# command:# Prefix for input files set to /projects/compbio/experiments/undertaker/atoms-inputs/ # command:# reading dunbrack-2191.atoms # #computed average backbone with maximum peptide_sq_deviance = 0.002 # computed average trans backbone unit from 53157 examples # computed average trans backbone unit before proline from 2010 examples # computed average cis backbone unit from 97 examples # trans (non-proline) backbone unit: # CA= -2.2087 1.0126 -0.0030 # O= -0.1499 2.2440 0.0016 # C= -0.6889 1.1368 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4581 -0.0000 0.0000 # cis backbone unit: # CA= -0.1436 2.4534 -0.0002 # O= -2.0284 0.9742 0.0015 # C= -0.8018 1.0771 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4668 0.0000 0.0000 # trans backbone unit before proline: # CA= -2.2100 1.0631 -0.0014 # O= -0.1236 2.2458 0.0075 # C= -0.6872 1.1517 -0.0000 # N+1= 0.0000 0.0000 0.0000 # CA+1= 1.4660 0.0000 0.0000 # After reading dunbrack-2191.atoms have 2191 chains in training database # Count of chains,residues,atoms: 2191,500310,3902258 # 493341 residues have no bad marker # 3226 residues lack atoms needed to compute omega # 1453 residues have cis peptide # number of each bad type: # NON_STANDARD_RESIDUE 4 # HAS_OXT 1167 # TOO_MANY_ATOMS 1 # TOO_FEW_ATOMS 3052 # HAS_UNKNOWN_ATOMS 9 # HAS_DUPLICATE_ATOMS 0 # CHAIN_BREAK_BEFORE 979 # NON_PLANAR_PEPTIDE 888 # BAD_PEPTIDE 2680 # Note: may sum to more than number of residues, # because one residue may have multiple problems # command:# Reading rotamer library from dunbrack-2191.rot # command:# Prefix for input files set to /projects/compbio/experiments/undertaker/spots/ # command:# ReadAtomType exp-pdb.types Read AtomType exp-pdb with 49 types. # command:# ReadClashTable exp-pdb-2191-2symm.clash # Read ClashTable exp-pdb-2191-2symm checking bonds symmetric at MaxSep 2 # command:# command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:# Making conformation for sequence T0340 numbered 1 through 90 Created new target T0340 from T0340.a2m # command:# Prefix for input files set to /projects/compbio/experiments/protein-predict/casp7/T0340/ # command:Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under or /projects/compbio/experiments/protein-predict/casp7/T0340//projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under.gz for input Trying /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # reading script from file /projects/compbio/experiments/protein-predict/casp7/constraints_v2/T0340/manyalignments-good-all.under # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fneA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fneA expands to /projects/compbio/data/pdb/2fne.pdb.gz 2fneA:Skipped atom 15, because occupancy 0.5 <= existing 0.500 in 2fneA Skipped atom 19, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 21, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 23, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 25, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 27, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 664, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 666, because occupancy 0.500 <= existing 0.500 in 2fneA Skipped atom 668, because occupancy 0.500 <= existing 0.500 in 2fneA # T0340 read from 2fneA/merged-good-all-a2m # 2fneA read from 2fneA/merged-good-all-a2m # adding 2fneA to template set # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGY # choosing archetypes in rotamer library T0340 26 :SRPGQYIRSVDPGSPAARSG 2fneA 1982 :GDLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=3 Number of alignments=1 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=6 Number of alignments=2 # 2fneA read from 2fneA/merged-good-all-a2m # found chain 2fneA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fneA)M1954 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fneA 1955 :PQCKSITLERGPDGLGFSIVGGYG T0340 27 :RPGQYIRSVDPGSPAARSG 2fneA 1983 :DLPIYVKTVFAKGAASEDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 2fneA 2003 :LKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVLSSDE Number of specific fragments extracted= 3 number of extra gaps= 0 total=9 Number of alignments=3 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2bygA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/2bygA/merged-good-all-a2m.gz for input Trying 2bygA/merged-good-all-a2m Error: Couldn't open file 2bygA/merged-good-all-a2m or 2bygA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1y8tA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1y8tA expands to /projects/compbio/data/pdb/1y8t.pdb.gz 1y8tA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1y8tA/merged-good-all-a2m # 1y8tA read from 1y8tA/merged-good-all-a2m # adding 1y8tA to template set # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=17 Number of alignments=4 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKAR 1y8tA 277 :ADALVAAVRSK T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 5 total=25 Number of alignments=5 # 1y8tA read from 1y8tA/merged-good-all-a2m # found chain 1y8tA in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)D238 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)D238 Warning: unaligning (T0340)K25 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)D240 Warning: unaligning (T0340)S26 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)D240 Warning: unaligning (T0340)R27 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)T241 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)L242 Warning: unaligning (T0340)S39 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A254 Warning: unaligning (T0340)P40 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A254 Warning: unaligning (T0340)R43 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)A258 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)A258 Warning: unaligning (T0340)G45 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1y8tA)V260 Warning: unaligning (T0340)L46 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)V260 Warning: unaligning (T0340)G57 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE in next template residue (1y8tA)R272 Warning: unaligning (T0340)Q58 because of BadResidue code TOO_FEW_ATOMS+BAD_PEPTIDE at template residue (1y8tA)R272 Warning: unaligning (T0340)N59 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1y8tA)P273 Warning: unaligning (T0340)R75 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P289 Warning: unaligning (T0340)G85 because of BadResidue code BAD_PEPTIDE in next template residue (1y8tA)P300 Warning: unaligning (T0340)P86 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)P300 Warning: unaligning (T0340)S87 because of BadResidue code BAD_PEPTIDE at template residue (1y8tA)S301 T0340 16 :GYGFNLH 1y8tA 230 :SLGVQVT T0340 29 :GQYIRSVDPG 1y8tA 243 :GAKIVEVVAG T0340 41 :AA 1y8tA 255 :AA T0340 47 :RAQDRLIEVN 1y8tA 261 :PKGVVVTKVD T0340 60 :VEG 1y8tA 274 :INS T0340 65 :HAEVVASIKA 1y8tA 277 :ADALVAAVRS T0340 76 :EDEARLLVV 1y8tA 290 :GATVALTFQ T0340 88 :TR 1y8tA 302 :GG Number of specific fragments extracted= 8 number of extra gaps= 6 total=33 Number of alignments=6 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qauA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1qauA/merged-good-all-a2m # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGPQ 1qauA 15 :VISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 27 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qauA 90 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=37 Number of alignments=7 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLRKGP 1qauA 15 :VISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 26 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qauA 90 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=41 Number of alignments=8 # 1qauA read from 1qauA/merged-good-all-a2m # found chain 1qauA in training set Warning: unaligning (T0340)R4 because first residue in template chain is (1qauA)N14 T0340 5 :PRLCHLR 1qauA 15 :VISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qauA 23 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 1qauA 58 :IQAGDIILAVNDRPLVDLSYDSALEVLRG T0340 75 :REDEARLLVVGPST 1qauA 89 :SETHVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=45 Number of alignments=9 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i16/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i16 expands to /projects/compbio/data/pdb/1i16.pdb.gz 1i16:Warning: there is no chain 1i16 will retry with 1i16A # T0340 read from 1i16/merged-good-all-a2m # 1i16 read from 1i16/merged-good-all-a2m # adding 1i16 to template set # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGK T0340 26 :SRPGQYIRSVDPGSPAARSG 1i16 55 :GDKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTRL 1i16 107 :DGPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=49 Number of alignments=10 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKAL T0340 76 :EDEARLLVVGPSTR 1i16 107 :DGPVTIVIRRKSLQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=53 Number of alignments=11 # 1i16 read from 1i16/merged-good-all-a2m # found chain 1i16 in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1i16 28 :ATVCTVTLEKMSAGLGFSLEGGKG T0340 27 :RPGQYIRSVDPGSPAARSG 1i16 56 :DKPLTINRIFKGAASEQSE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1i16 76 :VQPGDEILQLGGTAMQGLTRFEAWNIIKALP T0340 77 :DEARLLVVGPSTRL 1i16 108 :GPVTIVIRRKSLQS Number of specific fragments extracted= 4 number of extra gaps= 0 total=57 Number of alignments=12 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1v5lA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1v5lA expands to /projects/compbio/data/pdb/1v5l.pdb.gz 1v5lA:# T0340 read from 1v5lA/merged-good-all-a2m # 1v5lA read from 1v5lA/merged-good-all-a2m # adding 1v5lA to template set # found chain 1v5lA in template set T0340 3 :LRPRLCHLR 1v5lA 4 :GSSGNVVLP T0340 13 :GPQGYGFNLHSDKSRP 1v5lA 13 :GPAPWGFRLSGGIDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1v5lA 30 :PLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAE T0340 88 :TR 1v5lA 94 :PQ Number of specific fragments extracted= 4 number of extra gaps= 0 total=61 Number of alignments=13 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 8 :CHLR 1v5lA 9 :VVLP T0340 13 :GPQGYGFNLHSDKS 1v5lA 13 :GPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRA Number of specific fragments extracted= 3 number of extra gaps= 0 total=64 Number of alignments=14 # 1v5lA read from 1v5lA/merged-good-all-a2m # found chain 1v5lA in template set T0340 12 :KGPQGYGFNLHSDKS 1v5lA 12 :PGPAPWGFRLSGGID T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1v5lA 28 :NQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAET Number of specific fragments extracted= 2 number of extra gaps= 0 total=66 Number of alignments=15 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1tp5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1tp5A expands to /projects/compbio/data/pdb/1tp5.pdb.gz 1tp5A:# T0340 read from 1tp5A/merged-good-all-a2m # 1tp5A read from 1tp5A/merged-good-all-a2m # adding 1tp5A to template set # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=69 Number of alignments=16 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVGP 1tp5A 390 :AQYK Number of specific fragments extracted= 3 number of extra gaps= 1 total=72 Number of alignments=17 # 1tp5A read from 1tp5A/merged-good-all-a2m # found chain 1tp5A in template set Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1tp5A)I389 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1tp5A)I389 T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1tp5A 308 :PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEAR 1tp5A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVT T0340 83 :VVG 1tp5A 390 :AQY Number of specific fragments extracted= 3 number of extra gaps= 1 total=75 Number of alignments=18 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1i92A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1i92A expands to /projects/compbio/data/pdb/1i92.pdb.gz 1i92A:Skipped atom 533, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 543, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 545, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 547, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 549, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 551, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 553, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 555, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 557, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 559, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 561, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 563, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 565, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 567, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 569, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 571, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 573, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 575, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 577, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 579, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 581, because occupancy 0.500 <= existing 0.500 in 1i92A Skipped atom 583, because occupancy 0.500 <= existing 0.500 in 1i92A # T0340 read from 1i92A/merged-good-all-a2m # 1i92A read from 1i92A/merged-good-all-a2m # adding 1i92A to template set # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPS 1i92A 85 :AVRLLVVDPE T0340 89 :R 1i92A 97 :T Number of specific fragments extracted= 3 number of extra gaps= 1 total=78 Number of alignments=19 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1i92A)G9 Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=80 Number of alignments=20 # 1i92A read from 1i92A/merged-good-all-a2m # found chain 1i92A in template set Warning: unaligning (T0340)E76 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1i92A)N84 Warning: unaligning (T0340)D77 because of BadResidue code TOO_FEW_ATOMS+NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1i92A)N84 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1i92A 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAA T0340 78 :EARLLVVGPSTRL 1i92A 85 :AVRLLVVDPEQDT Number of specific fragments extracted= 2 number of extra gaps= 1 total=82 Number of alignments=21 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1bfeA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1bfeA expands to /projects/compbio/data/pdb/1bfe.pdb.gz 1bfeA:# T0340 read from 1bfeA/merged-good-all-a2m # 1bfeA read from 1bfeA/merged-good-all-a2m # adding 1bfeA to template set # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=84 Number of alignments=22 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=86 Number of alignments=23 # 1bfeA read from 1bfeA/merged-good-all-a2m # found chain 1bfeA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1bfeA 309 :REPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1bfeA 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=88 Number of alignments=24 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1fc6A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1fc6A/merged-good-all-a2m # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKSRP 1fc6A 162 :GVGLEITYDGGSG T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 176 :DVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 74 :AREDEