constraint 358 463 13.8250 17.2812 25.9219 104.0345 Constraint 319 383 8.0638 10.0798 15.1196 104.0345 Constraint 280 463 14.1602 17.7003 26.5504 104.0345 Constraint 274 463 14.2897 17.8621 26.7932 104.0345 Constraint 263 463 11.8480 14.8100 22.2150 104.0345 Constraint 255 463 9.5278 11.9097 17.8645 104.0345 Constraint 243 463 8.6519 10.8148 16.2222 104.0345 Constraint 434 559 9.8081 12.2601 18.3901 104.0345 Constraint 427 559 8.5941 10.7426 16.1139 104.0345 Constraint 418 559 12.9254 16.1567 24.2351 104.0345 Constraint 410 559 14.7676 18.4595 27.6892 104.0345 Constraint 402 559 11.2650 14.0813 21.1220 104.0345 Constraint 319 559 11.9183 14.8978 22.3468 104.0345 Constraint 287 559 12.6627 15.8283 23.7425 104.0345 Constraint 280 559 14.0135 17.5169 26.2753 104.0345 Constraint 255 559 12.6614 15.8267 23.7401 104.0345 Constraint 243 559 14.2617 17.8271 26.7407 104.0345 Constraint 358 533 15.5570 19.4463 29.1694 104.0345 Constraint 287 610 12.0280 15.0350 22.5525 103.9390 Constraint 391 502 10.4362 13.0452 19.5679 103.9127 Constraint 383 502 12.3714 15.4642 23.1963 103.9127 Constraint 274 502 11.8152 14.7690 22.1535 103.9127 Constraint 263 502 8.8734 11.0917 16.6375 103.9127 Constraint 427 573 6.0282 7.5353 11.3029 103.4137 Constraint 446 615 8.2936 10.3670 15.5506 103.1612 Constraint 446 610 8.9446 11.1808 16.7712 103.1612 Constraint 350 615 9.7757 12.2197 18.3295 103.1612 Constraint 350 610 8.9079 11.1349 16.7024 103.1612 Constraint 312 615 10.1309 12.6636 18.9955 103.1612 Constraint 312 610 7.1449 8.9311 13.3966 103.1612 Constraint 463 615 9.8965 12.3707 18.5560 103.1609 Constraint 463 610 9.8524 12.3154 18.4732 103.1609 Constraint 427 584 10.0737 12.5921 18.8882 103.1609 Constraint 533 601 14.4772 18.0965 27.1448 103.1609 Constraint 427 601 9.1248 11.4060 17.1090 103.1609 Constraint 374 615 15.7727 19.7159 29.5739 103.0612 Constraint 263 610 13.9630 17.4538 26.1807 103.0611 Constraint 391 540 14.6100 18.2625 27.3938 103.0349 Constraint 391 517 12.2306 15.2882 22.9323 103.0349 Constraint 391 512 13.7481 17.1852 25.7777 103.0349 Constraint 383 545 13.0777 16.3471 24.5207 103.0349 Constraint 383 517 14.4973 18.1216 27.1824 103.0349 Constraint 312 391 15.0247 18.7809 28.1714 103.0348 Constraint 312 383 11.7008 14.6260 21.9390 103.0348 Constraint 306 551 10.7739 13.4673 20.2010 103.0348 Constraint 306 533 13.2456 16.5570 24.8355 103.0348 Constraint 306 427 13.3851 16.7314 25.0971 103.0348 Constraint 306 402 12.5860 15.7325 23.5988 103.0348 Constraint 306 383 11.6649 14.5812 21.8717 103.0348 Constraint 306 374 13.4549 16.8186 25.2279 103.0348 Constraint 306 369 10.3747 12.9684 19.4526 103.0348 Constraint 274 350 8.3567 10.4458 15.6687 103.0348 Constraint 263 350 9.0576 11.3220 16.9830 103.0348 Constraint 463 559 10.7589 13.4487 20.1730 103.0345 Constraint 324 551 12.8991 16.1238 24.1857 103.0345 Constraint 324 427 14.4466 18.0583 27.0874 103.0345 Constraint 324 402 12.6475 15.8094 23.7141 103.0345 Constraint 274 559 13.7585 17.1981 25.7971 103.0345 Constraint 263 559 13.4059 16.7574 25.1361 103.0345 Constraint 255 324 9.0076 11.2595 16.8892 103.0345 Constraint 470 551 11.9553 14.9441 22.4162 103.0345 Constraint 470 545 9.9399 12.4248 18.6372 103.0345 Constraint 470 540 12.2839 15.3549 23.0324 103.0345 Constraint 402 470 7.5546 9.4432 14.1648 103.0345 Constraint 391 470 7.6333 9.5416 14.3124 103.0345 Constraint 383 470 11.4717 14.3396 21.5094 103.0345 Constraint 255 470 12.1413 15.1766 22.7649 103.0345 Constraint 243 470 9.8959 12.3699 18.5548 103.0345 Constraint 434 502 13.8526 17.3158 25.9736 102.9127 Constraint 287 545 15.2489 19.0611 28.5916 102.9127 Constraint 551 649 13.6144 17.0180 25.5270 102.8610 Constraint 545 649 13.9032 17.3790 26.0686 102.8610 Constraint 533 649 15.2312 19.0390 28.5585 102.8610 Constraint 526 649 11.6832 14.6040 21.9060 102.8610 Constraint 434 649 13.2077 16.5096 24.7644 102.8610 Constraint 427 649 10.6245 13.2807 19.9210 102.8610 Constraint 418 649 7.9641 9.9551 14.9327 102.8610 Constraint 410 649 4.6359 5.7949 8.6923 102.8610 Constraint 402 649 6.6336 8.2920 12.4381 102.8610 Constraint 374 649 8.0605 10.0756 15.1135 102.8610 Constraint 369 649 10.7464 13.4330 20.1495 102.8610 Constraint 358 649 9.0881 11.3601 17.0402 102.8610 Constraint 280 649 12.8895 16.1119 24.1678 102.8610 Constraint 255 649 8.6502 10.8128 16.2192 102.8610 Constraint 243 649 7.9352 9.9190 14.8785 102.8610 Constraint 512 573 12.4807 15.6009 23.4013 102.4137 Constraint 280 573 14.1208 17.6510 26.4764 102.4137 Constraint 434 568 7.7345 9.6681 14.5021 102.4136 Constraint 427 568 7.9422 9.9277 14.8915 102.4136 Constraint 418 568 11.9274 14.9093 22.3639 102.4136 Constraint 402 568 12.2232 15.2790 22.9185 102.4136 Constraint 306 615 13.2836 16.6045 24.9068 102.1612 Constraint 306 610 10.0894 12.6118 18.9176 102.1612 Constraint 526 601 13.8530 17.3162 25.9743 102.1610 Constraint 418 601 11.3618 14.2022 21.3033 102.1610 Constraint 402 601 12.6962 15.8702 23.8053 102.1610 Constraint 280 601 14.6323 18.2904 27.4356 102.1610 Constraint 324 615 13.6269 17.0337 25.5505 102.1609 Constraint 324 610 11.5836 14.4795 21.7192 102.1609 Constraint 255 601 14.5784 18.2230 27.3345 102.0610 Constraint 502 610 13.7168 17.1460 25.7190 102.0392 Constraint 319 545 12.4714 15.5892 23.3839 102.0359 Constraint 319 540 14.5041 18.1301 27.1951 102.0359 Constraint 319 533 11.8290 14.7863 22.1794 102.0359 Constraint 319 526 11.5910 14.4887 21.7330 102.0359 Constraint 319 418 12.5589 15.6986 23.5479 102.0359 Constraint 319 410 12.6806 15.8507 23.7761 102.0359 Constraint 243 319 10.6854 13.3567 20.0350 102.0359 Constraint 455 551 11.0447 13.8059 20.7088 102.0348 Constraint 455 545 8.3051 10.3814 15.5720 102.0348 Constraint 455 540 11.5244 14.4055 21.6083 102.0348 Constraint 455 533 12.2858 15.3573 23.0359 102.0348 Constraint 455 526 8.3771 10.4713 15.7070 102.0348 Constraint 350 455 14.6456 18.3070 27.4605 102.0348 Constraint 350 434 12.1823 15.2279 22.8418 102.0348 Constraint 312 434 11.9803 14.9754 22.4632 102.0348 Constraint 255 455 13.3622 16.7028 25.0542 102.0348 Constraint 243 455 12.3601 15.4501 23.1752 102.0348 Constraint 369 610 14.3931 17.9914 26.9872 101.9392 Constraint 350 502 14.0759 17.5949 26.3924 101.9130 Constraint 463 649 9.0077 11.2597 16.8895 101.8610 Constraint 391 649 3.8450 4.8062 7.2094 101.8610 Constraint 383 649 5.5637 6.9547 10.4320 101.8610 Constraint 274 649 14.2028 17.7535 26.6302 101.8610 Constraint 263 649 12.1777 15.2221 22.8332 101.8610 Constraint 255 573 12.8099 16.0124 24.0185 101.7064 Constraint 350 573 12.2105 15.2631 22.8947 101.4139 Constraint 312 573 9.7433 12.1791 18.2687 101.4139 Constraint 434 573 5.2901 6.6126 9.9189 101.4137 Constraint 319 573 10.9184 13.6480 20.4720 101.4137 Constraint 463 568 10.6598 13.3248 19.9872 101.4136 Constraint 455 615 10.3184 12.8980 19.3470 101.1612 Constraint 455 610 11.8884 14.8604 22.2907 101.1612 Constraint 434 584 8.0417 10.0522 15.0783 101.1609 Constraint 319 584 12.7147 15.8934 23.8402 101.1609 Constraint 434 601 6.8370 8.5462 12.8193 101.1609 Constraint 319 601 10.6825 13.3531 20.0296 101.1609 Constraint 410 601 14.2179 17.7724 26.6586 101.0611 Constraint 470 615 12.8983 16.1228 24.1842 101.0610 Constraint 287 615 15.3005 19.1257 28.6885 101.0448 Constraint 319 463 12.6631 15.8288 23.7432 101.0359 Constraint 319 391 11.4158 14.2697 21.4046 101.0359 Constraint 274 545 15.0438 18.8048 28.2072 101.0349 Constraint 383 455 12.6760 15.8450 23.7675 101.0348 Constraint 350 463 11.6655 14.5818 21.8728 101.0348 Constraint 306 434 14.8585 18.5731 27.8596 101.0348 Constraint 340 427 11.6837 14.6047 21.9070 101.0348 Constraint 340 418 12.8886 16.1108 24.1662 101.0348 Constraint 280 340 7.7758 9.7197 14.5796 101.0348 Constraint 274 340 12.0412 15.0515 22.5773 101.0348 Constraint 263 340 13.5158 16.8947 25.3421 101.0348 Constraint 255 340 9.6520 12.0650 18.0975 101.0348 Constraint 243 340 13.7749 17.2187 25.8280 101.0348 Constraint 455 559 13.9753 17.4691 26.2037 101.0348 Constraint 446 559 10.6325 13.2906 19.9359 101.0348 Constraint 350 559 13.7230 17.1538 25.7306 101.0348 Constraint 312 559 11.4146 14.2683 21.4024 101.0348 Constraint 234 551 7.7676 9.7095 14.5642 101.0345 Constraint 234 545 8.1640 10.2050 15.3076 101.0345 Constraint 234 540 9.7259 12.1573 18.2360 101.0345 Constraint 234 533 7.2763 9.0954 13.6431 101.0345 Constraint 234 526 4.1983 5.2479 7.8719 101.0345 Constraint 234 517 7.5498 9.4373 14.1559 101.0345 Constraint 234 512 8.5541 10.6927 16.0390 101.0345 Constraint 234 427 7.3862 9.2328 13.8492 101.0345 Constraint 234 418 8.2142 10.2677 15.4015 101.0345 Constraint 234 410 6.7533 8.4417 12.6625 101.0345 Constraint 234 402 3.7955 4.7444 7.1166 101.0345 Constraint 234 374 9.4909 11.8636 17.7955 101.0345 Constraint 234 369 10.3530 12.9412 19.4118 101.0345 Constraint 234 358 11.4505 14.3131 21.4697 101.0345 Constraint 551 642 10.5886 13.2358 19.8537 100.8612 Constraint 545 642 11.7762 14.7203 22.0804 100.8612 Constraint 533 642 13.1340 16.4175 24.6263 100.8612 Constraint 526 642 10.2199 12.7749 19.1623 100.8612 Constraint 434 642 10.5377 13.1722 19.7582 100.8612 Constraint 427 642 8.1308 10.1635 15.2452 100.8612 Constraint 418 642 6.9738 8.7173 13.0759 100.8612 Constraint 410 642 5.4265 6.7831 10.1747 100.8612 Constraint 402 642 4.7055 5.8818 8.8228 100.8612 Constraint 374 642 7.9340 9.9175 14.8763 100.8612 Constraint 369 642 9.1149 11.3937 17.0905 100.8612 Constraint 358 642 6.9039 8.6299 12.9448 100.8612 Constraint 319 642 8.6497 10.8121 16.2182 100.8612 Constraint 295 642 15.1082 18.8853 28.3279 100.8612 Constraint 287 642 13.2954 16.6193 24.9289 100.8612 Constraint 280 642 9.6365 12.0456 18.0684 100.8612 Constraint 255 642 6.2359 7.7949 11.6923 100.8612 Constraint 243 642 7.8388 9.7985 14.6977 100.8612 Constraint 374 610 15.3307 19.1634 28.7451 100.7392 Constraint 502 649 13.8012 17.2515 25.8772 100.7391 Constraint 306 573 12.2254 15.2818 22.9227 100.4139 Constraint 418 573 9.7966 12.2458 18.3686 100.4137 Constraint 402 573 10.2224 12.7780 19.1671 100.4137 Constraint 410 568 14.5188 18.1484 27.2227 100.4136 Constraint 255 568 14.9064 18.6331 27.9496 100.4136 Constraint 287 573 13.6743 17.0928 25.6392 100.2919 Constraint 340 615 9.0918 11.3648 17.0471 100.1612 Constraint 340 610 8.4520 10.5649 15.8474 100.1612 Constraint 312 584 10.2542 12.8178 19.2266 100.1612 Constraint 446 601 11.5794 14.4742 21.7113 100.1612 Constraint 350 601 11.7930 14.7413 22.1120 100.1612 Constraint 312 601 8.4293 10.5366 15.8048 100.1612 Constraint 324 601 13.3643 16.7054 25.0581 100.1609 Constraint 234 615 12.2155 15.2694 22.9041 100.1609 Constraint 470 610 13.8865 17.3581 26.0372 100.0611 Constraint 324 391 14.2167 17.7708 26.6563 100.0359 Constraint 263 324 10.9833 13.7291 20.5937 100.0359 Constraint 243 324 13.1904 16.4880 24.7320 100.0359 Constraint 306 526 14.1925 17.7406 26.6110 100.0351 Constraint 306 391 15.1603 18.9503 28.4255 100.0348 Constraint 306 559 12.3701 15.4626 23.1940 100.0348 Constraint 340 410 13.3515 16.6893 25.0340 100.0348 Constraint 329 551 13.6839 17.1049 25.6574 100.0348 Constraint 329 427 14.6601 18.3251 27.4877 100.0348 Constraint 329 402 14.1096 17.6370 26.4554 100.0348 Constraint 255 329 11.7384 14.6731 22.0096 100.0348 Constraint 274 418 16.2764 20.3455 30.5183 100.0346 Constraint 234 391 5.4829 6.8536 10.2804 100.0345 Constraint 234 383 7.6844 9.6055 14.4083 100.0345 Constraint 374 470 13.6969 17.1212 25.6817 100.0345 Constraint 263 470 14.0913 17.6141 26.4212 100.0345 Constraint 319 502 13.9188 17.3985 26.0978 99.9140 Constraint 319 649 12.5386 15.6733 23.5100 99.8623 Constraint 455 649 9.9600 12.4500 18.6750 99.8613 Constraint 446 649 12.5543 15.6929 23.5394 99.8613 Constraint 350 649 9.4384 11.7980 17.6970 99.8613 Constraint 463 642 8.4268 10.5335 15.8002 99.8612 Constraint 391 642 5.1629 6.4536 9.6805 99.8612 Constraint 383 642 3.6126 4.5158 6.7736 99.8612 Constraint 274 642 11.8308 14.7885 22.1828 99.8612 Constraint 263 642 10.7007 13.3759 20.0638 99.8612 Constraint 383 559 15.1733 18.9667 28.4500 99.7349 Constraint 383 540 15.6332 19.5415 29.3123 99.7349 Constraint 319 568 13.9277 17.4096 26.1144 99.4149 Constraint 446 568 8.5782 10.7228 16.0842 99.4139 Constraint 312 568 13.1732 16.4664 24.6997 99.4139 Constraint 306 584 13.1968 16.4961 24.7441 99.1612 Constraint 340 601 9.4598 11.8248 17.7372 99.1612 Constraint 329 615 12.3686 15.4608 23.1912 99.1612 Constraint 329 610 10.6981 13.3726 20.0590 99.1612 Constraint 329 601 11.2003 14.0004 21.0005 99.1612 Constraint 306 601 12.1164 15.1456 22.7183 99.1612 Constraint 234 610 11.1660 13.9576 20.9363 99.1610 Constraint 463 601 13.6933 17.1166 25.6749 99.0610 Constraint 340 434 12.3653 15.4566 23.1849 99.0348 Constraint 470 559 14.9817 18.7271 28.0907 99.0345 Constraint 324 559 15.2770 19.0962 28.6444 99.0345 Constraint 234 434 11.2674 14.0843 21.1264 99.0345 Constraint 234 502 5.3901 6.7376 10.1064 98.9127 Constraint 540 642 14.9966 18.7457 28.1186 98.8614 Constraint 517 642 13.8061 17.2576 25.8864 98.8614 Constraint 324 642 11.4487 14.3109 21.4663 98.8612 Constraint 470 649 8.5711 10.7139 16.0708 98.8610 Constraint 502 642 13.0665 16.3331 24.4996 98.7393 Constraint 374 455 15.8782 19.8477 29.7716 98.7348 Constraint 410 573 12.5278 15.6597 23.4896 98.7064 Constraint 324 573 14.4480 18.0601 27.0901 98.4137 Constraint 502 568 12.0312 15.0390 22.5585 98.2918 Constraint 551 626 7.2362 9.0453 13.5680 98.1609 Constraint 545 626 8.4716 10.5895 15.8842 98.1609 Constraint 540 626 12.0426 15.0533 22.5799 98.1609 Constraint 533 626 10.8820 13.6025 20.4038 98.1609 Constraint 526 626 8.5139 10.6424 15.9636 98.1609 Constraint 517 626 11.9365 14.9207 22.3810 98.1609 Constraint 434 626 6.4190 8.0238 12.0356 98.1609 Constraint 427 626 4.6672 5.8340 8.7510 98.1609 Constraint 418 626 5.6141 7.0176 10.5265 98.1609 Constraint 410 626 6.7897 8.4871 12.7306 98.1609 Constraint 402 626 4.8551 6.0689 9.1033 98.1609 Constraint 369 626 11.4373 14.2966 21.4449 98.1609 Constraint 358 626 9.7236 12.1546 18.2318 98.1609 Constraint 319 626 7.4156 9.2695 13.9043 98.1609 Constraint 287 626 12.3379 15.4224 23.1335 98.1609 Constraint 280 626 10.0443 12.5553 18.8330 98.1609 Constraint 255 626 7.5713 9.4641 14.1962 98.1609 Constraint 243 626 10.0209 12.5262 18.7893 98.1609 Constraint 383 601 14.8054 18.5067 27.7601 98.0613 Constraint 374 626 11.4668 14.3335 21.5003 98.0609 Constraint 340 551 11.7782 14.7227 22.0841 98.0362 Constraint 350 540 15.5508 19.4385 29.1577 98.0353 Constraint 312 446 15.4193 19.2742 28.9113 98.0349 Constraint 312 463 14.7664 18.4580 27.6870 98.0348 Constraint 234 446 9.5566 11.9458 17.9187 98.0348 Constraint 234 350 10.1151 12.6439 18.9659 98.0348 Constraint 234 312 14.1276 17.6596 26.4893 98.0348 Constraint 234 463 4.3970 5.4962 8.2443 98.0345 Constraint 234 559 11.0966 13.8707 20.8060 98.0345 Constraint 173 551 10.4376 13.0471 19.5706 97.9918 Constraint 173 545 12.3559 15.4449 23.1674 97.9918 Constraint 173 540 12.5183 15.6479 23.4719 97.9918 Constraint 173 533 8.6542 10.8177 16.2266 97.9918 Constraint 173 526 8.2392 10.2990 15.4484 97.9918 Constraint 173 517 11.3576 14.1971 21.2956 97.9918 Constraint 173 512 10.0383 12.5479 18.8218 97.9918 Constraint 173 502 6.2149 7.7686 11.6529 97.9918 Constraint 173 427 12.1853 15.2316 22.8474 97.9918 Constraint 173 418 13.7160 17.1450 25.7175 97.9918 Constraint 173 410 11.9055 14.8819 22.3228 97.9918 Constraint 173 402 8.2363 10.2954 15.4431 97.9918 Constraint 173 391 8.3929 10.4912 15.7368 97.9918 Constraint 173 383 8.9958 11.2447 16.8671 97.9918 Constraint 173 374 8.2101 10.2626 15.3939 97.9918 Constraint 173 369 7.9656 9.9569 14.9354 97.9918 Constraint 173 358 11.0387 13.7984 20.6976 97.9918 Constraint 173 295 14.6592 18.3239 27.4859 97.9918 Constraint 173 287 11.6673 14.5841 21.8761 97.9918 Constraint 173 280 9.9974 12.4968 18.7452 97.9918 Constraint 173 274 7.0882 8.8602 13.2904 97.9918 Constraint 173 263 3.5223 4.4029 6.6043 97.9918 Constraint 173 255 6.3021 7.8777 11.8165 97.9918 Constraint 173 243 4.1927 5.2408 7.8613 97.9918 Constraint 287 601 14.6263 18.2829 27.4243 97.9448 Constraint 324 649 15.1088 18.8860 28.3291 97.8623 Constraint 455 642 10.3598 12.9498 19.4246 97.8615 Constraint 446 642 11.3039 14.1298 21.1947 97.8615 Constraint 350 642 5.5233 6.9041 10.3562 97.8615 Constraint 312 642 11.4969 14.3711 21.5567 97.8615 Constraint 559 642 14.6575 18.3219 27.4829 97.8614 Constraint 446 573 7.8920 9.8650 14.7975 97.7066 Constraint 329 573 13.8381 17.2976 25.9464 97.4139 Constraint 455 568 12.5442 15.6803 23.5204 97.4139 Constraint 463 573 9.9859 12.4823 18.7235 97.4137 Constraint 502 573 13.0064 16.2581 24.3871 97.2919 Constraint 512 626 14.1026 17.6282 26.4424 97.1610 Constraint 295 626 14.8172 18.5215 27.7823 97.1610 Constraint 526 593 14.4124 18.0155 27.0233 97.1609 Constraint 427 593 10.5486 13.1857 19.7786 97.1609 Constraint 463 626 7.4372 9.2965 13.9447 97.1609 Constraint 391 626 8.4107 10.5134 15.7701 97.1609 Constraint 383 626 7.1535 8.9418 13.4127 97.1609 Constraint 324 626 11.0442 13.8053 20.7080 97.1609 Constraint 274 626 12.4195 15.5243 23.2865 97.1609 Constraint 263 626 11.7775 14.7219 22.0828 97.1609 Constraint 383 512 15.4921 19.3651 29.0477 97.0406 Constraint 274 329 11.9855 14.9819 22.4729 97.0362 Constraint 263 329 14.5021 18.1276 27.1915 97.0362 Constraint 306 545 14.6520 18.3150 27.4725 97.0351 Constraint 350 470 14.3944 17.9930 26.9895 97.0348 Constraint 234 470 6.8536 8.5670 12.8504 97.0345 Constraint 274 540 15.4750 19.3438 29.0157 97.0345 Constraint 173 610 14.4506 18.0633 27.0949 96.9919 Constraint 165 615 12.5908 15.7385 23.6078 96.9918 Constraint 165 610 10.2503 12.8129 19.2193 96.9918 Constraint 165 551 6.2309 7.7886 11.6829 96.9918 Constraint 165 545 8.6728 10.8411 16.2616 96.9918 Constraint 165 540 9.4705 11.8381 17.7572 96.9918 Constraint 165 533 5.7726 7.2157 10.8236 96.9918 Constraint 165 526 5.3035 6.6293 9.9440 96.9918 Constraint 165 517 9.1984 11.4980 17.2470 96.9918 Constraint 165 512 8.7748 10.9685 16.4527 96.9918 Constraint 165 502 5.8692 7.3365 11.0047 96.9918 Constraint 165 427 8.3074 10.3843 15.5764 96.9918 Constraint 165 418 10.7053 13.3816 20.0725 96.9918 Constraint 165 410 9.9497 12.4371 18.6557 96.9918 Constraint 165 402 5.4622 6.8278 10.2417 96.9918 Constraint 165 391 7.9548 9.9436 14.9153 96.9918 Constraint 165 383 7.8518 9.8148 14.7222 96.9918 Constraint 165 374 9.2492 11.5615 17.3422 96.9918 Constraint 165 369 8.4749 10.5937 15.8905 96.9918 Constraint 165 358 10.3161 12.8952 19.3427 96.9918 Constraint 165 295 13.4623 16.8279 25.2419 96.9918 Constraint 165 287 9.8263 12.2828 18.4242 96.9918 Constraint 165 280 8.5366 10.6708 16.0062 96.9918 Constraint 165 274 7.1908 8.9885 13.4828 96.9918 Constraint 165 263 4.9756 6.2195 9.3293 96.9918 Constraint 165 255 4.7855 5.9818 8.9727 96.9918 Constraint 165 243 5.2669 6.5837 9.8755 96.9918 Constraint 319 446 14.7691 18.4613 27.6920 96.9143 Constraint 358 434 15.9567 19.9459 29.9188 96.9127 Constraint 517 649 14.6157 18.2696 27.4044 96.8680 Constraint 306 642 12.6086 15.7607 23.6411 96.8615 Constraint 340 649 12.8854 16.1067 24.1600 96.8613 Constraint 470 642 10.1053 12.6316 18.9474 96.8612 Constraint 234 649 8.5974 10.7467 16.1201 96.8610 Constraint 418 584 13.2963 16.6203 24.9305 96.4138 Constraint 350 584 14.4855 18.1069 27.1604 96.1613 Constraint 329 584 14.0287 17.5359 26.3038 96.1612 Constraint 418 593 13.7209 17.1511 25.7267 96.1610 Constraint 402 593 14.4707 18.0884 27.1326 96.1610 Constraint 455 601 14.7137 18.3921 27.5881 96.0614 Constraint 551 634 10.5789 13.2236 19.8354 96.0611 Constraint 545 634 10.2445 12.8056 19.2084 96.0611 Constraint 540 634 14.1461 17.6826 26.5240 96.0611 Constraint 533 634 13.5514 16.9392 25.4088 96.0611 Constraint 526 634 10.1132 12.6414 18.9622 96.0611 Constraint 517 634 12.7902 15.9878 23.9817 96.0611 Constraint 434 634 7.5278 9.4097 14.1145 96.0611 Constraint 427 634 6.2921 7.8651 11.7977 96.0611 Constraint 418 634 3.2879 4.1099 6.1648 96.0611 Constraint 410 634 3.9887 4.9859 7.4789 96.0611 Constraint 402 634 5.9884 7.4856 11.2283 96.0611 Constraint 369 634 13.5451 16.9314 25.3971 96.0611 Constraint 358 634 11.3947 14.2434 21.3650 96.0611 Constraint 319 634 11.4447 14.3059 21.4588 96.0611 Constraint 280 634 13.4740 16.8424 25.2637 96.0611 Constraint 255 634 10.0220 12.5275 18.7912 96.0611 Constraint 243 634 10.9727 13.7158 20.5738 96.0611 Constraint 502 626 12.4335 15.5419 23.3129 96.0390 Constraint 340 463 14.5467 18.1834 27.2751 96.0362 Constraint 234 319 11.0738 13.8422 20.7633 96.0359 Constraint 391 559 15.4144 19.2680 28.9021 96.0349 Constraint 234 455 8.6231 10.7789 16.1683 96.0348 Constraint 165 573 10.9459 13.6823 20.5235 95.9919 Constraint 173 463 10.1691 12.7114 19.0671 95.9918 Constraint 146 615 11.3173 14.1466 21.2199 95.9918 Constraint 146 610 8.4616 10.5771 15.8656 95.9918 Constraint 146 568 12.8091 16.0114 24.0171 95.9918 Constraint 146 551 7.2253 9.0317 13.5475 95.9918 Constraint 146 545 11.0004 13.7505 20.6258 95.9918 Constraint 146 540 12.4002 15.5002 23.2504 95.9918 Constraint 146 533 9.1670 11.4587 17.1881 95.9918 Constraint 146 526 9.4017 11.7522 17.6283 95.9918 Constraint 146 517 13.4103 16.7629 25.1443 95.9918 Constraint 146 512 13.2459 16.5574 24.8360 95.9918 Constraint 146 502 11.0272 13.7840 20.6760 95.9918 Constraint 146 463 11.0328 13.7910 20.6864 95.9918 Constraint 146 434 12.1318 15.1647 22.7471 95.9918 Constraint 146 427 9.4836 11.8545 17.7817 95.9918 Constraint 146 418 12.1311 15.1639 22.7459 95.9918 Constraint 146 410 11.9147 14.8934 22.3401 95.9918 Constraint 146 402 7.4473 9.3091 13.9636 95.9918 Constraint 146 391 10.1079 12.6348 18.9522 95.9918 Constraint 146 383 7.3689 9.2111 13.8166 95.9918 Constraint 146 374 9.3498 11.6872 17.5309 95.9918 Constraint 146 369 7.0353 8.7941 13.1911 95.9918 Constraint 146 358 7.8239 9.7799 14.6698 95.9918 Constraint 146 319 3.7760 4.7200 7.0800 95.9918 Constraint 146 295 8.8236 11.0295 16.5442 95.9918 Constraint 146 287 5.3888 6.7359 10.1039 95.9918 Constraint 146 280 4.1534 5.1917 7.7876 95.9918 Constraint 146 274 5.4411 6.8014 10.2021 95.9918 Constraint 146 263 6.3737 7.9672 11.9507 95.9918 Constraint 146 255 4.3282 5.4103 8.1154 95.9918 Constraint 146 243 8.2632 10.3290 15.4935 95.9918 Constraint 358 502 15.2473 19.0591 28.5887 95.9184 Constraint 340 573 12.0222 15.0277 22.5416 95.4152 Constraint 470 568 14.5529 18.1911 27.2867 95.4136 Constraint 402 584 14.0714 17.5892 26.3838 95.1612 Constraint 455 626 9.5030 11.8787 17.8181 95.1612 Constraint 446 626 8.5298 10.6622 15.9933 95.1612 Constraint 350 626 6.1604 7.7005 11.5508 95.1612 Constraint 312 626 8.8841 11.1052 16.6577 95.1612 Constraint 434 593 8.5139 10.6424 15.9636 95.1609 Constraint 319 593 11.8129 14.7661 22.1491 95.1609 Constraint 483 551 8.5803 10.7254 16.0881 95.1140 Constraint 418 483 8.1669 10.2086 15.3129 95.1140 Constraint 410 483 8.3586 10.4483 15.6724 95.1140 Constraint 402 483 7.6231 9.5289 14.2934 95.1140 Constraint 391 483 9.8625 12.3281 18.4922 95.1140 Constraint 263 483 12.8907 16.1133 24.1700 95.1140 Constraint 255 483 11.8111 14.7639 22.1458 95.1140 Constraint 243 483 10.1301 12.6626 18.9940 95.1140 Constraint 374 634 12.2640 15.3300 22.9950 95.0612 Constraint 234 601 15.5054 19.3818 29.0727 95.0611 Constraint 463 634 7.1968 8.9960 13.4939 95.0611 Constraint 391 634 7.7134 9.6418 14.4627 95.0611 Constraint 383 634 8.1168 10.1460 15.2190 95.0611 Constraint 324 634 14.6806 18.3508 27.5262 95.0611 Constraint 263 634 14.2362 17.7953 26.6929 95.0611 Constraint 559 634 14.4736 18.0919 27.1379 95.0611 Constraint 446 584 11.4846 14.3558 21.5337 95.0393 Constraint 263 455 16.0739 20.0924 30.1385 95.0348 Constraint 173 446 14.9088 18.6360 27.9541 94.9921 Constraint 173 350 11.0244 13.7805 20.6707 94.9921 Constraint 173 312 14.9580 18.6974 28.0462 94.9921 Constraint 173 306 13.5615 16.9518 25.4278 94.9921 Constraint 146 573 10.4767 13.0958 19.6438 94.9919 Constraint 173 649 11.9492 14.9365 22.4047 94.9919 Constraint 146 649 12.1307 15.1633 22.7450 94.9919 Constraint 130 649 14.1673 17.7091 26.5637 94.9919 Constraint 130 615 9.1678 11.4597 17.1895 94.9919 Constraint 130 610 5.2032 6.5040 9.7559 94.9919 Constraint 130 568 9.9587 12.4484 18.6726 94.9919 Constraint 130 551 5.6725 7.0906 10.6359 94.9919 Constraint 130 545 9.5434 11.9292 17.8938 94.9919 Constraint 130 540 11.1564 13.9455 20.9183 94.9919 Constraint 130 533 9.1737 11.4671 17.2007 94.9919 Constraint 130 526 9.8718 12.3397 18.5095 94.9919 Constraint 130 517 13.2736 16.5919 24.8879 94.9919 Constraint 130 512 13.6417 17.0521 25.5782 94.9919 Constraint 130 502 12.6486 15.8108 23.7161 94.9919 Constraint 130 463 11.4368 14.2961 21.4441 94.9919 Constraint 130 434 9.6505 12.0631 18.0947 94.9919 Constraint 130 427 8.2350 10.2937 15.4406 94.9919 Constraint 130 418 11.7325 14.6656 21.9983 94.9919 Constraint 130 410 12.8669 16.0837 24.1255 94.9919 Constraint 130 402 8.8924 11.1155 16.6732 94.9919 Constraint 130 391 12.7127 15.8909 23.8364 94.9919 Constraint 130 383 10.3122 12.8903 19.3354 94.9919 Constraint 130 374 13.2796 16.5995 24.8993 94.9919 Constraint 130 369 11.2329 14.0411 21.0617 94.9919 Constraint 130 358 11.0286 13.7858 20.6787 94.9919 Constraint 130 319 4.4815 5.6019 8.4028 94.9919 Constraint 130 295 10.5052 13.1315 19.6973 94.9919 Constraint 130 287 6.9444 8.6805 13.0207 94.9919 Constraint 130 280 7.5272 9.4090 14.1135 94.9919 Constraint 130 274 9.4691 11.8364 17.7546 94.9919 Constraint 130 263 10.4695 13.0869 19.6304 94.9919 Constraint 130 255 8.0941 10.1176 15.1764 94.9919 Constraint 130 243 11.7703 14.7129 22.0693 94.9919 Constraint 165 568 11.8183 14.7729 22.1593 94.9918 Constraint 165 463 7.6147 9.5184 14.2775 94.9918 Constraint 165 434 11.9502 14.9378 22.4067 94.9918 Constraint 165 319 8.7835 10.9793 16.4690 94.9918 Constraint 157 615 15.0165 18.7707 28.1560 94.9918 Constraint 157 610 11.9196 14.8995 22.3492 94.9918 Constraint 157 568 13.9533 17.4416 26.1624 94.9918 Constraint 157 551 8.5925 10.7406 16.1109 94.9918 Constraint 157 545 12.0671 15.0839 22.6259 94.9918 Constraint 157 540 12.1668 15.2085 22.8128 94.9918 Constraint 157 533 8.1375 10.1719 15.2579 94.9918 Constraint 157 526 9.3799 11.7249 17.5873 94.9918 Constraint 157 517 12.9393 16.1741 24.2611 94.9918 Constraint 157 512 11.4956 14.3694 21.5542 94.9918 Constraint 157 502 9.0235 11.2793 16.9190 94.9918 Constraint 157 463 12.0052 15.0065 22.5097 94.9918 Constraint 157 427 11.7799 14.7249 22.0873 94.9918 Constraint 157 418 14.5502 18.1878 27.2817 94.9918 Constraint 157 410 13.8280 17.2850 25.9275 94.9918 Constraint 157 402 9.1952 11.4940 17.2410 94.9918 Constraint 157 391 11.1198 13.8997 20.8496 94.9918 Constraint 157 383 9.4609 11.8261 17.7392 94.9918 Constraint 157 374 9.7267 12.1583 18.2375 94.9918 Constraint 157 369 7.3258 9.1573 13.7359 94.9918 Constraint 157 358 10.0700 12.5875 18.8812 94.9918 Constraint 157 319 7.8924 9.8655 14.7982 94.9918 Constraint 157 295 9.9343 12.4179 18.6268 94.9918 Constraint 157 287 6.3210 7.9013 11.8519 94.9918 Constraint 157 280 6.3031 7.8789 11.8183 94.9918 Constraint 157 274 3.6001 4.5001 6.7502 94.9918 Constraint 157 263 3.7862 4.7328 7.0992 94.9918 Constraint 157 255 5.6878 7.1098 10.6646 94.9918 Constraint 157 243 7.6722 9.5903 14.3854 94.9918 Constraint 173 559 12.8379 16.0474 24.0711 94.9918 Constraint 146 559 10.0467 12.5584 18.8376 94.9918 Constraint 146 324 6.8095 8.5119 12.7678 94.9918 Constraint 173 470 12.1464 15.1831 22.7746 94.9918 Constraint 340 642 8.7668 10.9585 16.4377 94.8615 Constraint 234 642 8.0264 10.0330 15.0496 94.8612 Constraint 455 573 11.7788 14.7235 22.0852 94.7066 Constraint 274 573 15.3603 19.2003 28.8005 94.7065 Constraint 350 568 15.3678 19.2097 28.8146 94.4142 Constraint 234 568 12.4336 15.5420 23.3130 94.4136 Constraint 427 491 10.6126 13.2657 19.8986 94.2921 Constraint 418 491 12.1551 15.1939 22.7908 94.2921 Constraint 410 491 12.0387 15.0484 22.5726 94.2921 Constraint 402 491 10.3639 12.9549 19.4323 94.2921 Constraint 255 491 13.2975 16.6219 24.9328 94.2921 Constraint 243 491 11.1518 13.9397 20.9095 94.2921 Constraint 340 584 13.0323 16.2903 24.4355 94.1625 Constraint 446 593 12.7689 15.9611 23.9417 94.1612 Constraint 350 593 13.8617 17.3271 25.9907 94.1612 Constraint 312 593 8.9456 11.1821 16.7731 94.1612 Constraint 340 626 7.6532 9.5665 14.3498 94.1612 Constraint 329 626 11.1622 13.9528 20.9292 94.1612 Constraint 306 626 10.9946 13.7432 20.6148 94.1612 Constraint 470 626 10.7687 13.4609 20.1913 94.1609 Constraint 568 642 15.2708 19.0884 28.6327 94.1141 Constraint 483 615 12.9274 16.1592 24.2388 94.1141 Constraint 483 610 12.3454 15.4317 23.1475 94.1141 Constraint 483 649 11.9928 14.9910 22.4865 94.1140 Constraint 483 559 10.7927 13.4908 20.2362 94.1140 Constraint 274 634 15.5892 19.4865 29.2297 94.0612 Constraint 340 526 14.5669 18.2086 27.3129 94.0362 Constraint 243 329 16.0440 20.0551 30.0826 94.0362 Constraint 234 324 14.6221 18.2776 27.4164 94.0359 Constraint 324 533 15.3335 19.1669 28.7504 94.0359 Constraint 234 306 14.1751 17.7188 26.5783 94.0351 Constraint 263 615 16.0847 20.1059 30.1589 93.9922 Constraint 165 446 11.5311 14.4138 21.6207 93.9921 Constraint 165 350 8.6365 10.7956 16.1934 93.9921 Constraint 165 312 11.4899 14.3624 21.5435 93.9921 Constraint 165 306 10.9116 13.6395 20.4592 93.9921 Constraint 130 573 7.0861 8.8576 13.2864 93.9920 Constraint 165 649 11.0423 13.8029 20.7044 93.9919 Constraint 157 649 14.0321 17.5401 26.3102 93.9919 Constraint 130 559 7.7948 9.7435 14.6153 93.9919 Constraint 130 324 7.9265 9.9081 14.8622 93.9919 Constraint 165 559 9.1648 11.4560 17.1841 93.9918 Constraint 157 559 10.4380 13.0475 19.5713 93.9918 Constraint 157 324 9.8210 12.2762 18.4144 93.9918 Constraint 165 470 10.9823 13.7279 20.5918 93.9918 Constraint 502 634 13.9131 17.3913 26.0870 93.9392 Constraint 312 649 15.7362 19.6703 29.5054 93.8670 Constraint 329 642 12.4459 15.5574 23.3361 93.8615 Constraint 391 573 14.5642 18.2053 27.3080 93.7068 Constraint 470 573 14.0558 17.5697 26.3545 93.7064 Constraint 234 573 11.7503 14.6879 22.0318 93.7064 Constraint 383 573 13.8863 17.3579 26.0369 93.6068 Constraint 263 491 12.8717 16.0896 24.1344 93.2921 Constraint 491 559 11.0939 13.8674 20.8011 93.2921 Constraint 340 593 11.7895 14.7369 22.1053 93.1612 Constraint 329 593 12.4456 15.5569 23.3354 93.1612 Constraint 306 593 12.1961 15.2451 22.8677 93.1612 Constraint 483 568 10.5944 13.2430 19.8645 93.1140 Constraint 455 634 7.1599 8.9499 13.4249 93.0614 Constraint 446 634 8.0467 10.0584 15.0876 93.0614 Constraint 350 634 9.1751 11.4689 17.2033 93.0614 Constraint 312 634 13.1444 16.4305 24.6458 93.0614 Constraint 173 319 11.5551 14.4438 21.6657 92.9931 Constraint 173 491 10.0517 12.5646 18.8470 92.9921 Constraint 173 483 10.6553 13.3192 19.9787 92.9921 Constraint 146 491 14.3140 17.8926 26.8388 92.9921 Constraint 146 483 13.1664 16.4580 24.6870 92.9921 Constraint 146 455 14.9717 18.7146 28.0719 92.9921 Constraint 146 446 13.6917 17.1147 25.6720 92.9921 Constraint 146 350 5.0594 6.3243 9.4864 92.9921 Constraint 146 312 6.7030 8.3788 12.5682 92.9921 Constraint 146 306 5.7834 7.2293 10.8439 92.9921 Constraint 173 642 11.2157 14.0196 21.0294 92.9921 Constraint 146 642 8.5860 10.7325 16.0988 92.9921 Constraint 130 642 10.0861 12.6077 18.9115 92.9921 Constraint 165 601 14.6528 18.3160 27.4740 92.9919 Constraint 157 573 12.8033 16.0041 24.0061 92.9919 Constraint 146 584 13.2321 16.5402 24.8103 92.9918 Constraint 146 601 12.2274 15.2842 22.9264 92.9918 Constraint 512 642 15.6705 19.5882 29.3823 92.8671 Constraint 306 568 14.9118 18.6397 27.9596 92.4142 Constraint 491 568 11.7222 14.6527 21.9791 92.2921 Constraint 491 610 14.9061 18.6326 27.9489 92.1923 Constraint 234 626 8.3601 10.4502 15.6752 92.1609 Constraint 374 483 14.9075 18.6343 27.9515 92.1197 Constraint 383 483 12.5744 15.7180 23.5769 92.1143 Constraint 350 483 14.5963 18.2453 27.3680 92.1143 Constraint 483 642 11.8652 14.8315 22.2473 92.1142 Constraint 340 634 10.8349 13.5436 20.3155 92.0614 Constraint 470 634 8.6518 10.8148 16.2222 92.0611 Constraint 340 545 14.5105 18.1381 27.2072 92.0365 Constraint 234 340 14.0232 17.5290 26.2935 92.0362 Constraint 340 559 14.6669 18.3337 27.5005 92.0362 Constraint 329 434 15.1439 18.9298 28.3947 92.0348 Constraint 183 551 10.3761 12.9701 19.4552 91.9978 Constraint 183 545 11.0159 13.7699 20.6548 91.9978 Constraint 183 540 11.3522 14.1903 21.2854 91.9978 Constraint 183 533 8.3081 10.3851 15.5776 91.9978 Constraint 183 526 6.6372 8.2965 12.4448 91.9978 Constraint 183 517 9.0329 11.2911 16.9366 91.9978 Constraint 183 512 8.4535 10.5668 15.8502 91.9978 Constraint 183 502 4.5314 5.6643 8.4964 91.9978 Constraint 183 446 13.0174 16.2718 24.4077 91.9978 Constraint 183 427 11.2168 14.0210 21.0315 91.9978 Constraint 183 418 12.2145 15.2682 22.9022 91.9978 Constraint 183 410 10.3854 12.9817 19.4726 91.9978 Constraint 183 402 7.6593 9.5741 14.3612 91.9978 Constraint 183 391 7.7321 9.6651 14.4977 91.9978 Constraint 183 383 10.0044 12.5056 18.7583 91.9978 Constraint 183 374 9.9508 12.4385 18.6577 91.9978 Constraint 183 369 10.7529 13.4412 20.1618 91.9978 Constraint 183 358 13.0586 16.3233 24.4849 91.9978 Constraint 183 350 12.7648 15.9560 23.9339 91.9978 Constraint 183 287 14.7163 18.3954 27.5932 91.9978 Constraint 183 280 12.8935 16.1169 24.1753 91.9978 Constraint 183 274 10.6462 13.3077 19.9616 91.9978 Constraint 183 263 7.0993 8.8741 13.3112 91.9978 Constraint 183 255 8.2430 10.3038 15.4556 91.9978 Constraint 173 324 13.9029 17.3786 26.0679 91.9931 Constraint 130 491 15.1631 18.9538 28.4308 91.9922 Constraint 130 483 13.6260 17.0325 25.5488 91.9922 Constraint 130 455 14.8353 18.5441 27.8161 91.9922 Constraint 130 446 12.3650 15.4562 23.1844 91.9922 Constraint 130 350 6.9970 8.7463 13.1194 91.9922 Constraint 130 312 4.1896 5.2370 7.8555 91.9922 Constraint 130 306 5.5745 6.9682 10.4522 91.9922 Constraint 173 455 14.4434 18.0542 27.0814 91.9921 Constraint 165 491 9.2767 11.5959 17.3938 91.9921 Constraint 165 483 8.7770 10.9713 16.4569 91.9921 Constraint 165 455 12.0930 15.1163 22.6744 91.9921 Constraint 157 491 12.9523 16.1904 24.2855 91.9921 Constraint 157 483 13.1105 16.3882 24.5822 91.9921 Constraint 157 434 14.8911 18.6138 27.9207 91.9921 Constraint 157 350 8.8184 11.0230 16.5345 91.9921 Constraint 157 312 10.4511 13.0639 19.5958 91.9921 Constraint 157 306 8.4517 10.5646 15.8469 91.9921 Constraint 165 340 12.6383 15.7978 23.6967 91.9921 Constraint 165 642 9.0253 11.2817 16.9225 91.9921 Constraint 157 642 11.4889 14.3611 21.5416 91.9921 Constraint 243 573 14.7653 18.4566 27.6849 91.9919 Constraint 130 584 9.1426 11.4283 17.1424 91.9919 Constraint 146 470 14.6007 18.2509 27.3764 91.9919 Constraint 130 601 8.4900 10.6125 15.9187 91.9919 Constraint 165 234 4.2718 5.3398 8.0097 91.9918 Constraint 189 391 8.4772 10.5965 15.8948 91.4524 Constraint 324 593 14.2782 17.8478 26.7717 91.1609 Constraint 165 324 11.7926 14.7407 22.1111 90.9931 Constraint 157 446 15.4138 19.2672 28.9008 90.9922 Constraint 146 340 8.1986 10.2483 15.3724 90.9921 Constraint 173 568 15.5578 19.4473 29.1710 90.9918 Constraint 358 601 15.9240 19.9050 29.8575 90.9392 Constraint 287 502 14.3919 17.9899 26.9848 90.9186 Constraint 287 584 14.9894 18.7367 28.1051 90.7449 Constraint 189 526 7.5618 9.4522 14.1784 90.4524 Constraint 189 517 9.2280 11.5349 17.3024 90.4524 Constraint 189 512 8.9598 11.1998 16.7997 90.4524 Constraint 189 470 9.2025 11.5032 17.2547 90.4524 Constraint 483 573 11.2711 14.0889 21.1334 90.4067 Constraint 391 491 12.0964 15.1205 22.6808 90.2924 Constraint 491 573 13.4444 16.8055 25.2083 90.2921 Constraint 463 593 15.0890 18.8612 28.2919 90.1610 Constraint 306 634 15.1922 18.9903 28.4854 90.0616 Constraint 234 634 9.2172 11.5215 17.2822 90.0611 Constraint 512 634 15.6940 19.6175 29.4263 90.0611 Constraint 319 455 15.9976 19.9970 29.9955 90.0419 Constraint 183 491 7.2271 9.0339 13.5509 89.9978 Constraint 183 483 7.7972 9.7465 14.6197 89.9978 Constraint 183 463 8.0722 10.0903 15.1354 89.9978 Constraint 183 455 11.9988 14.9985 22.4977 89.9978 Constraint 173 340 15.5324 19.4156 29.1233 89.9934 Constraint 130 340 7.5830 9.4787 14.2180 89.9922 Constraint 491 649 15.0155 18.7694 28.1541 89.9922 Constraint 157 340 12.4207 15.5259 23.2888 89.9921 Constraint 146 329 9.2235 11.5293 17.2940 89.9921 Constraint 86 615 8.1687 10.2109 15.3163 89.9921 Constraint 86 610 6.1167 7.6458 11.4687 89.9921 Constraint 86 573 8.6555 10.8194 16.2291 89.9921 Constraint 86 551 11.0093 13.7616 20.6424 89.9921 Constraint 86 545 13.5368 16.9209 25.3814 89.9921 Constraint 86 446 14.5892 18.2366 27.3548 89.9921 Constraint 86 427 11.3310 14.1638 21.2457 89.9921 Constraint 86 418 13.8811 17.3514 26.0271 89.9921 Constraint 86 410 16.0304 20.0380 30.0569 89.9921 Constraint 86 402 13.6413 17.0516 25.5774 89.9921 Constraint 86 383 14.5220 18.1525 27.2287 89.9921 Constraint 86 358 14.6210 18.2762 27.4143 89.9921 Constraint 86 350 10.3922 12.9903 19.4854 89.9921 Constraint 86 312 5.2774 6.5967 9.8951 89.9921 Constraint 86 306 8.9727 11.2159 16.8239 89.9921 Constraint 86 295 13.7178 17.1472 25.7208 89.9921 Constraint 86 287 11.9003 14.8754 22.3131 89.9921 Constraint 86 280 12.3712 15.4639 23.1959 89.9921 Constraint 86 255 13.7840 17.2300 25.8450 89.9921 Constraint 78 615 6.1605 7.7007 11.5510 89.9921 Constraint 78 610 3.9378 4.9223 7.3834 89.9921 Constraint 78 573 7.5600 9.4500 14.1750 89.9921 Constraint 78 551 8.2415 10.3019 15.4528 89.9921 Constraint 78 545 11.0783 13.8478 20.7717 89.9921 Constraint 78 540 13.8066 17.2582 25.8873 89.9921 Constraint 78 533 12.5287 15.6608 23.4913 89.9921 Constraint 78 526 12.0796 15.0995 22.6493 89.9921 Constraint 78 446 12.1607 15.2009 22.8013 89.9921 Constraint 78 427 8.2322 10.2903 15.4354 89.9921 Constraint 78 418 10.6026 13.2532 19.8798 89.9921 Constraint 78 410 12.1421 15.1777 22.7665 89.9921 Constraint 78 402 9.4417 11.8021 17.7032 89.9921 Constraint 78 391 12.9421 16.1777 24.2665 89.9921 Constraint 78 383 10.2004 12.7505 19.1257 89.9921 Constraint 78 374 13.9806 17.4757 26.2136 89.9921 Constraint 78 369 12.5353 15.6691 23.5036 89.9921 Constraint 78 358 10.7666 13.4583 20.1874 89.9921 Constraint 78 350 6.3820 7.9776 11.9663 89.9921 Constraint 78 312 4.1760 5.2199 7.8299 89.9921 Constraint 78 306 7.4269 9.2836 13.9254 89.9921 Constraint 78 295 12.0977 15.1221 22.6831 89.9921 Constraint 78 287 9.8038 12.2548 18.3822 89.9921 Constraint 78 280 9.0733 11.3416 17.0124 89.9921 Constraint 78 274 12.3090 15.3863 23.0794 89.9921 Constraint 78 263 13.1928 16.4910 24.7365 89.9921 Constraint 78 255 9.5459 11.9323 17.8985 89.9921 Constraint 78 243 13.3570 16.6962 25.0443 89.9921 Constraint 263 573 15.0145 18.7682 28.1523 89.9921 Constraint 173 573 14.9484 18.6855 28.0283 89.9921 Constraint 157 234 8.6099 10.7624 16.1436 89.9918 Constraint 146 234 8.7310 10.9138 16.3706 89.9918 Constraint 146 593 12.9685 16.2106 24.3159 89.9918 Constraint 173 626 12.1453 15.1816 22.7724 89.9918 Constraint 146 626 7.5703 9.4629 14.1943 89.9918 Constraint 189 533 9.5318 11.9148 17.8721 89.7451 Constraint 189 502 5.4098 6.7622 10.1434 89.7451 Constraint 223 455 9.9412 12.4265 18.6397 89.7348 Constraint 223 410 9.0397 11.2996 16.9494 89.7348 Constraint 223 402 9.3388 11.6735 17.5103 89.7348 Constraint 223 374 12.0853 15.1067 22.6600 89.7348 Constraint 189 410 10.6741 13.3426 20.0140 89.4524 Constraint 189 402 8.7763 10.9704 16.4556 89.4524 Constraint 324 584 15.3382 19.1728 28.7591 89.1611 Constraint 319 483 15.2682 19.0852 28.6278 89.1153 Constraint 234 483 5.7452 7.1815 10.7722 89.1140 Constraint 483 626 10.8138 13.5172 20.2758 89.1140 Constraint 329 634 14.6654 18.3318 27.4977 89.0614 Constraint 324 410 16.0499 20.0623 30.0935 89.0416 Constraint 183 649 11.2499 14.0624 21.0936 88.9979 Constraint 183 470 9.4066 11.7583 17.6374 88.9978 Constraint 491 642 14.8319 18.5398 27.8097 88.9926 Constraint 130 329 8.3888 10.4860 15.7291 88.9922 Constraint 86 165 14.5962 18.2452 27.3678 88.9921 Constraint 78 165 10.7178 13.3972 20.0958 88.9921 Constraint 78 173 14.5578 18.1973 27.2959 88.9921 Constraint 130 234 10.6493 13.3116 19.9674 88.9919 Constraint 130 593 8.6933 10.8666 16.3000 88.9919 Constraint 130 626 7.0054 8.7567 13.1350 88.9919 Constraint 165 626 8.5324 10.6655 15.9982 88.9918 Constraint 157 626 11.0643 13.8304 20.7456 88.9918 Constraint 324 434 15.8559 19.8198 29.7297 88.9184 Constraint 223 463 8.1906 10.2383 15.3574 88.7348 Constraint 223 391 7.8967 9.8708 14.8062 88.7348 Constraint 223 526 9.1916 11.4895 17.2343 88.7348 Constraint 223 517 10.2534 12.8167 19.2250 88.7348 Constraint 223 418 11.4638 14.3298 21.4947 88.7348 Constraint 189 649 11.6078 14.5097 21.7646 88.4525 Constraint 189 463 8.4597 10.5746 15.8619 88.4524 Constraint 189 455 11.7749 14.7186 22.0779 88.4524 Constraint 189 418 12.5002 15.6253 23.4379 88.4524 Constraint 234 491 7.4209 9.2761 13.9142 88.2921 Constraint 491 626 13.9254 17.4068 26.1102 88.2921 Constraint 255 593 15.8832 19.8540 29.7810 88.1610 Constraint 183 610 14.6289 18.2861 27.4292 87.9979 Constraint 183 559 12.8561 16.0701 24.1051 87.9978 Constraint 165 329 14.2876 17.8595 26.7892 87.9934 Constraint 86 568 12.6015 15.7518 23.6277 87.9921 Constraint 86 559 12.3609 15.4512 23.1768 87.9921 Constraint 86 434 10.1312 12.6640 18.9960 87.9921 Constraint 86 319 8.4515 10.5644 15.8466 87.9921 Constraint 78 568 11.6703 14.5879 21.8818 87.9921 Constraint 78 559 10.8720 13.5900 20.3851 87.9921 Constraint 78 483 14.9446 18.6807 28.0211 87.9921 Constraint 78 463 12.1537 15.1921 22.7882 87.9921 Constraint 78 455 14.4268 18.0335 27.0503 87.9921 Constraint 78 434 8.4453 10.5566 15.8349 87.9921 Constraint 78 319 5.1711 6.4638 9.6958 87.9921 Constraint 78 146 7.1263 8.9079 13.3618 87.9921 Constraint 68 615 4.0477 5.0596 7.5894 87.9921 Constraint 68 610 5.7713 7.2141 10.8212 87.9921 Constraint 68 573 9.2535 11.5668 17.3502 87.9921 Constraint 68 568 13.6023 17.0029 25.5044 87.9921 Constraint 68 559 14.0347 17.5434 26.3150 87.9921 Constraint 68 551 11.1430 13.9287 20.8931 87.9921 Constraint 68 545 12.6618 15.8272 23.7409 87.9921 Constraint 68 526 14.2159 17.7699 26.6549 87.9921 Constraint 68 463 13.0513 16.3142 24.4712 87.9921 Constraint 68 455 13.8961 17.3701 26.0552 87.9921 Constraint 68 446 12.0276 15.0345 22.5518 87.9921 Constraint 68 434 7.9683 9.9604 14.9406 87.9921 Constraint 68 427 9.0982 11.3728 17.0592 87.9921 Constraint 68 418 9.7931 12.2413 18.3620 87.9921 Constraint 68 410 11.8046 14.7558 22.1337 87.9921 Constraint 68 402 10.8883 13.6104 20.4155 87.9921 Constraint 68 391 13.8546 17.3183 25.9774 87.9921 Constraint 68 383 11.6003 14.5004 21.7506 87.9921 Constraint 68 369 15.2571 19.0714 28.6071 87.9921 Constraint 68 358 12.4883 15.6103 23.4155 87.9921 Constraint 68 350 8.6585 10.8231 16.2347 87.9921 Constraint 68 319 8.9407 11.1758 16.7637 87.9921 Constraint 68 312 8.1778 10.2223 15.3335 87.9921 Constraint 68 306 11.5629 14.4536 21.6803 87.9921 Constraint 68 287 14.0830 17.6038 26.4057 87.9921 Constraint 68 280 12.6008 15.7510 23.6266 87.9921 Constraint 68 255 12.3084 15.3855 23.0782 87.9921 Constraint 68 243 15.5885 19.4857 29.2285 87.9921 Constraint 68 146 11.0888 13.8611 20.7916 87.9921 Constraint 62 615 5.7424 7.1780 10.7670 87.9921 Constraint 62 610 6.9406 8.6757 13.0136 87.9921 Constraint 62 573 10.5638 13.2047 19.8071 87.9921 Constraint 62 568 14.5768 18.2210 27.3315 87.9921 Constraint 62 559 14.1570 17.6962 26.5443 87.9921 Constraint 62 551 10.4676 13.0845 19.6267 87.9921 Constraint 62 545 12.3615 15.4519 23.1779 87.9921 Constraint 62 533 14.3474 17.9343 26.9014 87.9921 Constraint 62 526 12.4281 15.5352 23.3028 87.9921 Constraint 62 483 14.4855 18.1069 27.1603 87.9921 Constraint 62 463 11.1049 13.8811 20.8217 87.9921 Constraint 62 455 12.6426 15.8032 23.7048 87.9921 Constraint 62 446 11.9767 14.9709 22.4564 87.9921 Constraint 62 434 9.2568 11.5710 17.3566 87.9921 Constraint 62 427 8.4196 10.5245 15.7867 87.9921 Constraint 62 418 8.4442 10.5552 15.8329 87.9921 Constraint 62 410 9.0021 11.2526 16.8789 87.9921 Constraint 62 402 7.8133 9.7667 14.6500 87.9921 Constraint 62 391 9.9179 12.3974 18.5961 87.9921 Constraint 62 383 7.2520 9.0651 13.5976 87.9921 Constraint 62 374 11.4679 14.3348 21.5023 87.9921 Constraint 62 369 11.2513 14.0641 21.0962 87.9921 Constraint 62 358 8.3047 10.3809 15.5713 87.9921 Constraint 62 350 4.9646 6.2058 9.3087 87.9921 Constraint 62 319 6.8858 8.6073 12.9109 87.9921 Constraint 62 312 8.2906 10.3633 15.5450 87.9921 Constraint 62 306 10.5369 13.1711 19.7567 87.9921 Constraint 62 287 12.3375 15.4218 23.1327 87.9921 Constraint 62 280 9.6065 12.0081 18.0122 87.9921 Constraint 62 263 13.1170 16.3963 24.5944 87.9921 Constraint 62 255 8.5691 10.7114 16.0671 87.9921 Constraint 62 243 11.7251 14.6564 21.9845 87.9921 Constraint 62 173 14.3133 17.8916 26.8374 87.9921 Constraint 62 146 8.6072 10.7590 16.1385 87.9921 Constraint 54 615 5.2321 6.5401 9.8102 87.9921 Constraint 54 610 8.9770 11.2213 16.8319 87.9921 Constraint 54 551 12.6964 15.8705 23.8058 87.9921 Constraint 54 545 13.2168 16.5209 24.7814 87.9921 Constraint 54 526 13.7736 17.2170 25.8255 87.9921 Constraint 54 446 11.0969 13.8711 20.8067 87.9921 Constraint 54 427 8.9806 11.2257 16.8386 87.9921 Constraint 54 418 6.9954 8.7443 13.1164 87.9921 Constraint 54 410 8.0414 10.0517 15.0776 87.9921 Constraint 54 402 9.2904 11.6130 17.4194 87.9921 Constraint 54 391 10.7977 13.4971 20.2457 87.9921 Constraint 54 383 9.6768 12.0961 18.1441 87.9921 Constraint 54 374 13.9750 17.4688 26.2032 87.9921 Constraint 54 369 14.7220 18.4024 27.6037 87.9921 Constraint 54 358 11.5735 14.4668 21.7003 87.9921 Constraint 54 350 9.1248 11.4060 17.1089 87.9921 Constraint 54 312 12.3325 15.4156 23.1234 87.9921 Constraint 54 306 14.9180 18.6475 27.9713 87.9921 Constraint 54 280 13.9117 17.3896 26.0844 87.9921 Constraint 54 255 11.8410 14.8012 22.2018 87.9921 Constraint 54 243 13.8748 17.3435 26.0152 87.9921 Constraint 43 615 8.8959 11.1199 16.6798 87.9921 Constraint 43 551 13.9937 17.4921 26.2382 87.9921 Constraint 43 526 14.4149 18.0187 27.0280 87.9921 Constraint 43 446 13.6941 17.1176 25.6764 87.9921 Constraint 43 427 11.0232 13.7789 20.6684 87.9921 Constraint 43 418 8.9750 11.2187 16.8281 87.9921 Constraint 43 410 8.0105 10.0131 15.0197 87.9921 Constraint 43 402 8.9425 11.1782 16.7673 87.9921 Constraint 43 391 8.7387 10.9233 16.3850 87.9921 Constraint 43 383 6.9139 8.6424 12.9636 87.9921 Constraint 43 374 10.5964 13.2455 19.8683 87.9921 Constraint 43 369 11.7949 14.7436 22.1154 87.9921 Constraint 43 358 8.2531 10.3164 15.4746 87.9921 Constraint 43 350 7.4524 9.3156 13.9733 87.9921 Constraint 43 312 12.8784 16.0979 24.1469 87.9921 Constraint 43 280 12.0725 15.0906 22.6359 87.9921 Constraint 43 255 9.9895 12.4869 18.7303 87.9921 Constraint 43 243 11.8310 14.7887 22.1831 87.9921 Constraint 86 340 7.2592 9.0741 13.6111 87.9921 Constraint 78 340 4.8662 6.0827 9.1240 87.9921 Constraint 173 634 13.9929 17.4911 26.2366 87.9920 Constraint 146 634 11.4642 14.3303 21.4955 87.9920 Constraint 165 593 15.3196 19.1496 28.7243 87.9918 Constraint 287 568 15.6782 19.5978 29.3966 87.9918 Constraint 223 649 10.2499 12.8124 19.2186 87.8613 Constraint 189 545 11.5387 14.4234 21.6351 87.7451 Constraint 189 540 11.8959 14.8699 22.3049 87.7451 Constraint 223 383 11.7411 14.6764 22.0147 87.7348 Constraint 223 551 13.6637 17.0797 25.6195 87.7348 Constraint 223 545 12.8193 16.0241 24.0361 87.7348 Constraint 223 533 12.2168 15.2709 22.9064 87.7348 Constraint 223 512 11.1810 13.9763 20.9644 87.7348 Constraint 223 446 12.6625 15.8281 23.7422 87.7348 Constraint 223 427 12.3479 15.4349 23.1523 87.7348 Constraint 383 491 14.8012 18.5015 27.7523 87.2924 Constraint 483 634 10.7244 13.4056 20.1083 87.1141 Constraint 350 517 15.5170 19.3962 29.0943 87.0424 Constraint 183 319 13.6229 17.0286 25.5429 86.9992 Constraint 183 642 11.3229 14.1536 21.2304 86.9981 Constraint 43 610 11.3029 14.1286 21.1929 86.9922 Constraint 43 263 14.4912 18.1140 27.1711 86.9922 Constraint 78 649 13.2101 16.5127 24.7690 86.9922 Constraint 68 649 12.9389 16.1736 24.2604 86.9922 Constraint 62 649 9.0501 11.3126 16.9689 86.9922 Constraint 62 130 8.2697 10.3372 15.5058 86.9922 Constraint 78 157 11.2773 14.0966 21.1450 86.9921 Constraint 68 165 13.8766 17.3457 26.0186 86.9921 Constraint 62 165 11.1231 13.9039 20.8559 86.9921 Constraint 62 157 12.6615 15.8269 23.7404 86.9921 Constraint 54 165 13.9166 17.3958 26.0937 86.9921 Constraint 43 165 13.2552 16.5690 24.8535 86.9921 Constraint 86 584 7.7675 9.7094 14.5640 86.9921 Constraint 78 584 8.9368 11.1710 16.7565 86.9921 Constraint 86 324 10.2813 12.8517 19.2775 86.9921 Constraint 78 324 8.2164 10.2705 15.4057 86.9921 Constraint 68 324 11.3387 14.1734 21.2601 86.9921 Constraint 62 324 9.4746 11.8433 17.7650 86.9921 Constraint 62 295 13.8519 17.3149 25.9723 86.9921 Constraint 62 274 13.0023 16.2529 24.3794 86.9921 Constraint 110 610 10.7294 13.4117 20.1175 86.9921 Constraint 110 573 10.4109 13.0136 19.5204 86.9921 Constraint 110 568 12.1306 15.1633 22.7449 86.9921 Constraint 110 551 11.8846 14.8557 22.2836 86.9921 Constraint 110 319 11.6739 14.5924 21.8886 86.9921 Constraint 110 312 8.4306 10.5382 15.8073 86.9921 Constraint 110 306 9.6239 12.0299 18.0449 86.9921 Constraint 110 287 11.1535 13.9418 20.9127 86.9921 Constraint 54 573 11.9427 14.9284 22.3926 86.9921 Constraint 86 601 4.5202 5.6503 8.4754 86.9921 Constraint 86 329 7.6922 9.6152 14.4228 86.9921 Constraint 78 601 5.7600 7.2000 10.8000 86.9921 Constraint 78 329 7.0593 8.8241 13.2362 86.9921 Constraint 130 634 11.4825 14.3531 21.5297 86.9921 Constraint 165 634 11.1493 13.9366 20.9048 86.9920 Constraint 157 634 14.4513 18.0641 27.0962 86.9920 Constraint 287 593 14.2895 17.8619 26.7928 86.8448 Constraint 223 540 13.8473 17.3091 25.9636 86.7348 Constraint 223 369 14.0948 17.6185 26.4278 86.7348 Constraint 189 483 7.6789 9.5986 14.3979 86.7051 Constraint 369 545 16.0162 20.0203 30.0304 86.6200 Constraint 223 502 8.2080 10.2600 15.3901 86.6130 Constraint 189 383 10.8836 13.6044 20.4067 86.4524 Constraint 189 374 10.7625 13.4531 20.1797 86.4524 Constraint 189 369 11.9442 14.9303 22.3954 86.4524 Constraint 189 274 12.1581 15.1976 22.7964 86.4524 Constraint 189 263 8.7047 10.8808 16.3213 86.4524 Constraint 491 634 14.4877 18.1096 27.1644 86.1923 Constraint 324 526 15.2694 19.0868 28.6302 86.0421 Constraint 274 517 15.6747 19.5934 29.3900 86.0407 Constraint 306 463 15.7982 19.7478 29.6217 86.0352 Constraint 189 491 6.9391 8.6739 13.0108 85.9978 Constraint 157 329 12.7628 15.9535 23.9303 85.9934 Constraint 54 483 14.6745 18.3431 27.5146 85.9921 Constraint 54 463 11.2204 14.0254 21.0382 85.9921 Constraint 54 455 11.0354 13.7942 20.6913 85.9921 Constraint 54 434 8.8874 11.1092 16.6638 85.9921 Constraint 54 319 11.3279 14.1598 21.2398 85.9921 Constraint 54 146 12.6402 15.8002 23.7004 85.9921 Constraint 43 483 15.5410 19.4262 29.1394 85.9921 Constraint 43 463 12.0598 15.0747 22.6121 85.9921 Constraint 43 455 12.6940 15.8675 23.8012 85.9921 Constraint 43 434 12.2422 15.3028 22.9541 85.9921 Constraint 43 319 10.7235 13.4044 20.1066 85.9921 Constraint 43 146 11.8788 14.8485 22.2727 85.9921 Constraint 86 533 15.2324 19.0405 28.5608 85.9921 Constraint 86 526 15.4036 19.2545 28.8817 85.9921 Constraint 68 374 15.8256 19.7820 29.6730 85.9921 Constraint 68 340 6.3100 7.8874 11.8312 85.9921 Constraint 62 340 5.0014 6.2517 9.3776 85.9921 Constraint 117 615 14.4217 18.0272 27.0408 85.9921 Constraint 117 610 10.1702 12.7127 19.0691 85.9921 Constraint 117 573 9.9120 12.3900 18.5850 85.9921 Constraint 117 568 11.3336 14.1670 21.2506 85.9921 Constraint 117 551 10.0562 12.5703 18.8554 85.9921 Constraint 117 319 9.9614 12.4518 18.6776 85.9921 Constraint 117 312 7.5729 9.4662 14.1992 85.9921 Constraint 117 306 7.8615 9.8269 14.7403 85.9921 Constraint 117 287 8.6942 10.8677 16.3016 85.9921 Constraint 110 559 10.6859 13.3574 20.0361 85.9921 Constraint 54 340 9.0592 11.3240 16.9860 85.9921 Constraint 43 340 8.7644 10.9555 16.4332 85.9921 Constraint 212 455 11.0847 13.8559 20.7839 85.7406 Constraint 212 410 10.2265 12.7831 19.1747 85.7406 Constraint 223 470 6.6689 8.3361 12.5041 85.7348 Constraint 369 470 15.4502 19.3128 28.9692 85.6127 Constraint 280 593 15.4141 19.2676 28.9014 85.1667 Constraint 340 446 15.3956 19.2445 28.8668 85.0362 Constraint 306 540 15.6402 19.5503 29.3254 85.0351 Constraint 573 649 15.5012 19.3765 29.0647 84.9937 Constraint 43 545 15.0913 18.8641 28.2962 84.9924 Constraint 43 306 14.3947 17.9934 26.9901 84.9924 Constraint 86 642 13.0631 16.3288 24.4933 84.9924 Constraint 78 642 8.8671 11.0839 16.6258 84.9924 Constraint 68 642 9.0931 11.3664 17.0495 84.9924 Constraint 62 642 4.9766 6.2207 9.3310 84.9924 Constraint 54 649 8.6877 10.8597 16.2895 84.9922 Constraint 54 130 11.9906 14.9883 22.4824 84.9922 Constraint 43 649 6.2472 7.8090 11.7135 84.9922 Constraint 43 130 12.7288 15.9110 23.8665 84.9922 Constraint 68 584 10.0222 12.5277 18.7916 84.9921 Constraint 62 584 12.7394 15.9243 23.8864 84.9921 Constraint 54 324 13.8955 17.3694 26.0541 84.9921 Constraint 43 324 12.6441 15.8051 23.7076 84.9921 Constraint 68 601 5.1265 6.4081 9.6121 84.9921 Constraint 68 329 9.3799 11.7249 17.5873 84.9921 Constraint 62 601 8.8210 11.0262 16.5393 84.9921 Constraint 62 470 13.5611 16.9513 25.4270 84.9921 Constraint 62 329 8.9714 11.2143 16.8215 84.9921 Constraint 117 559 8.9965 11.2456 16.8685 84.9921 Constraint 117 533 12.1047 15.1309 22.6964 84.9921 Constraint 110 350 14.6952 18.3690 27.5535 84.9921 Constraint 110 280 14.1543 17.6929 26.5393 84.9921 Constraint 97 615 9.5098 11.8872 17.8308 84.9921 Constraint 97 610 5.5732 6.9665 10.4497 84.9921 Constraint 97 573 6.4966 8.1208 12.1811 84.9921 Constraint 97 551 8.2836 10.3545 15.5317 84.9921 Constraint 97 545 11.2399 14.0498 21.0747 84.9921 Constraint 97 540 12.7351 15.9188 23.8782 84.9921 Constraint 97 533 12.1368 15.1710 22.7565 84.9921 Constraint 97 427 10.2929 12.8661 19.2992 84.9921 Constraint 97 350 10.7721 13.4651 20.1977 84.9921 Constraint 97 312 5.1091 6.3863 9.5795 84.9921 Constraint 97 306 7.9077 9.8846 14.8269 84.9921 Constraint 97 295 13.0087 16.2609 24.3913 84.9921 Constraint 97 287 10.1355 12.6694 19.0040 84.9921 Constraint 97 280 11.6510 14.5637 21.8456 84.9921 Constraint 54 470 12.5484 15.6855 23.5283 84.9921 Constraint 54 329 12.9960 16.2450 24.3676 84.9921 Constraint 43 470 12.7751 15.9688 23.9532 84.9921 Constraint 43 329 12.6733 15.8416 23.7624 84.9921 Constraint 189 446 13.0177 16.2721 24.4081 84.7451 Constraint 189 551 11.3262 14.1578 21.2366 84.7451 Constraint 189 427 11.7034 14.6293 21.9439 84.7451 Constraint 212 391 8.8956 11.1195 16.6792 84.7406 Constraint 212 402 10.6568 13.3210 19.9816 84.7406 Constraint 287 540 15.5596 19.4495 29.1743 84.6184 Constraint 463 584 13.7756 17.2195 25.8292 84.0930 Constraint 319 517 15.2801 19.1002 28.6502 84.0421 Constraint 86 157 14.5583 18.1979 27.2969 83.9978 Constraint 183 626 12.2556 15.3195 22.9793 83.9978 Constraint 43 573 14.4815 18.1018 27.1527 83.9924 Constraint 43 157 15.2931 19.1164 28.6746 83.9922 Constraint 54 601 9.8046 12.2557 18.3836 83.9922 Constraint 43 601 13.0934 16.3667 24.5500 83.9922 Constraint 78 234 12.4195 15.5243 23.2865 83.9921 Constraint 110 584 8.8833 11.1042 16.6563 83.9921 Constraint 86 593 5.4326 6.7908 10.1862 83.9921 Constraint 78 593 7.7113 9.6392 14.4588 83.9921 Constraint 117 601 11.4195 14.2744 21.4116 83.9921 Constraint 117 350 13.0066 16.2583 24.3874 83.9921 Constraint 117 280 11.8346 14.7932 22.1898 83.9921 Constraint 110 615 14.5196 18.1495 27.2242 83.9921 Constraint 110 601 10.6400 13.3000 19.9499 83.9921 Constraint 110 533 14.3830 17.9787 26.9681 83.9921 Constraint 110 324 12.8542 16.0677 24.1016 83.9921 Constraint 97 274 13.8496 17.3120 25.9681 83.9921 Constraint 97 255 12.7273 15.9091 23.8636 83.9921 Constraint 212 649 11.0328 13.7909 20.6864 83.8670 Constraint 223 642 12.0516 15.0645 22.5968 83.8615 Constraint 212 463 9.5146 11.8932 17.8398 83.7406 Constraint 212 383 12.7354 15.9193 23.8789 83.7406 Constraint 212 526 10.4765 13.0956 19.6434 83.7406 Constraint 212 517 11.1654 13.9567 20.9350 83.7406 Constraint 212 512 12.1030 15.1288 22.6931 83.7406 Constraint 212 446 13.9452 17.4315 26.1472 83.7406 Constraint 212 427 13.7760 17.2201 25.8301 83.7406 Constraint 212 418 12.6353 15.7941 23.6911 83.7406 Constraint 223 358 15.3061 19.1326 28.6989 83.7348 Constraint 374 545 16.2160 20.2700 30.4050 83.6200 Constraint 189 642 12.1125 15.1407 22.7110 83.4527 Constraint 189 350 13.8154 17.2692 25.9038 83.4524 Constraint 189 280 14.2052 17.7565 26.6347 83.4524 Constraint 43 274 14.9915 18.7394 28.1091 82.9924 Constraint 43 173 15.3161 19.1451 28.7177 82.9924 Constraint 54 642 6.3027 7.8783 11.8175 82.9924 Constraint 43 642 4.4348 5.5435 8.3152 82.9924 Constraint 165 584 14.4998 18.1248 27.1872 82.9923 Constraint 97 165 12.3250 15.4063 23.1094 82.9921 Constraint 117 584 9.8672 12.3340 18.5009 82.9921 Constraint 86 463 15.6769 19.5961 29.3942 82.9921 Constraint 97 568 9.7147 12.1433 18.2150 82.9921 Constraint 97 559 8.7169 10.8961 16.3441 82.9921 Constraint 97 434 9.8803 12.3504 18.5256 82.9921 Constraint 97 319 8.1486 10.1857 15.2786 82.9921 Constraint 86 540 15.7170 19.6462 29.4694 82.9921 Constraint 117 324 11.2533 14.0667 21.1000 82.9921 Constraint 110 340 13.0923 16.3654 24.5480 82.9921 Constraint 97 446 13.5038 16.8798 25.3196 82.9921 Constraint 97 418 13.8002 17.2502 25.8754 82.9921 Constraint 97 402 12.6512 15.8140 23.7211 82.9921 Constraint 97 383 14.4332 18.0415 27.0622 82.9921 Constraint 97 358 14.9243 18.6554 27.9831 82.9921 Constraint 97 340 9.2675 11.5844 17.3766 82.9921 Constraint 455 660 14.7411 18.4263 27.6395 82.8631 Constraint 427 660 14.7210 18.4012 27.6019 82.8631 Constraint 418 660 12.9106 16.1382 24.2073 82.8631 Constraint 410 660 9.6751 12.0939 18.1408 82.8631 Constraint 402 660 9.8905 12.3631 18.5447 82.8631 Constraint 374 660 5.4904 6.8630 10.2945 82.8631 Constraint 369 660 8.7854 10.9818 16.4727 82.8631 Constraint 358 660 7.7813 9.7266 14.5900 82.8631 Constraint 350 660 10.3489 12.9362 19.4043 82.8631 Constraint 255 660 9.0735 11.3419 17.0128 82.8631 Constraint 243 660 8.0514 10.0642 15.0964 82.8631 Constraint 206 410 12.6078 15.7598 23.6397 82.7408 Constraint 212 545 14.0361 17.5452 26.3177 82.7406 Constraint 212 374 12.6004 15.7505 23.6258 82.7406 Constraint 223 350 15.1795 18.9744 28.4616 82.7348 Constraint 223 483 7.8430 9.8037 14.7055 82.1140 Constraint 306 418 15.9748 19.9685 29.9527 82.0410 Constraint 329 559 15.5525 19.4407 29.1610 82.0366 Constraint 197 410 12.6232 15.7790 23.6685 82.0335 Constraint 197 402 11.7491 14.6864 22.0296 82.0335 Constraint 197 391 10.7233 13.4041 20.1061 82.0335 Constraint 183 634 13.1416 16.4270 24.6405 81.9980 Constraint 78 517 15.3018 19.1273 28.6909 81.9980 Constraint 68 157 15.1894 18.9867 28.4801 81.9978 Constraint 54 584 13.9778 17.4722 26.2083 81.9924 Constraint 36 427 11.1253 13.9066 20.8599 81.9924 Constraint 36 418 7.6361 9.5451 14.3176 81.9924 Constraint 36 410 5.7464 7.1831 10.7746 81.9924 Constraint 36 402 8.8967 11.1209 16.6813 81.9924 Constraint 36 391 7.6741 9.5927 14.3890 81.9924 Constraint 36 383 8.2698 10.3373 15.5059 81.9924 Constraint 36 374 11.5394 14.4243 21.6364 81.9924 Constraint 36 369 13.7315 17.1644 25.7465 81.9924 Constraint 36 358 10.9707 13.7134 20.5702 81.9924 Constraint 36 350 10.6778 13.3472 20.0209 81.9924 Constraint 36 280 15.0978 18.8723 28.3085 81.9924 Constraint 36 255 11.5386 14.4233 21.6349 81.9924 Constraint 36 243 11.7898 14.7372 22.1059 81.9924 Constraint 110 295 13.4538 16.8173 25.2259 81.9922 Constraint 117 427 13.6589 17.0736 25.6104 81.9921 Constraint 117 540 13.1979 16.4974 24.7461 81.9921 Constraint 68 234 14.3847 17.9809 26.9714 81.9921 Constraint 62 234 11.4328 14.2910 21.4365 81.9921 Constraint 54 234 12.9169 16.1461 24.2191 81.9921 Constraint 43 234 12.3338 15.4172 23.1258 81.9921 Constraint 68 593 8.7025 10.8781 16.3171 81.9921 Constraint 62 593 11.8932 14.8665 22.2997 81.9921 Constraint 97 584 6.3183 7.8979 11.8469 81.9921 Constraint 97 324 10.4987 13.1234 19.6851 81.9921 Constraint 86 626 9.4769 11.8462 17.7692 81.9921 Constraint 78 626 5.5545 6.9432 10.4147 81.9921 Constraint 68 626 6.1792 7.7240 11.5860 81.9921 Constraint 62 626 4.0164 5.0205 7.5307 81.9921 Constraint 117 295 11.5092 14.3866 21.5798 81.9921 Constraint 117 274 12.7277 15.9096 23.8644 81.9921 Constraint 110 329 11.6349 14.5436 21.8154 81.9921 Constraint 97 601 6.2160 7.7699 11.6549 81.9921 Constraint 97 526 13.0810 16.3512 24.5269 81.9921 Constraint 97 329 9.2063 11.5079 17.2618 81.9921 Constraint 157 470 15.1004 18.8755 28.3132 81.9919 Constraint 502 615 15.5294 19.4117 29.1175 81.9393 Constraint 463 660 12.9615 16.2019 24.3029 81.8631 Constraint 391 660 6.1104 7.6380 11.4570 81.8631 Constraint 383 660 6.3030 7.8787 11.8181 81.8631 Constraint 206 470 10.1124 12.6405 18.9607 81.7408 Constraint 206 402 12.2527 15.3159 22.9739 81.7408 Constraint 206 391 10.8249 13.5311 20.2967 81.7408 Constraint 212 470 7.6818 9.6022 14.4034 81.7406 Constraint 212 502 9.2214 11.5268 17.2901 81.6187 Constraint 517 593 15.9544 19.9430 29.9145 81.1625 Constraint 340 533 15.1925 18.9906 28.4860 81.0363 Constraint 197 470 10.1418 12.6773 19.0159 81.0335 Constraint 183 568 14.6914 18.3642 27.5463 80.9978 Constraint 183 573 14.5317 18.1646 27.2469 80.9978 Constraint 36 551 14.8221 18.5277 27.7915 80.9925 Constraint 36 526 13.8497 17.3121 25.9681 80.9925 Constraint 36 446 12.4950 15.6188 23.4282 80.9925 Constraint 36 165 13.9523 17.4404 26.1606 80.9924 Constraint 173 434 15.7922 19.7402 29.6103 80.9922 Constraint 117 593 9.2074 11.5093 17.2639 80.9921 Constraint 110 593 7.8004 9.7505 14.6257 80.9921 Constraint 97 263 15.0869 18.8587 28.2880 80.9921 Constraint 223 491 8.3024 10.3780 15.5670 80.9921 Constraint 280 660 12.1634 15.2042 22.8063 80.8633 Constraint 234 660 11.0074 13.7592 20.6388 80.8631 Constraint 206 526 11.0049 13.7562 20.6342 80.7408 Constraint 206 463 11.2559 14.0699 21.1048 80.7408 Constraint 189 358 13.8239 17.2798 25.9198 80.4524 Constraint 369 483 15.6257 19.5321 29.2981 80.1202 Constraint 197 526 10.0306 12.5383 18.8075 80.0335 Constraint 117 340 12.1636 15.2045 22.8068 79.9934 Constraint 36 615 10.1241 12.6551 18.9826 79.9926 Constraint 36 610 13.1532 16.4415 24.6623 79.9926 Constraint 36 649 4.3355 5.4194 8.1291 79.9924 Constraint 36 642 5.7545 7.1931 10.7896 79.9924 Constraint 36 146 14.2112 17.7640 26.6460 79.9924 Constraint 36 340 12.8944 16.1180 24.1770 79.9924 Constraint 36 173 15.5944 19.4930 29.2395 79.9924 Constraint 86 634 13.0394 16.2992 24.4488 79.9923 Constraint 78 634 9.5604 11.9505 17.9258 79.9923 Constraint 68 634 8.2276 10.2845 15.4268 79.9923 Constraint 62 634 6.1422 7.6778 11.5166 79.9923 Constraint 54 593 13.3983 16.7479 25.1219 79.9922 Constraint 117 545 13.2179 16.5224 24.7835 79.9921 Constraint 117 526 14.3637 17.9546 26.9320 79.9921 Constraint 97 463 14.3258 17.9072 26.8608 79.9921 Constraint 54 626 5.8571 7.3214 10.9820 79.9921 Constraint 43 626 7.1106 8.8883 13.3324 79.9921 Constraint 526 660 14.5282 18.1602 27.2403 79.8633 Constraint 263 660 11.2515 14.0644 21.0965 79.8633 Constraint 340 660 14.1978 17.7473 26.6209 79.8631 Constraint 197 517 10.4162 13.0202 19.5303 79.6189 Constraint 197 502 7.4747 9.3433 14.0150 79.6189 Constraint 280 584 15.9809 19.9761 29.9642 79.0615 Constraint 197 463 10.6083 13.2604 19.8906 79.0335 Constraint 117 329 10.8478 13.5597 20.3396 78.9934 Constraint 36 483 13.8229 17.2786 25.9179 78.9925 Constraint 36 463 10.6106 13.2632 19.8948 78.9925 Constraint 36 455 10.1308 12.6635 18.9953 78.9925 Constraint 36 434 12.4709 15.5886 23.3830 78.9925 Constraint 36 130 15.2181 19.0226 28.5339 78.9925 Constraint 36 263 15.5733 19.4666 29.1999 78.9924 Constraint 36 470 9.8310 12.2888 18.4332 78.9924 Constraint 117 434 13.9246 17.4058 26.1087 78.9921 Constraint 97 593 4.8366 6.0458 9.0687 78.9921 Constraint 470 660 12.6388 15.7985 23.6978 78.8631 Constraint 223 634 12.5420 15.6775 23.5162 78.8614 Constraint 197 512 9.9675 12.4594 18.6890 78.6189 Constraint 206 502 8.5618 10.7022 16.0533 78.6189 Constraint 189 626 12.9962 16.2453 24.3679 78.4525 Constraint 263 434 16.1550 20.1938 30.2907 78.2979 Constraint 212 483 8.7681 10.9601 16.4401 78.1197 Constraint 517 584 13.8130 17.2663 25.8995 78.0933 Constraint 319 512 15.5886 19.4858 29.2287 78.0421 Constraint 183 434 14.7346 18.4183 27.6274 77.9980 Constraint 97 642 13.4574 16.8218 25.2327 77.9924 Constraint 157 584 15.6073 19.5091 29.2637 77.9923 Constraint 54 634 4.3544 5.4429 8.1644 77.9923 Constraint 43 634 5.9034 7.3792 11.0688 77.9923 Constraint 97 369 15.6242 19.5302 29.2953 77.9921 Constraint 110 626 14.6843 18.3554 27.5331 77.9921 Constraint 130 470 15.3656 19.2070 28.8105 77.9921 Constraint 287 463 15.8126 19.7657 29.6486 77.9184 Constraint 212 642 13.1734 16.4667 24.7001 77.8672 Constraint 319 660 13.3248 16.6560 24.9840 77.8646 Constraint 517 601 15.6189 19.5236 29.2854 77.8628 Constraint 223 626 13.4482 16.8103 25.2154 77.8613 Constraint 212 533 13.1485 16.4356 24.6534 77.7406 Constraint 340 568 15.5723 19.4654 29.1981 77.4157 Constraint 358 470 15.1716 18.9645 28.4468 77.2918 Constraint 274 483 15.3231 19.1539 28.7309 77.1202 Constraint 206 517 11.1204 13.9004 20.8507 77.0335 Constraint 263 446 15.9966 19.9958 29.9936 76.9978 Constraint 68 274 16.0065 20.0081 30.0122 76.9978 Constraint 157 593 15.8079 19.7598 29.6397 76.9975 Constraint 36 319 13.8568 17.3210 25.9815 76.9937 Constraint 62 540 15.6676 19.5845 29.3768 76.9936 Constraint 36 601 15.2163 19.0204 28.5306 76.9926 Constraint 68 470 15.8228 19.7784 29.6677 76.9924 Constraint 68 533 15.4344 19.2930 28.9395 76.9922 Constraint 68 483 16.0461 20.0577 30.0865 76.9922 Constraint 117 626 13.4620 16.8275 25.2413 76.9921 Constraint 97 234 14.6930 18.3662 27.5493 76.9921 Constraint 97 626 9.8022 12.2527 18.3791 76.9921 Constraint 274 660 12.7814 15.9767 23.9651 76.8646 Constraint 206 383 14.0731 17.5914 26.3871 76.7411 Constraint 212 369 14.7402 18.4252 27.6378 76.7406 Constraint 189 634 13.4008 16.7510 25.1265 76.4527 Constraint 512 584 15.4297 19.2871 28.9306 76.0934 Constraint 324 418 16.1180 20.1475 30.2213 76.0403 Constraint 62 183 14.6610 18.3262 27.4893 75.9980 Constraint 212 491 8.8741 11.0927 16.6390 75.9978 Constraint 36 545 14.7285 18.4106 27.6160 75.9940 Constraint 36 234 11.6694 14.5867 21.8800 75.9924 Constraint 97 517 15.4076 19.2595 28.8892 75.9922 Constraint 117 255 13.5994 16.9993 25.4989 75.9921 Constraint 97 410 15.7641 19.7051 29.5576 75.9921 Constraint 369 559 16.1120 20.1400 30.2100 75.9921 Constraint 324 660 14.5911 18.2388 27.3582 75.8646 Constraint 223 660 11.9843 14.9804 22.4706 75.8631 Constraint 189 319 14.6103 18.2628 27.3942 75.7464 Constraint 206 374 13.5731 16.9664 25.4496 75.7408 Constraint 197 483 9.0883 11.3603 17.0405 75.4126 Constraint 491 615 16.1836 20.2294 30.3442 75.1923 Constraint 197 649 13.3804 16.7256 25.0883 75.1599 Constraint 206 483 9.8901 12.3627 18.5440 75.1199 Constraint 280 540 16.0034 20.0043 30.0064 75.0407 Constraint 197 418 14.2486 17.8107 26.7161 75.0335 Constraint 36 183 14.7533 18.4417 27.6625 74.9982 Constraint 78 502 15.2908 19.1135 28.6703 74.9980 Constraint 36 573 15.4815 19.3518 29.0278 74.9940 Constraint 358 545 16.0778 20.0973 30.1459 74.9189 Constraint 197 533 11.4594 14.3243 21.4864 74.7453 Constraint 206 455 12.8208 16.0260 24.0390 74.7408 Constraint 206 512 10.8429 13.5536 20.3305 74.6189 Constraint 319 470 15.7497 19.6871 29.5306 74.0419 Constraint 197 383 13.5637 16.9547 25.4320 74.0338 Constraint 54 568 15.5305 19.4131 29.1197 73.9995 Constraint 197 491 7.4806 9.3508 14.0261 73.9980 Constraint 455 584 14.8486 18.5607 27.8411 73.9927 Constraint 358 573 15.8965 19.8706 29.8060 73.9926 Constraint 43 287 15.5445 19.4306 29.1459 73.9924 Constraint 36 634 5.1330 6.4163 9.6244 73.9924 Constraint 36 626 8.6807 10.8508 16.2763 73.9924 Constraint 206 649 13.1357 16.4196 24.6295 73.8673 Constraint 189 559 13.1638 16.4547 24.6821 73.7451 Constraint 197 455 12.6469 15.8086 23.7129 73.0335 Constraint 197 374 12.9114 16.1392 24.2088 73.0335 Constraint 206 491 8.4726 10.5908 15.8862 72.9980 Constraint 157 601 15.5453 19.4316 29.1475 72.9979 Constraint 243 568 15.9383 19.9228 29.8842 72.9978 Constraint 183 660 11.8331 14.7914 22.1870 72.9978 Constraint 86 274 15.3520 19.1900 28.7850 72.9978 Constraint 68 295 15.4554 19.3193 28.9789 72.9978 Constraint 173 660 11.2767 14.0959 21.1439 72.9942 Constraint 165 660 11.9978 14.9972 22.4958 72.9942 Constraint 146 660 12.6622 15.8277 23.7415 72.9942 Constraint 97 634 13.7415 17.1768 25.7652 72.9923 Constraint 146 223 14.4266 18.0333 27.0499 72.9922 Constraint 287 634 16.1479 20.1848 30.2772 72.9450 Constraint 212 551 14.6417 18.3021 27.4531 72.6187 Constraint 212 540 14.5620 18.2025 27.3038 72.6187 Constraint 274 491 15.4253 19.2816 28.9225 72.2983 Constraint 54 263 16.2991 20.3739 30.5608 71.9981 Constraint 483 584 14.7822 18.4777 27.7166 71.9936 Constraint 110 434 14.0223 17.5279 26.2918 71.9921 Constraint 306 502 15.4468 19.3085 28.9628 71.9205 Constraint 306 649 16.3675 20.4594 30.6891 71.8673 Constraint 212 660 12.3593 15.4491 23.1737 71.8669 Constraint 62 517 15.7629 19.7036 29.5554 70.9993 Constraint 68 540 15.9234 19.9043 29.8564 70.9983 Constraint 117 263 14.1691 17.7114 26.5671 70.9960 Constraint 483 601 15.8340 19.7925 29.6888 70.9926 Constraint 212 634 13.6431 17.0539 25.5808 70.8672 Constraint 374 491 15.9143 19.8928 29.8393 70.2983 Constraint 54 157 16.2218 20.2772 30.4158 69.9981 Constraint 78 470 15.5434 19.4293 29.1439 69.9978 Constraint 157 660 13.5166 16.8958 25.3437 69.9955 Constraint 62 660 11.8393 14.7991 22.1986 69.9940 Constraint 62 502 15.7069 19.6337 29.4505 69.9936 Constraint 206 418 14.2236 17.7795 26.6692 69.7408 Constraint 206 533 12.5387 15.6733 23.5100 69.6189 Constraint 117 402 14.7503 18.4379 27.6568 68.9925 Constraint 110 545 14.2865 17.8581 26.7871 68.9924 Constraint 110 427 14.4716 18.0895 27.1342 68.9924 Constraint 189 660 12.1098 15.1373 22.7059 68.7051 Constraint 54 660 12.8287 16.0358 24.0537 67.9940 Constraint 43 660 9.1433 11.4291 17.1436 67.9940 Constraint 36 223 13.7166 17.1458 25.7187 67.9924 Constraint 306 410 16.2977 20.3721 30.5582 67.0410 Constraint 329 418 15.9999 19.9999 29.9998 67.0407 Constraint 78 183 15.1161 18.8951 28.3426 66.9980 Constraint 391 601 16.4415 20.5519 30.8278 66.9938 Constraint 255 584 15.5413 19.4266 29.1399 66.9928 Constraint 173 615 16.1479 20.1849 30.2773 66.9924 Constraint 274 615 16.2709 20.3386 30.5079 66.8674 Constraint 234 584 15.2872 19.1090 28.6635 65.9935 Constraint 43 593 16.2828 20.3535 30.5303 65.9925 Constraint 97 173 16.0040 20.0050 30.0076 65.9922 Constraint 97 502 15.9645 19.9556 29.9334 65.9921 Constraint 324 545 16.2262 20.2828 30.4242 65.9145 Constraint 206 427 14.6026 18.2533 27.3800 65.0339 Constraint 157 455 16.1363 20.1703 30.2555 64.9980 Constraint 78 660 15.5144 19.3930 29.0895 64.9955 Constraint 110 540 14.2352 17.7940 26.6910 64.9924 Constraint 97 512 15.9290 19.9112 29.8668 64.9921 Constraint 197 274 14.6165 18.2706 27.4059 64.6189 Constraint 197 642 14.3995 17.9994 26.9991 64.1601 Constraint 62 189 15.1575 18.9469 28.4203 63.9991 Constraint 263 568 15.9470 19.9337 29.9006 63.9981 Constraint 36 660 8.8689 11.0862 16.6292 63.9943 Constraint 502 660 14.9257 18.6572 27.9858 63.9942 Constraint 212 626 14.6142 18.2677 27.4016 63.8671 Constraint 206 545 13.8636 17.3295 25.9942 63.6194 Constraint 287 434 15.8747 19.8433 29.7650 63.6187 Constraint 391 568 16.0644 20.0805 30.1207 62.9994 Constraint 189 434 14.6959 18.3699 27.5548 62.9991 Constraint 25 649 6.0641 7.5802 11.3703 62.9981 Constraint 25 642 7.8665 9.8331 14.7497 62.9981 Constraint 25 410 9.3206 11.6507 17.4761 62.9981 Constraint 25 402 11.6684 14.5855 21.8782 62.9981 Constraint 25 391 9.4099 11.7623 17.6435 62.9981 Constraint 25 383 9.1814 11.4767 17.2150 62.9981 Constraint 25 374 11.2870 14.1088 21.1632 62.9981 Constraint 25 358 10.6290 13.2863 19.9294 62.9981 Constraint 25 350 11.6844 14.6054 21.9082 62.9981 Constraint 25 255 12.8347 16.0434 24.0651 62.9981 Constraint 25 243 13.1421 16.4277 24.6415 62.9981 Constraint 97 483 15.8804 19.8505 29.7757 62.9922 Constraint 110 274 15.1537 18.9421 28.4132 62.9922 Constraint 189 610 14.8132 18.5165 27.7747 62.7468 Constraint 197 545 12.7954 15.9942 23.9913 62.7453 Constraint 197 427 13.6862 17.1077 25.6616 62.6191 Constraint 197 369 14.0831 17.6038 26.4058 62.0348 Constraint 206 446 14.5002 18.1253 27.1879 62.0336 Constraint 54 559 16.1069 20.1337 30.2005 61.9986 Constraint 43 183 15.0543 18.8179 28.2269 61.9982 Constraint 25 470 13.0027 16.2534 24.3801 61.9982 Constraint 25 463 14.0331 17.5414 26.3121 61.9982 Constraint 25 455 14.0113 17.5142 26.2712 61.9982 Constraint 25 427 14.5700 18.2125 27.3188 61.9982 Constraint 25 418 11.4828 14.3534 21.5302 61.9982 Constraint 36 312 16.0137 20.0171 30.0256 61.9982 Constraint 86 234 16.2345 20.2931 30.4397 61.9921 Constraint 206 540 13.7844 17.2304 25.8457 61.8722 Constraint 206 551 14.6587 18.3234 27.4851 61.8721 Constraint 197 551 13.3928 16.7410 25.1115 61.7453 Constraint 223 434 15.1005 18.8756 28.3134 61.7349 Constraint 483 660 14.9257 18.6572 27.9858 61.1162 Constraint 25 615 13.2949 16.6186 24.9279 60.9983 Constraint 25 340 13.6476 17.0595 25.5893 60.9981 Constraint 54 533 16.2065 20.2581 30.3871 60.9928 Constraint 329 649 16.0114 20.0142 30.0214 60.8674 Constraint 189 287 15.6905 19.6132 29.4198 60.7464 Constraint 197 540 12.3702 15.4628 23.1942 60.7453 Constraint 280 568 16.3881 20.4851 30.7276 60.2923 Constraint 350 512 16.1115 20.1393 30.2090 60.0410 Constraint 287 512 15.7362 19.6703 29.5054 60.0405 Constraint 25 610 16.0043 20.0054 30.0080 59.9984 Constraint 25 369 13.5664 16.9580 25.4369 59.9981 Constraint 117 369 15.1862 18.9827 28.4740 59.9963 Constraint 97 243 15.9798 19.9747 29.9620 59.9922 Constraint 25 319 15.0850 18.8563 28.2844 58.9995 Constraint 25 146 15.6102 19.5127 29.2691 58.9982 Constraint 25 234 14.1099 17.6374 26.4561 58.9982 Constraint 43 223 15.4547 19.3184 28.9776 58.9924 Constraint 383 568 16.1697 20.2121 30.3182 57.9994 Constraint 86 369 16.0148 20.0185 30.0277 57.9978 Constraint 312 502 15.7762 19.7202 29.5803 57.9205 Constraint 512 615 16.0467 20.0584 30.0876 57.8685 Constraint 369 512 16.2530 20.3163 30.4744 57.0405 Constraint 36 189 14.4556 18.0694 27.1042 56.9995 Constraint 43 189 15.3885 19.2356 28.8534 56.9995 Constraint 25 434 16.0208 20.0260 30.0391 56.9984 Constraint 36 212 14.0092 17.5115 26.2673 56.9982 Constraint 197 626 15.5416 19.4270 29.1405 56.1601 Constraint 280 483 15.7260 19.6576 29.4863 56.1202 Constraint 17 649 5.8775 7.3469 11.0204 55.9982 Constraint 17 642 8.8915 11.1144 16.6716 55.9982 Constraint 17 402 11.9765 14.9707 22.4560 55.9982 Constraint 17 391 8.7275 10.9093 16.3640 55.9982 Constraint 17 383 9.2391 11.5489 17.3233 55.9982 Constraint 17 374 10.2393 12.7991 19.1986 55.9982 Constraint 17 358 10.8609 13.5762 20.3642 55.9982 Constraint 17 350 12.6851 15.8564 23.7846 55.9982 Constraint 25 634 8.8448 11.0560 16.5840 55.9982 Constraint 25 626 11.5460 14.4325 21.6487 55.9982 Constraint 183 306 15.4769 19.3462 29.0192 54.9986 Constraint 189 568 13.9855 17.4819 26.2228 54.9983 Constraint 17 470 12.5003 15.6254 23.4380 54.9983 Constraint 17 418 12.5553 15.6941 23.5412 54.9983 Constraint 17 410 9.5627 11.9533 17.9300 54.9983 Constraint 117 383 15.6122 19.5152 29.2729 54.9963 Constraint 197 446 13.5023 16.8778 25.3167 54.7455 Constraint 197 634 15.2066 19.0083 28.5124 54.1600 Constraint 280 512 15.8250 19.7813 29.6719 54.0407 Constraint 17 615 15.3365 19.1706 28.7559 53.9984 Constraint 25 165 15.7462 19.6827 29.5241 53.9982 Constraint 17 255 12.6257 15.7821 23.6732 53.9982 Constraint 17 243 12.0037 15.0046 22.5069 53.9982 Constraint 183 615 15.2438 19.0548 28.5821 53.9982 Constraint 36 324 16.0887 20.1109 30.1663 53.9981 Constraint 551 660 15.4796 19.3495 29.0242 53.9955 Constraint 17 463 14.0828 17.6035 26.4052 52.9983 Constraint 17 455 14.4151 18.0189 27.0284 52.9983 Constraint 17 369 12.9578 16.1972 24.2958 52.9982 Constraint 68 263 16.2507 20.3133 30.4700 52.9978 Constraint 117 358 15.4589 19.3237 28.9855 52.9963 Constraint 68 660 15.9302 19.9128 29.8692 52.9955 Constraint 206 660 12.4116 15.5144 23.2717 52.8673 Constraint 374 667 8.2193 10.2741 15.4111 52.8654 Constraint 369 667 11.3654 14.2068 21.3102 52.8654 Constraint 358 667 10.0186 12.5233 18.7849 52.8654 Constraint 243 667 10.9306 13.6633 20.4950 52.8653 Constraint 324 463 16.1122 20.1402 30.2103 52.0417 Constraint 369 573 16.2770 20.3462 30.5194 51.9997 Constraint 183 324 16.0017 20.0022 30.0033 51.9996 Constraint 25 280 15.3672 19.2091 28.8136 51.9984 Constraint 117 512 14.8917 18.6146 27.9219 51.9945 Constraint 255 667 11.8587 14.8233 22.2350 51.8654 Constraint 391 667 8.7501 10.9377 16.4065 51.8653 Constraint 383 667 9.0899 11.3624 17.0435 51.8653 Constraint 295 533 15.5900 19.4875 29.2312 51.0405 Constraint 130 660 15.2970 19.1213 28.6820 50.9957 Constraint 280 470 16.4490 20.5612 30.8418 50.9188 Constraint 206 642 14.0982 17.6228 26.4342 50.8676 Constraint 410 667 11.4140 14.2675 21.4013 50.8653 Constraint 402 667 12.2646 15.3308 22.9961 50.8653 Constraint 212 358 15.3017 19.1271 28.6907 50.7406 Constraint 197 660 12.8516 16.0645 24.0967 50.4128 Constraint 358 483 15.9065 19.8831 29.8247 50.1202 Constraint 295 559 15.8096 19.7621 29.6431 50.0408 Constraint 17 427 15.4263 19.2829 28.9243 49.9983 Constraint 17 234 13.5543 16.9429 25.4143 49.9983 Constraint 43 295 16.0887 20.1109 30.1663 49.9928 Constraint 110 255 15.5800 19.4750 29.2125 49.9924 Constraint 350 667 12.5099 15.6374 23.4561 49.8654 Constraint 418 667 14.4639 18.0799 27.1199 49.8653 Constraint 234 667 13.3690 16.7113 25.0670 49.8653 Constraint 369 491 16.2837 20.3546 30.5319 49.2996 Constraint 223 559 15.6815 19.6019 29.4029 48.9985 Constraint 17 634 10.3188 12.8984 19.3477 48.9983 Constraint 17 626 12.9154 16.1442 24.2164 48.9983 Constraint 17 340 15.1431 18.9288 28.3933 48.9983 Constraint 25 660 7.9544 9.9430 14.9144 48.9981 Constraint 280 667 14.4911 18.1139 27.1709 48.8654 Constraint 502 584 16.0756 20.0945 30.1418 47.9999 Constraint 189 573 13.8787 17.3483 26.0225 47.9996 Constraint 410 584 14.8465 18.5581 27.8372 47.9993 Constraint 183 312 15.9169 19.8962 29.8443 46.9982 Constraint 78 512 16.0385 20.0481 30.0721 46.9980 Constraint 117 642 15.6015 19.5018 29.2527 46.9965 Constraint 117 234 15.1744 18.9680 28.4519 46.9963 Constraint 263 667 13.7740 17.2175 25.8263 46.8654 Constraint 197 559 14.3714 17.9643 26.9464 46.7455 Constraint 374 517 16.0731 20.0913 30.1370 46.7408 Constraint 350 491 16.2586 20.3233 30.4849 46.2996 Constraint 358 455 16.2679 20.3349 30.5024 46.2981 Constraint 17 183 14.5744 18.2180 27.3271 45.9985 Constraint 287 660 15.5080 19.3850 29.0775 45.9955 Constraint 97 391 16.2019 20.2524 30.3786 45.9924 Constraint 463 667 14.6781 18.3477 27.5215 45.8653 Constraint 410 593 16.0148 20.0186 30.0278 45.0614 Constraint 78 189 15.6558 19.5697 29.3546 44.9996 Constraint 54 287 16.2777 20.3471 30.5207 44.9986 Constraint 17 660 6.8687 8.5858 12.8787 44.9982 Constraint 287 649 16.4515 20.5644 30.8466 44.8682 Constraint 340 455 16.0355 20.0444 30.0666 44.4212 Constraint 274 470 16.3344 20.4180 30.6271 44.0407 Constraint 329 533 16.1750 20.2187 30.3281 44.0366 Constraint 54 517 16.1419 20.1774 30.2661 43.9999 Constraint 54 183 15.7024 19.6280 29.4420 43.9982 Constraint 212 350 15.3851 19.2313 28.8470 43.7422 Constraint 17 165 15.1050 18.8813 28.3219 42.9985 Constraint 206 634 14.4904 18.1130 27.1695 42.8679 Constraint 319 667 15.4017 19.2521 28.8781 42.8668 Constraint 206 369 14.0474 17.5592 26.3388 42.7424 Constraint 25 446 16.0026 20.0033 30.0049 41.9998 Constraint 25 223 15.5331 19.4164 29.1245 41.9995 Constraint 17 263 15.1877 18.9846 28.4769 41.9985 Constraint 17 223 13.8538 17.3172 25.9758 41.9983 Constraint 25 183 15.9340 19.9175 29.8762 41.9983 Constraint 173 667 13.8555 17.3194 25.9791 41.9963 Constraint 234 329 16.2067 20.2584 30.3875 41.0367 Constraint 17 146 15.5356 19.4195 29.1293 40.9998 Constraint 17 319 15.5085 19.3856 29.0784 40.9996 Constraint 110 526 15.3711 19.2139 28.8208 40.9926 Constraint 512 649 16.0089 20.0111 30.0166 40.8683 Constraint 455 593 15.7101 19.6376 29.4564 40.0617 Constraint 43 584 15.7472 19.6840 29.5259 39.9999 Constraint 189 615 15.4576 19.3220 28.9830 39.9999 Constraint 62 667 13.8911 17.3639 26.0459 39.9962 Constraint 43 667 10.6207 13.2759 19.9139 39.9962 Constraint 234 593 15.9982 19.9977 29.9966 39.0673 Constraint 117 502 14.7460 18.4325 27.6488 38.9983 Constraint 54 667 14.3655 17.9569 26.9353 38.9962 Constraint 183 667 14.0875 17.6094 26.4140 37.9982 Constraint 36 667 10.1937 12.7421 19.1132 37.9964 Constraint 146 667 15.0695 18.8368 28.2552 37.9963 Constraint 223 667 12.5022 15.6278 23.4417 37.8653 Constraint 391 673 10.9583 13.6979 20.5468 37.5791 Constraint 383 673 10.6538 13.3173 19.9759 37.5791 Constraint 374 673 9.3850 11.7312 17.5968 37.5791 Constraint 243 673 12.4332 15.5415 23.3123 37.5791 Constraint 329 410 16.2779 20.3474 30.5211 37.4212 Constraint 319 491 16.2267 20.2833 30.4250 37.2996 Constraint 36 502 16.3406 20.4257 30.6386 36.9995 Constraint 17 173 15.0183 18.7729 28.1593 36.9985 Constraint 212 667 12.0736 15.0920 22.6381 36.8672 Constraint 369 673 11.7695 14.7119 22.0679 36.5791 Constraint 358 673 10.6223 13.2779 19.9168 36.5791 Constraint 255 673 13.1181 16.3976 24.5964 36.5791 Constraint 295 601 15.9559 19.9449 29.9174 36.4198 Constraint 36 517 15.9542 19.9427 29.9140 35.9999 Constraint 17 280 14.9544 18.6930 28.0396 34.9998 Constraint 17 212 13.3678 16.7098 25.0647 34.9986 Constraint 197 568 15.1453 18.9316 28.3974 34.9983 Constraint 274 667 14.8223 18.5279 27.7919 34.9978 Constraint 165 667 14.3340 17.9175 26.8763 34.9963 Constraint 533 660 15.9042 19.8802 29.8203 34.9959 Constraint 206 626 15.0551 18.8188 28.2282 34.8689 Constraint 540 649 16.2923 20.3654 30.5480 34.8685 Constraint 263 673 14.6507 18.3133 27.4700 34.5792 Constraint 295 593 15.6965 19.6206 29.4309 34.1673 Constraint 483 593 16.3362 20.4202 30.6303 34.1144 Constraint 491 584 16.3253 20.4066 30.6099 33.9941 Constraint 470 667 13.2954 16.6193 24.9289 33.8654 Constraint 410 673 13.4557 16.8197 25.2295 33.5791 Constraint 402 673 13.9560 17.4450 26.1676 33.5791 Constraint 280 517 15.6960 19.6201 29.4301 33.0408 Constraint 383 584 15.8428 19.8035 29.7053 32.9999 Constraint 295 660 15.7159 19.6449 29.4673 32.9996 Constraint 306 660 15.4110 19.2637 28.8956 32.9996 Constraint 212 434 15.5440 19.4300 29.1451 32.9995 Constraint 54 173 16.5566 20.6958 31.0437 32.9986 Constraint 25 667 8.2995 10.3744 15.5616 32.9983 Constraint 189 667 12.4092 15.5115 23.2673 32.7055 Constraint 223 319 15.7563 19.6954 29.5431 32.6204 Constraint 312 483 16.3712 20.4640 30.6961 32.1215 Constraint 329 660 15.7904 19.7380 29.6070 32.1214 Constraint 329 526 15.7929 19.7411 29.6116 32.0424 Constraint 329 545 15.9286 19.9108 29.8662 32.0366 Constraint 197 358 14.8386 18.5483 27.8225 32.0351 Constraint 62 223 15.2691 19.0864 28.6295 31.9994 Constraint 197 434 15.5379 19.4224 29.1336 31.9983 Constraint 43 212 15.3258 19.1572 28.7358 31.9982 Constraint 86 263 16.1186 20.1482 30.2224 31.9979 Constraint 340 667 14.9506 18.6882 28.0323 31.8669 Constraint 455 667 15.0167 18.7708 28.1562 31.8666 Constraint 369 517 16.2083 20.2603 30.3905 31.7421 Constraint 234 673 15.0719 18.8398 28.2597 31.5791 Constraint 25 324 16.2108 20.2636 30.3953 30.9996 Constraint 36 329 15.6427 19.5534 29.3301 30.9986 Constraint 130 223 15.6773 19.5966 29.3949 30.9982 Constraint 117 243 15.6426 19.5532 29.3298 30.9982 Constraint 110 402 15.6578 19.5723 29.3585 30.9926 Constraint 223 610 15.3068 19.1334 28.7002 30.7456 Constraint 183 340 15.8005 19.7506 29.6259 29.9996 Constraint 25 263 15.6214 19.5267 29.2901 29.9984 Constraint 17 667 8.2697 10.3371 15.5056 29.9984 Constraint 173 673 15.1933 18.9916 28.4874 29.9983 Constraint 117 463 14.8740 18.5925 27.8887 29.9983 Constraint 157 667 15.7202 19.6502 29.4753 29.9977 Constraint 206 358 14.6052 18.2565 27.3847 29.7424 Constraint 350 673 13.1870 16.4838 24.7257 29.5794 Constraint 329 568 16.2737 20.3421 30.5132 29.4160 Constraint 374 512 15.8716 19.8396 29.7593 29.0405 Constraint 295 391 16.0850 20.1063 30.1594 29.0363 Constraint 9 391 10.9037 13.6296 20.4444 28.9997 Constraint 9 383 9.8048 12.2560 18.3839 28.9997 Constraint 9 374 10.7496 13.4370 20.1555 28.9997 Constraint 9 358 10.1439 12.6799 19.0199 28.9997 Constraint 197 573 16.0903 20.1128 30.1692 28.9986 Constraint 97 183 15.8594 19.8243 29.7364 28.9983 Constraint 25 212 14.6026 18.2532 27.3798 28.9982 Constraint 206 667 12.3608 15.4510 23.1765 28.8676 Constraint 223 615 14.9362 18.6703 28.0055 28.8674 Constraint 197 350 15.6456 19.5570 29.3355 28.0353 Constraint 17 483 15.5141 19.3927 29.0890 27.9999 Constraint 9 649 8.0402 10.0503 15.0754 27.9998 Constraint 9 642 9.4475 11.8093 17.7140 27.9998 Constraint 9 418 13.9894 17.4868 26.2302 27.9998 Constraint 9 410 11.5509 14.4387 21.6580 27.9998 Constraint 9 402 13.3361 16.6702 25.0052 27.9998 Constraint 9 350 11.9355 14.9194 22.3791 27.9998 Constraint 9 255 13.2398 16.5498 24.8247 27.9998 Constraint 36 157 16.5516 20.6895 31.0342 27.9997 Constraint 312 660 15.9744 19.9680 29.9520 27.9995 Constraint 110 263 15.9262 19.9078 29.8617 27.9985 Constraint 223 568 15.6876 19.6095 29.4143 27.9984 Constraint 274 568 16.1396 20.1745 30.2617 27.9982 Constraint 117 446 14.1994 17.7493 26.6239 27.9945 Constraint 280 673 14.4307 18.0383 27.0575 27.5793 Constraint 391 680 11.6974 14.6217 21.9325 27.0982 Constraint 243 680 13.3281 16.6601 24.9902 27.0982 Constraint 25 526 16.1975 20.2469 30.3703 26.9998 Constraint 54 189 15.7228 19.6535 29.4803 26.9998 Constraint 9 369 12.8275 16.0344 24.0516 26.9997 Constraint 206 559 14.9997 18.7496 28.1244 26.8735 Constraint 374 680 10.4095 13.0119 19.5179 26.0983 Constraint 9 243 13.4417 16.8021 25.2031 25.9998 Constraint 43 673 11.8739 14.8423 22.2635 25.9985 Constraint 36 673 12.0728 15.0910 22.6365 25.9985 Constraint 117 517 13.9074 17.3843 26.0764 25.9945 Constraint 383 680 11.3142 14.1427 21.2141 25.8055 Constraint 324 667 15.3352 19.1691 28.7536 25.1197 Constraint 9 470 14.5583 18.1979 27.2968 24.9999 Constraint 212 559 15.3518 19.1897 28.7846 24.9998 Constraint 25 173 15.9378 19.9222 29.8834 24.9998 Constraint 358 559 16.3889 20.4861 30.7292 24.9986 Constraint 110 446 15.2905 19.1132 28.6698 24.9984 Constraint 446 660 15.5812 19.4766 29.2148 24.9946 Constraint 287 410 16.2362 20.2953 30.4429 24.9190 Constraint 526 667 15.6885 19.6106 29.4159 24.8668 Constraint 287 517 16.2426 20.3032 30.4548 24.6187 Constraint 312 517 15.7907 19.7383 29.6075 24.0424 Constraint 9 634 11.2244 14.0305 21.0458 23.9999 Constraint 9 626 13.3866 16.7333 25.0999 23.9999 Constraint 545 660 15.8693 19.8366 29.7549 23.9960 Constraint 97 455 15.4655 19.3319 28.9978 23.9926 Constraint 324 502 15.4912 19.3640 29.0460 23.9203 Constraint 383 593 16.3815 20.4769 30.7153 23.8673 Constraint 197 667 12.5827 15.7284 23.5926 23.4144 Constraint 340 483 16.1038 20.1297 30.1946 23.1215 Constraint 54 540 16.3038 20.3797 30.5696 23.0000 Constraint 9 340 13.0651 16.3313 24.4970 22.9999 Constraint 62 212 16.0087 20.0108 30.0162 22.9998 Constraint 43 533 16.2846 20.3557 30.5336 22.9986 Constraint 62 673 14.7521 18.4402 27.6603 22.9985 Constraint 427 667 15.5884 19.4855 29.2282 22.8668 Constraint 358 680 10.8049 13.5061 20.2592 22.8056 Constraint 255 680 13.4376 16.7971 25.1956 22.8056 Constraint 189 306 15.9628 19.9535 29.9302 22.7472 Constraint 280 491 16.2858 20.3572 30.5358 22.2983 Constraint 36 206 14.2668 17.8336 26.7503 21.9998 Constraint 17 673 10.6024 13.2530 19.8795 21.9985 Constraint 117 418 15.2052 19.0065 28.5097 21.9984 Constraint 491 660 15.1693 18.9617 28.4425 21.9960 Constraint 274 673 15.0641 18.8301 28.2451 21.5809 Constraint 295 573 15.3943 19.2428 28.8642 21.4202 Constraint 369 680 11.7816 14.7269 22.0904 21.0983 Constraint 9 615 14.7456 18.4320 27.6480 21.0000 Constraint 54 274 16.3993 20.4991 30.7486 20.9999 Constraint 9 263 15.8980 19.8725 29.8087 20.9999 Constraint 470 584 16.2419 20.3024 30.4535 20.9999 Constraint 9 319 14.6344 18.2930 27.4396 20.9999 Constraint 9 660 9.1170 11.3963 17.0944 20.9997 Constraint 25 673 9.9755 12.4694 18.7040 20.9985 Constraint 78 491 16.4774 20.5968 30.8952 20.9983 Constraint 54 223 14.8033 18.5042 27.7562 20.9982 Constraint 110 512 15.8793 19.8491 29.7737 20.9967 Constraint 340 502 15.8692 19.8365 29.7547 20.9208 Constraint 502 667 16.1297 20.1622 30.2433 20.7436 Constraint 206 350 14.5196 18.1495 27.2243 20.7426 Constraint 206 280 15.6699 19.5874 29.3812 20.7426 Constraint 340 540 15.6232 19.5290 29.2935 20.4218 Constraint 340 470 16.0898 20.1123 30.1684 20.1218 Constraint 306 512 15.9462 19.9327 29.8990 20.0427 Constraint 17 189 13.7594 17.1992 25.7988 19.9999 Constraint 9 165 16.2698 20.3372 30.5058 19.9999 Constraint 212 568 15.7483 19.6854 29.5281 19.9998 Constraint 9 234 15.1301 18.9126 28.3689 19.9998 Constraint 274 601 16.4009 20.5012 30.7518 19.9997 Constraint 183 673 15.6881 19.6101 29.4152 19.9985 Constraint 36 680 12.2948 15.3685 23.0527 19.9985 Constraint 117 483 14.9152 18.6441 27.9661 19.9983 Constraint 197 280 15.3168 19.1459 28.7189 19.6207 Constraint 512 593 15.8288 19.7860 29.6790 19.1686 Constraint 295 584 15.2216 19.0270 28.5406 19.1676 Constraint 9 463 15.6197 19.5246 29.2869 18.9999 Constraint 9 280 14.1854 17.7318 26.5977 18.9999 Constraint 17 274 16.0687 20.0859 30.1289 18.9998 Constraint 25 483 16.2950 20.3687 30.5531 18.9998 Constraint 223 573 15.4691 19.3364 29.0046 18.9985 Constraint 189 324 15.9232 19.9040 29.8560 18.7470 Constraint 287 418 16.1309 20.1636 30.2453 18.6193 Constraint 312 512 16.0050 20.0062 30.0093 18.0427 Constraint 206 434 15.6474 19.5593 29.3389 18.0355 Constraint 17 526 15.1288 18.9109 28.3664 17.9999 Constraint 9 324 15.0523 18.8154 28.2231 17.9999 Constraint 173 329 16.1612 20.2015 30.3023 17.9997 Constraint 43 680 11.7908 14.7385 22.1078 17.9985 Constraint 212 673 14.9725 18.7156 28.0735 17.8721 Constraint 280 680 14.5212 18.1515 27.2272 17.8056 Constraint 319 673 14.7545 18.4431 27.6647 17.5806 Constraint 329 463 16.3988 20.4985 30.7477 17.0425 Constraint 206 568 15.4026 19.2533 28.8800 17.0000 Constraint 68 517 16.2738 20.3423 30.5134 16.9999 Constraint 9 427 15.7003 19.6254 29.4381 16.9999 Constraint 9 146 15.1723 18.9653 28.4480 16.9999 Constraint 36 197 15.4809 19.3511 29.0267 16.9998 Constraint 25 189 14.1365 17.6707 26.5060 16.9998 Constraint 117 634 15.4746 19.3433 29.0149 16.9996 Constraint 25 329 15.8682 19.8353 29.7529 16.9986 Constraint 17 680 11.6485 14.5606 21.8409 16.9985 Constraint 117 491 15.1856 18.9821 28.4731 16.9983 Constraint 189 673 14.0433 17.5541 26.3311 16.8734 Constraint 223 673 14.2548 17.8185 26.7277 16.8734 Constraint 410 680 11.7714 14.7142 22.0714 16.8055 Constraint 340 673 14.4594 18.0743 27.1114 16.5808 Constraint 434 660 16.2409 20.3012 30.4517 16.1178 Constraint 517 660 15.7229 19.6536 29.4804 15.9999 Constraint 212 573 15.9828 19.9786 29.9678 15.9998 Constraint 110 234 16.3430 20.4288 30.6432 15.9987 Constraint 25 680 10.9389 13.6736 20.5105 15.9985 Constraint 110 517 15.8466 19.8083 29.7124 15.9980 Constraint 350 680 13.2152 16.5190 24.7786 15.8059 Constraint 470 673 14.5471 18.1839 27.2758 15.5804 Constraint 263 680 14.2500 17.8124 26.7187 15.0983 Constraint 295 526 15.1194 18.8993 28.3489 15.0421 Constraint 25 130 16.4861 20.6077 30.9115 15.0000 Constraint 9 274 16.4299 20.5373 30.8060 15.0000 Constraint 391 584 16.4835 20.6044 30.9066 15.0000 Constraint 189 584 16.5628 20.7035 31.0553 15.0000 Constraint 17 197 15.2172 19.0215 28.5322 14.9999 Constraint 243 601 16.6802 20.8502 31.2753 14.9999 Constraint 9 329 15.6916 19.6145 29.4217 14.9999 Constraint 146 673 15.3481 19.1851 28.7777 14.9997 Constraint 483 667 15.9579 19.9474 29.9211 14.9996 Constraint 189 680 14.7976 18.4970 27.7455 14.9986 Constraint 54 673 14.9353 18.6691 28.0036 14.9986 Constraint 173 680 15.0690 18.8363 28.2544 14.9983 Constraint 274 434 15.6337 19.5422 29.3132 14.9981 Constraint 463 680 14.4986 18.1232 27.1848 14.8055 Constraint 402 680 12.0903 15.1128 22.6692 14.8055 Constraint 234 680 13.7759 17.2199 25.8298 14.8055 Constraint 9 610 16.2968 20.3710 30.5565 14.0000 Constraint 43 502 16.5272 20.6590 30.9885 13.9999 Constraint 9 183 16.4472 20.5590 30.8386 13.9999 Constraint 165 673 15.6106 19.5132 29.2698 13.9997 Constraint 391 691 13.6708 17.0885 25.6328 13.9991 Constraint 374 691 11.7503 14.6879 22.0318 13.9991 Constraint 36 533 16.4742 20.5928 30.8892 13.9987 Constraint 110 463 16.4035 20.5044 30.7565 13.9986 Constraint 54 212 15.8638 19.8298 29.7447 13.9985 Constraint 383 691 13.0645 16.3306 24.4960 13.7064 Constraint 358 691 12.6110 15.7638 23.6457 13.7064 Constraint 324 673 14.4724 18.0906 27.1358 13.5809 Constraint 418 673 13.7082 17.1352 25.7028 13.5805 Constraint 280 446 15.5756 19.4695 29.2043 13.2984 Constraint 36 584 16.0512 20.0640 30.0960 13.0000 Constraint 36 274 16.5122 20.6403 30.9604 12.9998 Constraint 470 680 13.6345 17.0432 25.5648 12.9996 Constraint 369 691 13.5272 16.9090 25.3635 12.9991 Constraint 223 680 13.8473 17.3091 25.9637 12.9985 Constraint 62 680 13.9286 17.4108 26.1162 12.9985 Constraint 54 680 14.2065 17.7582 26.6373 12.9985 Constraint 78 223 15.5793 19.4741 29.2112 12.9982 Constraint 295 502 16.1810 20.2263 30.3394 12.9206 Constraint 206 673 13.9622 17.4527 26.1790 12.8735 Constraint 295 427 15.0625 18.8281 28.2421 12.4202 Constraint 502 593 16.0689 20.0861 30.1291 12.0470 Constraint 502 601 16.2478 20.3098 30.4647 12.0000 Constraint 3 649 9.9208 12.4009 18.6014 11.9999 Constraint 3 642 11.2090 14.0113 21.0169 11.9999 Constraint 3 634 13.5468 16.9335 25.4002 11.9999 Constraint 3 410 13.6433 17.0542 25.5813 11.9999 Constraint 3 391 12.4062 15.5078 23.2617 11.9999 Constraint 3 383 11.0299 13.7874 20.6811 11.9999 Constraint 3 374 11.0896 13.8620 20.7929 11.9999 Constraint 3 369 13.2975 16.6219 24.9328 11.9999 Constraint 3 358 10.4923 13.1154 19.6730 11.9999 Constraint 3 350 13.2935 16.6169 24.9253 11.9999 Constraint 3 255 14.3163 17.8953 26.8430 11.9999 Constraint 212 615 15.8965 19.8707 29.8060 11.9998 Constraint 189 340 15.9925 19.9906 29.9859 11.9998 Constraint 117 455 16.2463 20.3078 30.4617 11.9984 Constraint 358 446 15.6713 19.5891 29.3836 11.9984 Constraint 165 680 15.1337 18.9171 28.3757 11.9983 Constraint 324 680 15.8520 19.8149 29.7224 11.8069 Constraint 197 610 16.0313 20.0391 30.0586 11.7473 Constraint 189 312 16.0195 20.0243 30.0365 11.7472 Constraint 287 483 16.2103 20.2628 30.3943 11.1203 Constraint 306 517 15.7152 19.6440 29.4660 11.0427 Constraint 117 189 14.9132 18.6415 27.9622 11.0000 Constraint 9 455 15.0256 18.7821 28.1731 10.9999 Constraint 17 446 15.1870 18.9838 28.4757 10.9998 Constraint 17 206 13.2126 16.5157 24.7735 10.9995 Constraint 306 446 15.4959 19.3699 29.0548 10.9987 Constraint 212 680 14.5281 18.1601 27.2401 10.9985 Constraint 146 680 15.3096 19.1370 28.7055 10.9983 Constraint 212 319 16.0056 20.0071 30.0106 10.8736 Constraint 319 680 15.0870 18.8587 28.2881 10.8069 Constraint 418 680 12.6931 15.8664 23.7995 10.8068 Constraint 340 680 14.6248 18.2810 27.4215 10.8059 Constraint 340 517 15.2271 19.0339 28.5509 10.7427 Constraint 350 691 15.2082 19.0102 28.5153 10.7064 Constraint 255 691 14.8040 18.5050 27.7575 10.7064 Constraint 312 455 16.4410 20.5513 30.8269 10.2984 Constraint 212 610 15.6043 19.5054 29.2581 10.0000 Constraint 3 418 15.5851 19.4813 29.2220 9.9999 Constraint 3 402 14.7453 18.4316 27.6474 9.9999 Constraint 3 243 14.0543 17.5679 26.3518 9.9999 Constraint 9 189 14.5044 18.1305 27.1958 9.9999 Constraint 223 340 16.2738 20.3423 30.5134 9.9998 Constraint 25 206 13.3250 16.6562 24.9843 9.9998 Constraint 43 691 12.9210 16.1512 24.2268 9.9991 Constraint 36 691 13.5051 16.8814 25.3221 9.9991 Constraint 110 642 16.1600 20.2000 30.3000 9.9986 Constraint 197 673 13.4550 16.8187 25.2281 9.8735 Constraint 274 680 15.0908 18.8635 28.2952 9.8059 Constraint 463 673 13.9300 17.4125 26.1187 9.5805 Constraint 295 615 15.4674 19.3342 29.0014 9.4201 Constraint 274 593 16.6463 20.8079 31.2119 9.1218 Constraint 559 649 16.4698 20.5872 30.8808 9.1217 Constraint 263 601 16.4865 20.6081 30.9122 9.0000 Constraint 3 660 7.7246 9.6557 14.4836 8.9999 Constraint 25 274 16.4172 20.5215 30.7822 8.9999 Constraint 36 491 16.2298 20.2872 30.4308 8.9999 Constraint 97 189 16.2504 20.3129 30.4694 8.9999 Constraint 25 197 15.0570 18.8213 28.2320 8.9998 Constraint 43 206 14.9159 18.6449 27.9673 8.9998 Constraint 117 410 16.1396 20.1745 30.2617 8.9997 Constraint 110 418 16.0321 20.0401 30.0601 8.9987 Constraint 374 559 16.4894 20.6118 30.9177 8.9986 Constraint 374 446 15.6558 19.5698 29.3547 8.9983 Constraint 86 173 15.7524 19.6905 29.5358 8.9983 Constraint 206 319 15.4922 19.3653 29.0479 8.8735 Constraint 427 673 14.7399 18.4249 27.6373 8.5805 Constraint 206 615 15.4758 19.3447 29.0171 8.2881 Constraint 358 517 16.0064 20.0080 30.0120 8.1215 Constraint 54 502 16.5286 20.6607 30.9910 8.0000 Constraint 3 626 14.4019 18.0024 27.0036 8.0000 Constraint 3 340 13.4802 16.8502 25.2753 8.0000 Constraint 3 319 15.5590 19.4487 29.1731 8.0000 Constraint 3 280 14.9018 18.6272 27.9408 7.9999 Constraint 374 573 16.5448 20.6810 31.0216 7.9999 Constraint 68 223 15.8571 19.8214 29.7321 7.9998 Constraint 17 324 14.8513 18.5642 27.8463 7.9998 Constraint 17 434 15.4596 19.3245 28.9868 7.9998 Constraint 97 649 16.4865 20.6081 30.9121 7.9998 Constraint 78 667 15.4717 19.3396 29.0094 7.9997 Constraint 17 691 12.3368 15.4210 23.1314 7.9991 Constraint 25 691 11.5763 14.4703 21.7055 7.9991 Constraint 183 680 14.1027 17.6284 26.4426 7.9987 Constraint 110 634 15.8666 19.8332 29.7498 7.9985 Constraint 97 491 16.2694 20.3367 30.5050 7.9984 Constraint 526 680 15.0887 18.8608 28.2912 7.8070 Constraint 427 680 14.5362 18.1703 27.2554 7.8069 Constraint 197 319 15.0659 18.8324 28.2486 7.6208 Constraint 295 673 15.3083 19.1353 28.7030 7.5809 Constraint 287 673 15.7856 19.7320 29.5981 7.5809 Constraint 157 673 15.5947 19.4934 29.2401 7.0000 Constraint 130 212 15.5414 19.4267 29.1400 7.0000 Constraint 9 130 16.5803 20.7253 31.0880 7.0000 Constraint 206 680 15.2536 19.0670 28.6005 6.9999 Constraint 197 680 15.7469 19.6837 29.5255 6.9999 Constraint 62 491 16.1815 20.2269 30.3404 6.9999 Constraint 17 610 15.9090 19.8862 29.8293 6.9999 Constraint 9 173 16.1228 20.1535 30.2302 6.9999 Constraint 97 374 16.5957 20.7446 31.1169 6.9999 Constraint 68 667 15.4951 19.3688 29.0532 6.9999 Constraint 263 691 15.3459 19.1824 28.7736 6.9991 Constraint 243 691 12.6670 15.8337 23.7505 6.9991 Constraint 110 502 16.0766 20.0957 30.1436 6.9987 Constraint 86 455 15.7738 19.7173 29.5759 6.9984 Constraint 86 243 15.6034 19.5043 29.2565 6.9984 Constraint 446 667 15.4524 19.3155 28.9732 6.8689 Constraint 197 287 15.5045 19.3806 29.0709 6.7472 Constraint 455 673 14.6282 18.2853 27.4279 6.5808 Constraint 295 568 15.7474 19.6843 29.5265 6.4216 Constraint 295 634 16.1923 20.2404 30.3606 6.3215 Constraint 295 434 14.5215 18.1518 27.2277 6.2984 Constraint 329 667 15.0890 18.8613 28.2920 6.1219 Constraint 263 584 15.2764 19.0955 28.6433 6.0000 Constraint 369 601 16.5143 20.6429 30.9644 6.0000 Constraint 25 601 16.1385 20.1732 30.2597 6.0000 Constraint 68 189 15.3558 19.1947 28.7921 6.0000 Constraint 3 615 15.9415 19.9268 29.8902 6.0000 Constraint 3 324 15.2560 19.0700 28.6050 6.0000 Constraint 512 601 16.0351 20.0439 30.0658 6.0000 Constraint 3 470 15.2334 19.0417 28.5626 5.9999 Constraint 17 551 15.7050 19.6312 29.4469 5.9999 Constraint 17 545 15.5016 19.3770 29.0655 5.9999 Constraint 62 206 14.8121 18.5151 27.7727 5.9999 Constraint 117 374 16.4013 20.5017 30.7525 5.9999 Constraint 9 667 10.0524 12.5655 18.8483 5.9999 Constraint 86 183 15.3473 19.1841 28.7762 5.9996 Constraint 68 183 14.7405 18.4256 27.6384 5.9996 Constraint 110 358 15.6769 19.5961 29.3941 5.9987 Constraint 25 312 15.8738 19.8422 29.7633 5.9987 Constraint 157 680 16.2232 20.2791 30.4186 5.9987 Constraint 36 306 16.5319 20.6649 30.9974 5.9987 Constraint 374 540 16.5739 20.7174 31.0761 5.9986 Constraint 369 455 16.5045 20.6306 30.9460 5.9984 Constraint 369 446 15.6796 19.5995 29.3993 5.9984 Constraint 287 446 14.4837 18.1047 27.1570 5.9984 Constraint 274 446 14.6908 18.3636 27.5453 5.9984 Constraint 615 680 13.0573 16.3217 24.4825 5.8070 Constraint 610 680 15.2047 19.0059 28.5088 5.8070 Constraint 434 680 15.4137 19.2671 28.9006 5.8070 Constraint 329 673 13.8605 17.3257 25.9885 5.5809 Constraint 526 673 14.2850 17.8562 26.7843 5.5806 Constraint 295 545 15.6859 19.6073 29.4110 5.4216 Constraint 295 540 15.5676 19.4595 29.1892 5.4216 Constraint 295 463 15.1388 18.9235 28.3853 5.4216 Constraint 295 418 16.3368 20.4210 30.6314 5.4216 Constraint 295 410 16.2802 20.3502 30.5254 5.4216 Constraint 340 512 15.6215 19.5268 29.2903 5.1218 Constraint 455 680 12.2250 15.2813 22.9220 5.0999 Constraint 117 391 16.3250 20.4063 30.6094 5.0000 Constraint 54 206 14.8439 18.5548 27.8322 5.0000 Constraint 43 197 16.3427 20.4284 30.6426 5.0000 Constraint 206 573 15.2103 19.0129 28.5194 5.0000 Constraint 189 601 16.6402 20.8003 31.2004 5.0000 Constraint 9 526 16.6374 20.7967 31.1950 4.9999 Constraint 9 483 16.4021 20.5026 30.7539 4.9999 Constraint 9 197 15.8096 19.7620 29.6430 4.9999 Constraint 9 206 12.3906 15.4883 23.2324 4.9999 Constraint 183 584 15.8943 19.8679 29.8018 4.9999 Constraint 173 584 15.3850 19.2313 28.8470 4.9999 Constraint 68 173 15.4654 19.3317 28.9975 4.9999 Constraint 68 673 16.3567 20.4458 30.6687 4.9999 Constraint 17 329 15.5670 19.4587 29.1880 4.9999 Constraint 9 673 13.4271 16.7838 25.1758 4.9999 Constraint 9 312 16.5974 20.7468 31.1202 4.9999 Constraint 183 295 14.9594 18.6993 28.0490 4.9996 Constraint 274 584 14.9625 18.7031 28.0547 4.9991 Constraint 212 691 13.7202 17.1503 25.7255 4.9991 Constraint 173 691 15.3792 19.2240 28.8360 4.9991 Constraint 97 470 16.5009 20.6261 30.9392 4.9985 Constraint 295 667 14.7290 18.4113 27.6169 4.9981 Constraint 287 667 15.2212 19.0265 28.5398 4.9981 Constraint 434 667 14.7159 18.3949 27.5923 4.8690 Constraint 626 691 13.4486 16.8107 25.2161 4.7064 Constraint 463 691 14.2758 17.8447 26.7671 4.7064 Constraint 418 691 14.2669 17.8336 26.7503 4.7064 Constraint 410 691 11.9083 14.8854 22.3280 4.7064 Constraint 402 691 11.8289 14.7861 22.1792 4.7064 Constraint 234 691 13.7859 17.2323 25.8485 4.7064 Constraint 306 673 13.9701 17.4627 26.1940 4.5809 Constraint 517 673 15.0751 18.8438 28.2658 4.5806 Constraint 287 491 16.6274 20.7843 31.1764 4.3000 Constraint 280 455 15.9926 19.9907 29.9861 4.2987 Constraint 312 667 15.9461 19.9326 29.8989 4.1219 Constraint 3 667 9.4058 11.7572 17.6358 4.0000 Constraint 206 691 14.9260 18.6575 27.9863 4.0000 Constraint 197 691 14.8647 18.5809 27.8713 4.0000 Constraint 189 691 13.1159 16.3949 24.5923 4.0000 Constraint 502 680 16.2710 20.3387 30.5081 4.0000 Constraint 110 483 15.5228 19.4035 29.1053 4.0000 Constraint 3 329 15.6278 19.5347 29.3020 4.0000 Constraint 130 206 15.3104 19.1380 28.7071 4.0000 Constraint 3 78 15.9994 19.9992 29.9988 4.0000 Constraint 3 274 15.3944 19.2430 28.8645 3.9999 Constraint 3 263 14.6758 18.3448 27.5171 3.9999 Constraint 3 234 15.0071 18.7589 28.1384 3.9999 Constraint 3 173 14.9569 18.6961 28.0441 3.9999 Constraint 3 165 15.8271 19.7839 29.6758 3.9999 Constraint 3 146 15.5897 19.4871 29.2306 3.9999 Constraint 9 223 13.4517 16.8146 25.2219 3.9999 Constraint 9 212 12.3187 15.3984 23.0976 3.9999 Constraint 197 615 15.0614 18.8268 28.2402 3.9999 Constraint 62 197 15.5646 19.4557 29.1836 3.9999 Constraint 97 223 16.5868 20.7335 31.1002 3.9999 Constraint 512 660 16.5890 20.7362 31.1043 3.9999 Constraint 17 157 14.9496 18.6870 28.0306 3.9998 Constraint 17 130 15.4475 19.3094 28.9641 3.9998 Constraint 86 649 14.8973 18.6216 27.9324 3.9997 Constraint 86 391 14.0903 17.6129 26.4194 3.9997 Constraint 470 691 12.6911 15.8639 23.7958 3.9991 Constraint 183 691 14.7811 18.4763 27.7145 3.9991 Constraint 165 691 15.7957 19.7447 29.6170 3.9991 Constraint 62 691 14.2125 17.7656 26.6484 3.9991 Constraint 54 691 13.9621 17.4526 26.1789 3.9991 Constraint 110 369 15.0160 18.7699 28.1549 3.9986 Constraint 130 667 15.5971 19.4964 29.2446 3.9980 Constraint 502 673 15.1892 18.9865 28.4798 3.8733 Constraint 446 680 15.3384 19.1730 28.7595 3.8073 Constraint 312 680 13.8073 17.2591 25.8887 3.8060 Constraint 189 295 14.9638 18.7047 28.0571 3.7472 Constraint 517 667 16.7641 20.9551 31.4326 3.7471 Constraint 517 680 16.7209 20.9011 31.3516 3.7070 Constraint 280 691 14.4156 18.0194 27.0292 3.7064 Constraint 206 340 15.8533 19.8166 29.7249 3.4146 Constraint 329 502 16.1150 20.1438 30.2157 3.3000 Constraint 295 649 16.1118 20.1397 30.2095 3.1218 Constraint 369 584 15.8495 19.8118 29.7177 3.0000 Constraint 358 584 15.5128 19.3911 29.0866 3.0000 Constraint 324 568 15.8075 19.7594 29.6391 3.0000 Constraint 243 584 15.1293 18.9116 28.3675 3.0000 Constraint 197 324 16.3635 20.4544 30.6816 3.0000 Constraint 117 206 16.6289 20.7861 31.1791 3.0000 Constraint 43 559 16.7969 20.9962 31.4943 3.0000 Constraint 36 540 16.7347 20.9184 31.3775 3.0000 Constraint 3 680 14.7694 18.4618 27.6926 3.0000 Constraint 3 673 12.6232 15.7790 23.6686 3.0000 Constraint 223 691 11.9646 14.9558 22.4336 3.0000 Constraint 483 680 14.3139 17.8924 26.8386 3.0000 Constraint 206 610 13.9160 17.3951 26.0926 3.0000 Constraint 324 517 16.5935 20.7419 31.1129 3.0000 Constraint 3 183 15.6422 19.5528 29.3292 2.9999 Constraint 470 601 16.2802 20.3502 30.5253 2.9999 Constraint 62 512 16.7197 20.8997 31.3495 2.9999 Constraint 25 551 16.5895 20.7369 31.1054 2.9999 Constraint 17 533 16.3077 20.3846 30.5769 2.9999 Constraint 17 517 15.5675 19.4593 29.1890 2.9999 Constraint 17 502 14.2526 17.8157 26.7236 2.9999 Constraint 17 491 14.7551 18.4438 27.6657 2.9999 Constraint 9 680 13.9535 17.4418 26.1628 2.9999 Constraint 86 660 16.4154 20.5192 30.7788 2.9998 Constraint 295 446 16.5321 20.6651 30.9977 2.9997 Constraint 287 470 16.7955 20.9944 31.4916 2.9997 Constraint 117 470 16.6063 20.7578 31.1367 2.9997 Constraint 358 593 16.5578 20.6972 31.0458 2.9987 Constraint 274 455 16.0840 20.1050 30.1575 2.9987 Constraint 110 383 15.3637 19.2047 28.8070 2.9987 Constraint 110 243 16.0630 20.0788 30.1181 2.9987 Constraint 306 667 15.0808 18.8510 28.2765 2.9981 Constraint 551 667 16.5487 20.6858 31.0287 2.9979 Constraint 206 287 15.5129 19.3911 29.0867 2.8735 Constraint 551 680 14.8531 18.5664 27.8497 2.8073 Constraint 545 680 15.5441 19.4302 29.1453 2.7073 Constraint 526 691 14.0008 17.5010 26.2515 2.7073 Constraint 483 691 14.4489 18.0611 27.0916 2.7073 Constraint 446 691 15.7655 19.7069 29.5603 2.7073 Constraint 427 691 14.3180 17.8975 26.8463 2.7073 Constraint 340 691 11.8857 14.8571 22.2856 2.7064 Constraint 329 691 14.1315 17.6643 26.4965 2.7064 Constraint 312 691 12.7985 15.9981 23.9972 2.7064 Constraint 610 673 11.3967 14.2458 21.3687 2.5809 Constraint 434 673 12.6579 15.8224 23.7336 2.5809 Constraint 295 517 15.4868 19.3586 29.0378 2.4219 Constraint 295 512 13.8738 17.3423 26.0134 2.4219 Constraint 601 667 16.5867 20.7334 31.1001 2.1219 Constraint 470 593 16.6792 20.8491 31.2736 2.1219 Constraint 329 483 16.1640 20.2050 30.3075 2.1219 Constraint 324 483 15.7880 19.7350 29.6025 2.1219 Constraint 306 483 12.9970 16.2463 24.3694 2.1219 Constraint 295 483 12.5111 15.6389 23.4584 2.1219 Constraint 573 660 16.7141 20.8926 31.3389 2.0000 Constraint 43 117 16.6986 20.8733 31.3100 2.0000 Constraint 9 446 14.7323 18.4153 27.6230 2.0000 Constraint 9 434 15.1266 18.9082 28.3623 2.0000 Constraint 502 691 16.1807 20.2258 30.3388 2.0000 Constraint 491 691 16.3415 20.4268 30.6403 2.0000 Constraint 455 691 11.9791 14.9739 22.4608 2.0000 Constraint 78 680 16.4300 20.5375 30.8062 2.0000 Constraint 68 680 15.8177 19.7721 29.6582 2.0000 Constraint 3 312 16.6516 20.8145 31.2217 2.0000 Constraint 3 295 16.2477 20.3097 30.4645 2.0000 Constraint 3 223 13.1761 16.4701 24.7052 1.9999 Constraint 3 212 10.1972 12.7465 19.1198 1.9999 Constraint 3 206 9.3364 11.6705 17.5057 1.9999 Constraint 3 197 13.6254 17.0318 25.5477 1.9999 Constraint 3 189 10.7184 13.3980 20.0970 1.9999 Constraint 183 601 14.9741 18.7176 28.0764 1.9999 Constraint 183 593 15.0829 18.8537 28.2805 1.9999 Constraint 183 329 14.0564 17.5706 26.3558 1.9999 Constraint 173 601 15.7354 19.6692 29.5039 1.9999 Constraint 173 593 15.8706 19.8382 29.7573 1.9999 Constraint 78 206 15.1820 18.9776 28.4663 1.9999 Constraint 78 197 16.0763 20.0954 30.1431 1.9999 Constraint 86 374 15.3830 19.2287 28.8431 1.9999 Constraint 545 667 16.7747 20.9684 31.4526 1.9998 Constraint 491 667 16.1972 20.2465 30.3697 1.9998 Constraint 146 691 15.4089 19.2612 28.8918 1.9991 Constraint 78 691 16.4782 20.5977 30.8966 1.9991 Constraint 197 306 16.6776 20.8470 31.2705 1.7473 Constraint 274 691 14.8463 18.5578 27.8367 1.7073 Constraint 601 673 10.4867 13.1084 19.6626 1.5809 Constraint 593 673 11.6280 14.5350 21.8025 1.5809 Constraint 551 673 11.1004 13.8755 20.8133 1.5809 Constraint 545 673 12.6572 15.8215 23.7323 1.5809 Constraint 533 673 14.1235 17.6544 26.4815 1.5809 Constraint 446 673 13.3635 16.7043 25.0565 1.5809 Constraint 312 673 9.1095 11.3869 17.0804 1.5809 Constraint 312 491 16.2107 20.2633 30.3950 1.3000 Constraint 223 324 15.7206 19.6508 29.4761 1.0000 Constraint 223 312 16.2897 20.3622 30.5433 1.0000 Constraint 223 306 16.6426 20.8032 31.2049 1.0000 Constraint 212 340 15.6322 19.5402 29.3103 1.0000 Constraint 117 212 16.7569 20.9462 31.4193 1.0000 Constraint 110 491 13.9796 17.4745 26.2118 1.0000 Constraint 86 517 14.6576 18.3221 27.4831 1.0000 Constraint 86 512 15.7377 19.6721 29.5082 1.0000 Constraint 86 502 14.7703 18.4629 27.6943 1.0000 Constraint 86 491 16.7730 20.9662 31.4493 1.0000 Constraint 86 483 14.7111 18.3889 27.5833 1.0000 Constraint 86 470 16.5745 20.7182 31.0772 1.0000 Constraint 86 189 15.6347 19.5433 29.3150 1.0000 Constraint 78 212 16.0638 20.0798 30.1197 1.0000 Constraint 68 502 15.3247 19.1558 28.7338 1.0000 Constraint 68 212 16.6380 20.7976 31.1963 1.0000 Constraint 3 691 15.4226 19.2783 28.9174 1.0000 Constraint 3 306 16.7511 20.9389 31.4083 1.0000 Constraint 3 287 16.5950 20.7438 31.1156 1.0000 Constraint 3 157 16.5836 20.7295 31.0943 1.0000 Constraint 491 680 16.6448 20.8061 31.2091 1.0000 Constraint 206 601 16.5081 20.6351 30.9526 1.0000 Constraint 206 584 16.7363 20.9204 31.3806 1.0000 Constraint 206 324 15.9791 19.9739 29.9608 1.0000 Constraint 206 312 15.8660 19.8325 29.7488 1.0000 Constraint 206 306 15.5856 19.4820 29.2229 1.0000 Constraint 97 206 16.2281 20.2852 30.4277 1.0000 Constraint 68 206 15.4397 19.2996 28.9494 1.0000 Constraint 189 329 16.6602 20.8253 31.2379 0.9999 Constraint 568 649 15.7522 19.6903 29.5354 0.9999 Constraint 117 649 15.4926 19.3658 29.0486 0.9999 Constraint 17 312 14.4006 18.0008 27.0012 0.9999 Constraint 533 667 16.3965 20.4956 30.7434 0.9981 Constraint 601 680 5.6436 7.0545 10.5818 0.8073 Constraint 593 680 6.7860 8.4824 12.7237 0.8073 Constraint 329 680 7.1578 8.9472 13.4208 0.8073 Constraint 306 680 9.5868 11.9835 17.9753 0.8073 Constraint 287 680 15.2119 19.0149 28.5224 0.8073 Constraint 615 691 10.0164 12.5205 18.7808 0.7073 Constraint 610 691 6.3427 7.9284 11.8926 0.7073 Constraint 601 691 6.5187 8.1484 12.2226 0.7073 Constraint 593 691 3.3943 4.2428 6.3642 0.7073 Constraint 584 691 4.2720 5.3400 8.0099 0.7073 Constraint 584 680 5.0225 6.2782 9.4173 0.7073 Constraint 584 673 7.9807 9.9758 14.9637 0.7073 Constraint 573 691 5.1863 6.4829 9.7243 0.7073 Constraint 573 680 8.7851 10.9814 16.4720 0.7073 Constraint 573 673 7.3944 9.2430 13.8645 0.7073 Constraint 568 691 9.0680 11.3350 17.0024 0.7073 Constraint 568 680 13.1444 16.4305 24.6457 0.7073 Constraint 568 673 11.2775 14.0968 21.1453 0.7073 Constraint 559 691 7.9900 9.9875 14.9813 0.7073 Constraint 559 680 12.1561 15.1952 22.7928 0.7073 Constraint 559 673 9.7951 12.2439 18.3659 0.7073 Constraint 551 691 7.2110 9.0137 13.5206 0.7073 Constraint 545 691 9.9878 12.4848 18.7272 0.7073 Constraint 540 691 11.8032 14.7541 22.1311 0.7073 Constraint 540 680 15.4234 19.2792 28.9189 0.7073 Constraint 540 673 12.2435 15.3043 22.9565 0.7073 Constraint 533 691 11.4628 14.3285 21.4927 0.7073 Constraint 533 680 14.7752 18.4690 27.7035 0.7073 Constraint 517 691 14.2113 17.7641 26.6462 0.7073 Constraint 512 691 14.8566 18.5707 27.8561 0.7073 Constraint 512 673 14.2863 17.8579 26.7869 0.7073 Constraint 483 673 13.4506 16.8133 25.2199 0.7073 Constraint 434 691 10.8703 13.5878 20.3818 0.7073 Constraint 324 691 11.6705 14.5881 21.8822 0.7073 Constraint 319 691 9.7935 12.2418 18.3627 0.7073 Constraint 306 691 7.3457 9.1821 13.7731 0.7073 Constraint 295 691 10.9191 13.6489 20.4734 0.7073 Constraint 295 680 12.2567 15.3209 22.9813 0.7073 Constraint 287 691 14.8021 18.5027 27.7540 0.7073 Constraint 358 491 16.1842 20.2303 30.3454 0.3000 Constraint 295 491 15.3556 19.1946 28.7918 0.3000 Constraint 680 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 691 0.8000 1.0000 1.5000 0.0000 Constraint 667 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 691 0.8000 1.0000 1.5000 0.0000 Constraint 660 680 0.8000 1.0000 1.5000 0.0000 Constraint 660 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 691 0.8000 1.0000 1.5000 0.0000 Constraint 649 680 0.8000 1.0000 1.5000 0.0000 Constraint 649 673 0.8000 1.0000 1.5000 0.0000 Constraint 649 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 691 0.8000 1.0000 1.5000 0.0000 Constraint 642 680 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 667 0.8000 1.0000 1.5000 0.0000 Constraint 642 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 691 0.8000 1.0000 1.5000 0.0000 Constraint 634 680 0.8000 1.0000 1.5000 0.0000 Constraint 634 673 0.8000 1.0000 1.5000 0.0000 Constraint 634 667 0.8000 1.0000 1.5000 0.0000 Constraint 634 660 0.8000 1.0000 1.5000 0.0000 Constraint 634 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 680 0.8000 1.0000 1.5000 0.0000 Constraint 626 673 0.8000 1.0000 1.5000 0.0000 Constraint 626 667 0.8000 1.0000 1.5000 0.0000 Constraint 626 660 0.8000 1.0000 1.5000 0.0000 Constraint 626 649 0.8000 1.0000 1.5000 0.0000 Constraint 626 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 673 0.8000 1.0000 1.5000 0.0000 Constraint 615 667 0.8000 1.0000 1.5000 0.0000 Constraint 615 660 0.8000 1.0000 1.5000 0.0000 Constraint 615 649 0.8000 1.0000 1.5000 0.0000 Constraint 615 642 0.8000 1.0000 1.5000 0.0000 Constraint 615 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 667 0.8000 1.0000 1.5000 0.0000 Constraint 610 660 0.8000 1.0000 1.5000 0.0000 Constraint 610 649 0.8000 1.0000 1.5000 0.0000 Constraint 610 642 0.8000 1.0000 1.5000 0.0000 Constraint 610 634 0.8000 1.0000 1.5000 0.0000 Constraint 610 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 660 0.8000 1.0000 1.5000 0.0000 Constraint 601 649 0.8000 1.0000 1.5000 0.0000 Constraint 601 642 0.8000 1.0000 1.5000 0.0000 Constraint 601 634 0.8000 1.0000 1.5000 0.0000 Constraint 601 626 0.8000 1.0000 1.5000 0.0000 Constraint 601 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 667 0.8000 1.0000 1.5000 0.0000 Constraint 593 660 0.8000 1.0000 1.5000 0.0000 Constraint 593 649 0.8000 1.0000 1.5000 0.0000 Constraint 593 642 0.8000 1.0000 1.5000 0.0000 Constraint 593 634 0.8000 1.0000 1.5000 0.0000 Constraint 593 626 0.8000 1.0000 1.5000 0.0000 Constraint 593 615 0.8000 1.0000 1.5000 0.0000 Constraint 593 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 667 0.8000 1.0000 1.5000 0.0000 Constraint 584 660 0.8000 1.0000 1.5000 0.0000 Constraint 584 649 0.8000 1.0000 1.5000 0.0000 Constraint 584 642 0.8000 1.0000 1.5000 0.0000 Constraint 584 634 0.8000 1.0000 1.5000 0.0000 Constraint 584 626 0.8000 1.0000 1.5000 0.0000 Constraint 584 615 0.8000 1.0000 1.5000 0.0000 Constraint 584 610 0.8000 1.0000 1.5000 0.0000 Constraint 584 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 667 0.8000 1.0000 1.5000 0.0000 Constraint 573 642 0.8000 1.0000 1.5000 0.0000 Constraint 573 634 0.8000 1.0000 1.5000 0.0000 Constraint 573 626 0.8000 1.0000 1.5000 0.0000 Constraint 573 615 0.8000 1.0000 1.5000 0.0000 Constraint 573 610 0.8000 1.0000 1.5000 0.0000 Constraint 573 601 0.8000 1.0000 1.5000 0.0000 Constraint 573 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 667 0.8000 1.0000 1.5000 0.0000 Constraint 568 660 0.8000 1.0000 1.5000 0.0000 Constraint 568 634 0.8000 1.0000 1.5000 0.0000 Constraint 568 626 0.8000 1.0000 1.5000 0.0000 Constraint 568 615 0.8000 1.0000 1.5000 0.0000 Constraint 568 610 0.8000 1.0000 1.5000 0.0000 Constraint 568 601 0.8000 1.0000 1.5000 0.0000 Constraint 568 593 0.8000 1.0000 1.5000 0.0000 Constraint 568 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 667 0.8000 1.0000 1.5000 0.0000 Constraint 559 660 0.8000 1.0000 1.5000 0.0000 Constraint 559 626 0.8000 1.0000 1.5000 0.0000 Constraint 559 615 0.8000 1.0000 1.5000 0.0000 Constraint 559 610 0.8000 1.0000 1.5000 0.0000 Constraint 559 601 0.8000 1.0000 1.5000 0.0000 Constraint 559 593 0.8000 1.0000 1.5000 0.0000 Constraint 559 584 0.8000 1.0000 1.5000 0.0000 Constraint 559 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 615 0.8000 1.0000 1.5000 0.0000 Constraint 551 610 0.8000 1.0000 1.5000 0.0000 Constraint 551 601 0.8000 1.0000 1.5000 0.0000 Constraint 551 593 0.8000 1.0000 1.5000 0.0000 Constraint 551 584 0.8000 1.0000 1.5000 0.0000 Constraint 551 573 0.8000 1.0000 1.5000 0.0000 Constraint 551 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 610 0.8000 1.0000 1.5000 0.0000 Constraint 545 601 0.8000 1.0000 1.5000 0.0000 Constraint 545 593 0.8000 1.0000 1.5000 0.0000 Constraint 545 584 0.8000 1.0000 1.5000 0.0000 Constraint 545 573 0.8000 1.0000 1.5000 0.0000 Constraint 545 568 0.8000 1.0000 1.5000 0.0000 Constraint 545 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 667 0.8000 1.0000 1.5000 0.0000 Constraint 540 660 0.8000 1.0000 1.5000 0.0000 Constraint 540 601 0.8000 1.0000 1.5000 0.0000 Constraint 540 593 0.8000 1.0000 1.5000 0.0000 Constraint 540 584 0.8000 1.0000 1.5000 0.0000 Constraint 540 573 0.8000 1.0000 1.5000 0.0000 Constraint 540 568 0.8000 1.0000 1.5000 0.0000 Constraint 540 559 0.8000 1.0000 1.5000 0.0000 Constraint 540 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 593 0.8000 1.0000 1.5000 0.0000 Constraint 533 584 0.8000 1.0000 1.5000 0.0000 Constraint 533 573 0.8000 1.0000 1.5000 0.0000 Constraint 533 568 0.8000 1.0000 1.5000 0.0000 Constraint 533 559 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 584 0.8000 1.0000 1.5000 0.0000 Constraint 526 573 0.8000 1.0000 1.5000 0.0000 Constraint 526 568 0.8000 1.0000 1.5000 0.0000 Constraint 526 559 0.8000 1.0000 1.5000 0.0000 Constraint 526 551 0.8000 1.0000 1.5000 0.0000 Constraint 526 545 0.8000 1.0000 1.5000 0.0000 Constraint 526 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 573 0.8000 1.0000 1.5000 0.0000 Constraint 517 568 0.8000 1.0000 1.5000 0.0000 Constraint 517 559 0.8000 1.0000 1.5000 0.0000 Constraint 517 551 0.8000 1.0000 1.5000 0.0000 Constraint 517 545 0.8000 1.0000 1.5000 0.0000 Constraint 517 540 0.8000 1.0000 1.5000 0.0000 Constraint 517 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 680 0.8000 1.0000 1.5000 0.0000 Constraint 512 667 0.8000 1.0000 1.5000 0.0000 Constraint 512 568 0.8000 1.0000 1.5000 0.0000 Constraint 512 559 0.8000 1.0000 1.5000 0.0000 Constraint 512 551 0.8000 1.0000 1.5000 0.0000 Constraint 512 545 0.8000 1.0000 1.5000 0.0000 Constraint 512 540 0.8000 1.0000 1.5000 0.0000 Constraint 512 533 0.8000 1.0000 1.5000 0.0000 Constraint 512 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 559 0.8000 1.0000 1.5000 0.0000 Constraint 502 551 0.8000 1.0000 1.5000 0.0000 Constraint 502 545 0.8000 1.0000 1.5000 0.0000 Constraint 502 540 0.8000 1.0000 1.5000 0.0000 Constraint 502 533 0.8000 1.0000 1.5000 0.0000 Constraint 502 526 0.8000 1.0000 1.5000 0.0000 Constraint 502 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 673 0.8000 1.0000 1.5000 0.0000 Constraint 491 601 0.8000 1.0000 1.5000 0.0000 Constraint 491 593 0.8000 1.0000 1.5000 0.0000 Constraint 491 551 0.8000 1.0000 1.5000 0.0000 Constraint 491 545 0.8000 1.0000 1.5000 0.0000 Constraint 491 540 0.8000 1.0000 1.5000 0.0000 Constraint 491 533 0.8000 1.0000 1.5000 0.0000 Constraint 491 526 0.8000 1.0000 1.5000 0.0000 Constraint 491 517 0.8000 1.0000 1.5000 0.0000 Constraint 491 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 545 0.8000 1.0000 1.5000 0.0000 Constraint 483 540 0.8000 1.0000 1.5000 0.0000 Constraint 483 533 0.8000 1.0000 1.5000 0.0000 Constraint 483 526 0.8000 1.0000 1.5000 0.0000 Constraint 483 517 0.8000 1.0000 1.5000 0.0000 Constraint 483 512 0.8000 1.0000 1.5000 0.0000 Constraint 483 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 533 0.8000 1.0000 1.5000 0.0000 Constraint 470 526 0.8000 1.0000 1.5000 0.0000 Constraint 470 517 0.8000 1.0000 1.5000 0.0000 Constraint 470 512 0.8000 1.0000 1.5000 0.0000 Constraint 470 502 0.8000 1.0000 1.5000 0.0000 Constraint 470 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 526 0.8000 1.0000 1.5000 0.0000 Constraint 463 517 0.8000 1.0000 1.5000 0.0000 Constraint 463 512 0.8000 1.0000 1.5000 0.0000 Constraint 463 502 0.8000 1.0000 1.5000 0.0000 Constraint 463 491 0.8000 1.0000 1.5000 0.0000 Constraint 463 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 517 0.8000 1.0000 1.5000 0.0000 Constraint 455 512 0.8000 1.0000 1.5000 0.0000 Constraint 455 502 0.8000 1.0000 1.5000 0.0000 Constraint 455 491 0.8000 1.0000 1.5000 0.0000 Constraint 455 483 0.8000 1.0000 1.5000 0.0000 Constraint 455 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 512 0.8000 1.0000 1.5000 0.0000 Constraint 446 502 0.8000 1.0000 1.5000 0.0000 Constraint 446 491 0.8000 1.0000 1.5000 0.0000 Constraint 446 483 0.8000 1.0000 1.5000 0.0000 Constraint 446 470 0.8000 1.0000 1.5000 0.0000 Constraint 446 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 491 0.8000 1.0000 1.5000 0.0000 Constraint 434 483 0.8000 1.0000 1.5000 0.0000 Constraint 434 470 0.8000 1.0000 1.5000 0.0000 Constraint 434 463 0.8000 1.0000 1.5000 0.0000 Constraint 434 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 483 0.8000 1.0000 1.5000 0.0000 Constraint 427 470 0.8000 1.0000 1.5000 0.0000 Constraint 427 463 0.8000 1.0000 1.5000 0.0000 Constraint 427 455 0.8000 1.0000 1.5000 0.0000 Constraint 427 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 470 0.8000 1.0000 1.5000 0.0000 Constraint 418 463 0.8000 1.0000 1.5000 0.0000 Constraint 418 455 0.8000 1.0000 1.5000 0.0000 Constraint 418 446 0.8000 1.0000 1.5000 0.0000 Constraint 418 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 470 0.8000 1.0000 1.5000 0.0000 Constraint 410 463 0.8000 1.0000 1.5000 0.0000 Constraint 410 455 0.8000 1.0000 1.5000 0.0000 Constraint 410 446 0.8000 1.0000 1.5000 0.0000 Constraint 410 434 0.8000 1.0000 1.5000 0.0000 Constraint 410 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 463 0.8000 1.0000 1.5000 0.0000 Constraint 402 455 0.8000 1.0000 1.5000 0.0000 Constraint 402 446 0.8000 1.0000 1.5000 0.0000 Constraint 402 434 0.8000 1.0000 1.5000 0.0000 Constraint 402 427 0.8000 1.0000 1.5000 0.0000 Constraint 402 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 593 0.8000 1.0000 1.5000 0.0000 Constraint 391 455 0.8000 1.0000 1.5000 0.0000 Constraint 391 446 0.8000 1.0000 1.5000 0.0000 Constraint 391 434 0.8000 1.0000 1.5000 0.0000 Constraint 391 427 0.8000 1.0000 1.5000 0.0000 Constraint 391 418 0.8000 1.0000 1.5000 0.0000 Constraint 391 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 446 0.8000 1.0000 1.5000 0.0000 Constraint 383 434 0.8000 1.0000 1.5000 0.0000 Constraint 383 427 0.8000 1.0000 1.5000 0.0000 Constraint 383 418 0.8000 1.0000 1.5000 0.0000 Constraint 383 410 0.8000 1.0000 1.5000 0.0000 Constraint 383 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 601 0.8000 1.0000 1.5000 0.0000 Constraint 374 593 0.8000 1.0000 1.5000 0.0000 Constraint 374 584 0.8000 1.0000 1.5000 0.0000 Constraint 374 568 0.8000 1.0000 1.5000 0.0000 Constraint 374 434 0.8000 1.0000 1.5000 0.0000 Constraint 374 427 0.8000 1.0000 1.5000 0.0000 Constraint 374 418 0.8000 1.0000 1.5000 0.0000 Constraint 374 410 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 593 0.8000 1.0000 1.5000 0.0000 Constraint 369 568 0.8000 1.0000 1.5000 0.0000 Constraint 369 540 0.8000 1.0000 1.5000 0.0000 Constraint 369 434 0.8000 1.0000 1.5000 0.0000 Constraint 369 427 0.8000 1.0000 1.5000 0.0000 Constraint 369 418 0.8000 1.0000 1.5000 0.0000 Constraint 369 410 0.8000 1.0000 1.5000 0.0000 Constraint 369 402 0.8000 1.0000 1.5000 0.0000 Constraint 369 391 0.8000 1.0000 1.5000 0.0000 Constraint 369 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 568 0.8000 1.0000 1.5000 0.0000 Constraint 358 540 0.8000 1.0000 1.5000 0.0000 Constraint 358 512 0.8000 1.0000 1.5000 0.0000 Constraint 358 427 0.8000 1.0000 1.5000 0.0000 Constraint 358 418 0.8000 1.0000 1.5000 0.0000 Constraint 358 410 0.8000 1.0000 1.5000 0.0000 Constraint 358 402 0.8000 1.0000 1.5000 0.0000 Constraint 358 391 0.8000 1.0000 1.5000 0.0000 Constraint 358 383 0.8000 1.0000 1.5000 0.0000 Constraint 358 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 418 0.8000 1.0000 1.5000 0.0000 Constraint 350 410 0.8000 1.0000 1.5000 0.0000 Constraint 350 402 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 383 0.8000 1.0000 1.5000 0.0000 Constraint 350 374 0.8000 1.0000 1.5000 0.0000 Constraint 350 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 491 0.8000 1.0000 1.5000 0.0000 Constraint 340 402 0.8000 1.0000 1.5000 0.0000 Constraint 340 391 0.8000 1.0000 1.5000 0.0000 Constraint 340 383 0.8000 1.0000 1.5000 0.0000 Constraint 340 374 0.8000 1.0000 1.5000 0.0000 Constraint 340 369 0.8000 1.0000 1.5000 0.0000 Constraint 340 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 540 0.8000 1.0000 1.5000 0.0000 Constraint 329 517 0.8000 1.0000 1.5000 0.0000 Constraint 329 512 0.8000 1.0000 1.5000 0.0000 Constraint 329 491 0.8000 1.0000 1.5000 0.0000 Constraint 329 470 0.8000 1.0000 1.5000 0.0000 Constraint 329 455 0.8000 1.0000 1.5000 0.0000 Constraint 329 446 0.8000 1.0000 1.5000 0.0000 Constraint 329 391 0.8000 1.0000 1.5000 0.0000 Constraint 329 383 0.8000 1.0000 1.5000 0.0000 Constraint 329 374 0.8000 1.0000 1.5000 0.0000 Constraint 329 369 0.8000 1.0000 1.5000 0.0000 Constraint 329 358 0.8000 1.0000 1.5000 0.0000 Constraint 329 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 540 0.8000 1.0000 1.5000 0.0000 Constraint 324 512 0.8000 1.0000 1.5000 0.0000 Constraint 324 491 0.8000 1.0000 1.5000 0.0000 Constraint 324 470 0.8000 1.0000 1.5000 0.0000 Constraint 324 455 0.8000 1.0000 1.5000 0.0000 Constraint 324 446 0.8000 1.0000 1.5000 0.0000 Constraint 324 383 0.8000 1.0000 1.5000 0.0000 Constraint 324 374 0.8000 1.0000 1.5000 0.0000 Constraint 324 369 0.8000 1.0000 1.5000 0.0000 Constraint 324 358 0.8000 1.0000 1.5000 0.0000 Constraint 324 350 0.8000 1.0000 1.5000 0.0000 Constraint 324 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 369 0.8000 1.0000 1.5000 0.0000 Constraint 319 358 0.8000 1.0000 1.5000 0.0000 Constraint 319 350 0.8000 1.0000 1.5000 0.0000 Constraint 319 340 0.8000 1.0000 1.5000 0.0000 Constraint 319 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 470 0.8000 1.0000 1.5000 0.0000 Constraint 312 369 0.8000 1.0000 1.5000 0.0000 Constraint 312 358 0.8000 1.0000 1.5000 0.0000 Constraint 312 350 0.8000 1.0000 1.5000 0.0000 Constraint 312 340 0.8000 1.0000 1.5000 0.0000 Constraint 312 329 0.8000 1.0000 1.5000 0.0000 Constraint 312 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 491 0.8000 1.0000 1.5000 0.0000 Constraint 306 470 0.8000 1.0000 1.5000 0.0000 Constraint 306 455 0.8000 1.0000 1.5000 0.0000 Constraint 306 358 0.8000 1.0000 1.5000 0.0000 Constraint 306 350 0.8000 1.0000 1.5000 0.0000 Constraint 306 340 0.8000 1.0000 1.5000 0.0000 Constraint 306 329 0.8000 1.0000 1.5000 0.0000 Constraint 306 324 0.8000 1.0000 1.5000 0.0000 Constraint 306 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 470 0.8000 1.0000 1.5000 0.0000 Constraint 295 455 0.8000 1.0000 1.5000 0.0000 Constraint 295 340 0.8000 1.0000 1.5000 0.0000 Constraint 295 329 0.8000 1.0000 1.5000 0.0000 Constraint 295 324 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 455 0.8000 1.0000 1.5000 0.0000 Constraint 287 340 0.8000 1.0000 1.5000 0.0000 Constraint 287 329 0.8000 1.0000 1.5000 0.0000 Constraint 287 324 0.8000 1.0000 1.5000 0.0000 Constraint 287 319 0.8000 1.0000 1.5000 0.0000 Constraint 287 312 0.8000 1.0000 1.5000 0.0000 Constraint 287 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 329 0.8000 1.0000 1.5000 0.0000 Constraint 280 324 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 312 0.8000 1.0000 1.5000 0.0000 Constraint 280 306 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 324 0.8000 1.0000 1.5000 0.0000 Constraint 274 319 0.8000 1.0000 1.5000 0.0000 Constraint 274 312 0.8000 1.0000 1.5000 0.0000 Constraint 274 306 0.8000 1.0000 1.5000 0.0000 Constraint 274 295 0.8000 1.0000 1.5000 0.0000 Constraint 274 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 593 0.8000 1.0000 1.5000 0.0000 Constraint 263 319 0.8000 1.0000 1.5000 0.0000 Constraint 263 312 0.8000 1.0000 1.5000 0.0000 Constraint 263 306 0.8000 1.0000 1.5000 0.0000 Constraint 263 295 0.8000 1.0000 1.5000 0.0000 Constraint 263 287 0.8000 1.0000 1.5000 0.0000 Constraint 263 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 312 0.8000 1.0000 1.5000 0.0000 Constraint 255 306 0.8000 1.0000 1.5000 0.0000 Constraint 255 295 0.8000 1.0000 1.5000 0.0000 Constraint 255 287 0.8000 1.0000 1.5000 0.0000 Constraint 255 280 0.8000 1.0000 1.5000 0.0000 Constraint 255 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 593 0.8000 1.0000 1.5000 0.0000 Constraint 243 306 0.8000 1.0000 1.5000 0.0000 Constraint 243 295 0.8000 1.0000 1.5000 0.0000 Constraint 243 287 0.8000 1.0000 1.5000 0.0000 Constraint 243 280 0.8000 1.0000 1.5000 0.0000 Constraint 243 274 0.8000 1.0000 1.5000 0.0000 Constraint 243 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 295 0.8000 1.0000 1.5000 0.0000 Constraint 234 287 0.8000 1.0000 1.5000 0.0000 Constraint 234 280 0.8000 1.0000 1.5000 0.0000 Constraint 234 274 0.8000 1.0000 1.5000 0.0000 Constraint 234 263 0.8000 1.0000 1.5000 0.0000 Constraint 234 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 601 0.8000 1.0000 1.5000 0.0000 Constraint 223 593 0.8000 1.0000 1.5000 0.0000 Constraint 223 584 0.8000 1.0000 1.5000 0.0000 Constraint 223 329 0.8000 1.0000 1.5000 0.0000 Constraint 223 295 0.8000 1.0000 1.5000 0.0000 Constraint 223 287 0.8000 1.0000 1.5000 0.0000 Constraint 223 280 0.8000 1.0000 1.5000 0.0000 Constraint 223 274 0.8000 1.0000 1.5000 0.0000 Constraint 223 263 0.8000 1.0000 1.5000 0.0000 Constraint 223 255 0.8000 1.0000 1.5000 0.0000 Constraint 223 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 601 0.8000 1.0000 1.5000 0.0000 Constraint 212 593 0.8000 1.0000 1.5000 0.0000 Constraint 212 584 0.8000 1.0000 1.5000 0.0000 Constraint 212 329 0.8000 1.0000 1.5000 0.0000 Constraint 212 324 0.8000 1.0000 1.5000 0.0000 Constraint 212 312 0.8000 1.0000 1.5000 0.0000 Constraint 212 306 0.8000 1.0000 1.5000 0.0000 Constraint 212 295 0.8000 1.0000 1.5000 0.0000 Constraint 212 287 0.8000 1.0000 1.5000 0.0000 Constraint 212 280 0.8000 1.0000 1.5000 0.0000 Constraint 212 274 0.8000 1.0000 1.5000 0.0000 Constraint 212 263 0.8000 1.0000 1.5000 0.0000 Constraint 212 255 0.8000 1.0000 1.5000 0.0000 Constraint 212 243 0.8000 1.0000 1.5000 0.0000 Constraint 212 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 593 0.8000 1.0000 1.5000 0.0000 Constraint 206 329 0.8000 1.0000 1.5000 0.0000 Constraint 206 295 0.8000 1.0000 1.5000 0.0000 Constraint 206 274 0.8000 1.0000 1.5000 0.0000 Constraint 206 263 0.8000 1.0000 1.5000 0.0000 Constraint 206 255 0.8000 1.0000 1.5000 0.0000 Constraint 206 243 0.8000 1.0000 1.5000 0.0000 Constraint 206 234 0.8000 1.0000 1.5000 0.0000 Constraint 206 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 601 0.8000 1.0000 1.5000 0.0000 Constraint 197 593 0.8000 1.0000 1.5000 0.0000 Constraint 197 584 0.8000 1.0000 1.5000 0.0000 Constraint 197 340 0.8000 1.0000 1.5000 0.0000 Constraint 197 329 0.8000 1.0000 1.5000 0.0000 Constraint 197 312 0.8000 1.0000 1.5000 0.0000 Constraint 197 295 0.8000 1.0000 1.5000 0.0000 Constraint 197 263 0.8000 1.0000 1.5000 0.0000 Constraint 197 255 0.8000 1.0000 1.5000 0.0000 Constraint 197 243 0.8000 1.0000 1.5000 0.0000 Constraint 197 234 0.8000 1.0000 1.5000 0.0000 Constraint 197 223 0.8000 1.0000 1.5000 0.0000 Constraint 197 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 593 0.8000 1.0000 1.5000 0.0000 Constraint 189 255 0.8000 1.0000 1.5000 0.0000 Constraint 189 243 0.8000 1.0000 1.5000 0.0000 Constraint 189 234 0.8000 1.0000 1.5000 0.0000 Constraint 189 223 0.8000 1.0000 1.5000 0.0000 Constraint 189 212 0.8000 1.0000 1.5000 0.0000 Constraint 189 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 243 0.8000 1.0000 1.5000 0.0000 Constraint 183 234 0.8000 1.0000 1.5000 0.0000 Constraint 183 223 0.8000 1.0000 1.5000 0.0000 Constraint 183 212 0.8000 1.0000 1.5000 0.0000 Constraint 183 206 0.8000 1.0000 1.5000 0.0000 Constraint 183 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 234 0.8000 1.0000 1.5000 0.0000 Constraint 173 223 0.8000 1.0000 1.5000 0.0000 Constraint 173 212 0.8000 1.0000 1.5000 0.0000 Constraint 173 206 0.8000 1.0000 1.5000 0.0000 Constraint 173 197 0.8000 1.0000 1.5000 0.0000 Constraint 173 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 223 0.8000 1.0000 1.5000 0.0000 Constraint 165 212 0.8000 1.0000 1.5000 0.0000 Constraint 165 206 0.8000 1.0000 1.5000 0.0000 Constraint 165 197 0.8000 1.0000 1.5000 0.0000 Constraint 165 189 0.8000 1.0000 1.5000 0.0000 Constraint 165 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 691 0.8000 1.0000 1.5000 0.0000 Constraint 157 223 0.8000 1.0000 1.5000 0.0000 Constraint 157 212 0.8000 1.0000 1.5000 0.0000 Constraint 157 206 0.8000 1.0000 1.5000 0.0000 Constraint 157 197 0.8000 1.0000 1.5000 0.0000 Constraint 157 189 0.8000 1.0000 1.5000 0.0000 Constraint 157 183 0.8000 1.0000 1.5000 0.0000 Constraint 157 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 212 0.8000 1.0000 1.5000 0.0000 Constraint 146 206 0.8000 1.0000 1.5000 0.0000 Constraint 146 197 0.8000 1.0000 1.5000 0.0000 Constraint 146 189 0.8000 1.0000 1.5000 0.0000 Constraint 146 183 0.8000 1.0000 1.5000 0.0000 Constraint 146 173 0.8000 1.0000 1.5000 0.0000 Constraint 146 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 691 0.8000 1.0000 1.5000 0.0000 Constraint 130 680 0.8000 1.0000 1.5000 0.0000 Constraint 130 673 0.8000 1.0000 1.5000 0.0000 Constraint 130 197 0.8000 1.0000 1.5000 0.0000 Constraint 130 189 0.8000 1.0000 1.5000 0.0000 Constraint 130 183 0.8000 1.0000 1.5000 0.0000 Constraint 130 173 0.8000 1.0000 1.5000 0.0000 Constraint 130 165 0.8000 1.0000 1.5000 0.0000 Constraint 130 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 691 0.8000 1.0000 1.5000 0.0000 Constraint 117 680 0.8000 1.0000 1.5000 0.0000 Constraint 117 673 0.8000 1.0000 1.5000 0.0000 Constraint 117 667 0.8000 1.0000 1.5000 0.0000 Constraint 117 660 0.8000 1.0000 1.5000 0.0000 Constraint 117 223 0.8000 1.0000 1.5000 0.0000 Constraint 117 197 0.8000 1.0000 1.5000 0.0000 Constraint 117 183 0.8000 1.0000 1.5000 0.0000 Constraint 117 173 0.8000 1.0000 1.5000 0.0000 Constraint 117 165 0.8000 1.0000 1.5000 0.0000 Constraint 117 157 0.8000 1.0000 1.5000 0.0000 Constraint 117 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 691 0.8000 1.0000 1.5000 0.0000 Constraint 110 680 0.8000 1.0000 1.5000 0.0000 Constraint 110 673 0.8000 1.0000 1.5000 0.0000 Constraint 110 667 0.8000 1.0000 1.5000 0.0000 Constraint 110 660 0.8000 1.0000 1.5000 0.0000 Constraint 110 649 0.8000 1.0000 1.5000 0.0000 Constraint 110 470 0.8000 1.0000 1.5000 0.0000 Constraint 110 455 0.8000 1.0000 1.5000 0.0000 Constraint 110 410 0.8000 1.0000 1.5000 0.0000 Constraint 110 391 0.8000 1.0000 1.5000 0.0000 Constraint 110 374 0.8000 1.0000 1.5000 0.0000 Constraint 110 223 0.8000 1.0000 1.5000 0.0000 Constraint 110 212 0.8000 1.0000 1.5000 0.0000 Constraint 110 206 0.8000 1.0000 1.5000 0.0000 Constraint 110 197 0.8000 1.0000 1.5000 0.0000 Constraint 110 189 0.8000 1.0000 1.5000 0.0000 Constraint 110 183 0.8000 1.0000 1.5000 0.0000 Constraint 110 173 0.8000 1.0000 1.5000 0.0000 Constraint 110 165 0.8000 1.0000 1.5000 0.0000 Constraint 110 157 0.8000 1.0000 1.5000 0.0000 Constraint 110 146 0.8000 1.0000 1.5000 0.0000 Constraint 110 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 691 0.8000 1.0000 1.5000 0.0000 Constraint 97 680 0.8000 1.0000 1.5000 0.0000 Constraint 97 673 0.8000 1.0000 1.5000 0.0000 Constraint 97 667 0.8000 1.0000 1.5000 0.0000 Constraint 97 660 0.8000 1.0000 1.5000 0.0000 Constraint 97 212 0.8000 1.0000 1.5000 0.0000 Constraint 97 197 0.8000 1.0000 1.5000 0.0000 Constraint 97 157 0.8000 1.0000 1.5000 0.0000 Constraint 97 146 0.8000 1.0000 1.5000 0.0000 Constraint 97 130 0.8000 1.0000 1.5000 0.0000 Constraint 97 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 691 0.8000 1.0000 1.5000 0.0000 Constraint 86 680 0.8000 1.0000 1.5000 0.0000 Constraint 86 673 0.8000 1.0000 1.5000 0.0000 Constraint 86 667 0.8000 1.0000 1.5000 0.0000 Constraint 86 223 0.8000 1.0000 1.5000 0.0000 Constraint 86 212 0.8000 1.0000 1.5000 0.0000 Constraint 86 206 0.8000 1.0000 1.5000 0.0000 Constraint 86 197 0.8000 1.0000 1.5000 0.0000 Constraint 86 146 0.8000 1.0000 1.5000 0.0000 Constraint 86 130 0.8000 1.0000 1.5000 0.0000 Constraint 86 117 0.8000 1.0000 1.5000 0.0000 Constraint 86 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 673 0.8000 1.0000 1.5000 0.0000 Constraint 78 130 0.8000 1.0000 1.5000 0.0000 Constraint 78 117 0.8000 1.0000 1.5000 0.0000 Constraint 78 110 0.8000 1.0000 1.5000 0.0000 Constraint 78 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 691 0.8000 1.0000 1.5000 0.0000 Constraint 68 512 0.8000 1.0000 1.5000 0.0000 Constraint 68 491 0.8000 1.0000 1.5000 0.0000 Constraint 68 197 0.8000 1.0000 1.5000 0.0000 Constraint 68 130 0.8000 1.0000 1.5000 0.0000 Constraint 68 117 0.8000 1.0000 1.5000 0.0000 Constraint 68 110 0.8000 1.0000 1.5000 0.0000 Constraint 68 97 0.8000 1.0000 1.5000 0.0000 Constraint 68 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 117 0.8000 1.0000 1.5000 0.0000 Constraint 62 110 0.8000 1.0000 1.5000 0.0000 Constraint 62 97 0.8000 1.0000 1.5000 0.0000 Constraint 62 86 0.8000 1.0000 1.5000 0.0000 Constraint 62 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 512 0.8000 1.0000 1.5000 0.0000 Constraint 54 491 0.8000 1.0000 1.5000 0.0000 Constraint 54 295 0.8000 1.0000 1.5000 0.0000 Constraint 54 197 0.8000 1.0000 1.5000 0.0000 Constraint 54 117 0.8000 1.0000 1.5000 0.0000 Constraint 54 110 0.8000 1.0000 1.5000 0.0000 Constraint 54 97 0.8000 1.0000 1.5000 0.0000 Constraint 54 86 0.8000 1.0000 1.5000 0.0000 Constraint 54 78 0.8000 1.0000 1.5000 0.0000 Constraint 54 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 568 0.8000 1.0000 1.5000 0.0000 Constraint 43 540 0.8000 1.0000 1.5000 0.0000 Constraint 43 517 0.8000 1.0000 1.5000 0.0000 Constraint 43 512 0.8000 1.0000 1.5000 0.0000 Constraint 43 491 0.8000 1.0000 1.5000 0.0000 Constraint 43 110 0.8000 1.0000 1.5000 0.0000 Constraint 43 97 0.8000 1.0000 1.5000 0.0000 Constraint 43 86 0.8000 1.0000 1.5000 0.0000 Constraint 43 78 0.8000 1.0000 1.5000 0.0000 Constraint 43 68 0.8000 1.0000 1.5000 0.0000 Constraint 43 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 593 0.8000 1.0000 1.5000 0.0000 Constraint 36 568 0.8000 1.0000 1.5000 0.0000 Constraint 36 559 0.8000 1.0000 1.5000 0.0000 Constraint 36 512 0.8000 1.0000 1.5000 0.0000 Constraint 36 295 0.8000 1.0000 1.5000 0.0000 Constraint 36 287 0.8000 1.0000 1.5000 0.0000 Constraint 36 117 0.8000 1.0000 1.5000 0.0000 Constraint 36 110 0.8000 1.0000 1.5000 0.0000 Constraint 36 97 0.8000 1.0000 1.5000 0.0000 Constraint 36 86 0.8000 1.0000 1.5000 0.0000 Constraint 36 78 0.8000 1.0000 1.5000 0.0000 Constraint 36 68 0.8000 1.0000 1.5000 0.0000 Constraint 36 62 0.8000 1.0000 1.5000 0.0000 Constraint 36 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 593 0.8000 1.0000 1.5000 0.0000 Constraint 25 584 0.8000 1.0000 1.5000 0.0000 Constraint 25 573 0.8000 1.0000 1.5000 0.0000 Constraint 25 568 0.8000 1.0000 1.5000 0.0000 Constraint 25 559 0.8000 1.0000 1.5000 0.0000 Constraint 25 545 0.8000 1.0000 1.5000 0.0000 Constraint 25 540 0.8000 1.0000 1.5000 0.0000 Constraint 25 533 0.8000 1.0000 1.5000 0.0000 Constraint 25 517 0.8000 1.0000 1.5000 0.0000 Constraint 25 512 0.8000 1.0000 1.5000 0.0000 Constraint 25 502 0.8000 1.0000 1.5000 0.0000 Constraint 25 491 0.8000 1.0000 1.5000 0.0000 Constraint 25 306 0.8000 1.0000 1.5000 0.0000 Constraint 25 295 0.8000 1.0000 1.5000 0.0000 Constraint 25 287 0.8000 1.0000 1.5000 0.0000 Constraint 25 157 0.8000 1.0000 1.5000 0.0000 Constraint 25 117 0.8000 1.0000 1.5000 0.0000 Constraint 25 110 0.8000 1.0000 1.5000 0.0000 Constraint 25 97 0.8000 1.0000 1.5000 0.0000 Constraint 25 86 0.8000 1.0000 1.5000 0.0000 Constraint 25 78 0.8000 1.0000 1.5000 0.0000 Constraint 25 68 0.8000 1.0000 1.5000 0.0000 Constraint 25 62 0.8000 1.0000 1.5000 0.0000 Constraint 25 54 0.8000 1.0000 1.5000 0.0000 Constraint 25 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 601 0.8000 1.0000 1.5000 0.0000 Constraint 17 593 0.8000 1.0000 1.5000 0.0000 Constraint 17 584 0.8000 1.0000 1.5000 0.0000 Constraint 17 573 0.8000 1.0000 1.5000 0.0000 Constraint 17 568 0.8000 1.0000 1.5000 0.0000 Constraint 17 559 0.8000 1.0000 1.5000 0.0000 Constraint 17 540 0.8000 1.0000 1.5000 0.0000 Constraint 17 512 0.8000 1.0000 1.5000 0.0000 Constraint 17 306 0.8000 1.0000 1.5000 0.0000 Constraint 17 295 0.8000 1.0000 1.5000 0.0000 Constraint 17 287 0.8000 1.0000 1.5000 0.0000 Constraint 17 117 0.8000 1.0000 1.5000 0.0000 Constraint 17 110 0.8000 1.0000 1.5000 0.0000 Constraint 17 97 0.8000 1.0000 1.5000 0.0000 Constraint 17 86 0.8000 1.0000 1.5000 0.0000 Constraint 17 78 0.8000 1.0000 1.5000 0.0000 Constraint 17 68 0.8000 1.0000 1.5000 0.0000 Constraint 17 62 0.8000 1.0000 1.5000 0.0000 Constraint 17 54 0.8000 1.0000 1.5000 0.0000 Constraint 17 43 0.8000 1.0000 1.5000 0.0000 Constraint 17 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 691 0.8000 1.0000 1.5000 0.0000 Constraint 9 601 0.8000 1.0000 1.5000 0.0000 Constraint 9 593 0.8000 1.0000 1.5000 0.0000 Constraint 9 584 0.8000 1.0000 1.5000 0.0000 Constraint 9 573 0.8000 1.0000 1.5000 0.0000 Constraint 9 568 0.8000 1.0000 1.5000 0.0000 Constraint 9 559 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 545 0.8000 1.0000 1.5000 0.0000 Constraint 9 540 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 517 0.8000 1.0000 1.5000 0.0000 Constraint 9 512 0.8000 1.0000 1.5000 0.0000 Constraint 9 502 0.8000 1.0000 1.5000 0.0000 Constraint 9 491 0.8000 1.0000 1.5000 0.0000 Constraint 9 306 0.8000 1.0000 1.5000 0.0000 Constraint 9 295 0.8000 1.0000 1.5000 0.0000 Constraint 9 287 0.8000 1.0000 1.5000 0.0000 Constraint 9 157 0.8000 1.0000 1.5000 0.0000 Constraint 9 117 0.8000 1.0000 1.5000 0.0000 Constraint 9 110 0.8000 1.0000 1.5000 0.0000 Constraint 9 97 0.8000 1.0000 1.5000 0.0000 Constraint 9 86 0.8000 1.0000 1.5000 0.0000 Constraint 9 78 0.8000 1.0000 1.5000 0.0000 Constraint 9 68 0.8000 1.0000 1.5000 0.0000 Constraint 9 62 0.8000 1.0000 1.5000 0.0000 Constraint 9 54 0.8000 1.0000 1.5000 0.0000 Constraint 9 43 0.8000 1.0000 1.5000 0.0000 Constraint 9 36 0.8000 1.0000 1.5000 0.0000 Constraint 9 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 610 0.8000 1.0000 1.5000 0.0000 Constraint 3 601 0.8000 1.0000 1.5000 0.0000 Constraint 3 593 0.8000 1.0000 1.5000 0.0000 Constraint 3 584 0.8000 1.0000 1.5000 0.0000 Constraint 3 573 0.8000 1.0000 1.5000 0.0000 Constraint 3 568 0.8000 1.0000 1.5000 0.0000 Constraint 3 559 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 545 0.8000 1.0000 1.5000 0.0000 Constraint 3 540 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 526 0.8000 1.0000 1.5000 0.0000 Constraint 3 517 0.8000 1.0000 1.5000 0.0000 Constraint 3 512 0.8000 1.0000 1.5000 0.0000 Constraint 3 502 0.8000 1.0000 1.5000 0.0000 Constraint 3 491 0.8000 1.0000 1.5000 0.0000 Constraint 3 483 0.8000 1.0000 1.5000 0.0000 Constraint 3 463 0.8000 1.0000 1.5000 0.0000 Constraint 3 455 0.8000 1.0000 1.5000 0.0000 Constraint 3 446 0.8000 1.0000 1.5000 0.0000 Constraint 3 434 0.8000 1.0000 1.5000 0.0000 Constraint 3 427 0.8000 1.0000 1.5000 0.0000 Constraint 3 130 0.8000 1.0000 1.5000 0.0000 Constraint 3 117 0.8000 1.0000 1.5000 0.0000 Constraint 3 110 0.8000 1.0000 1.5000 0.0000 Constraint 3 97 0.8000 1.0000 1.5000 0.0000 Constraint 3 86 0.8000 1.0000 1.5000 0.0000 Constraint 3 68 0.8000 1.0000 1.5000 0.0000 Constraint 3 62 0.8000 1.0000 1.5000 0.0000 Constraint 3 54 0.8000 1.0000 1.5000 0.0000 Constraint 3 43 0.8000 1.0000 1.5000 0.0000 Constraint 3 36 0.8000 1.0000 1.5000 0.0000 Constraint 3 25 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: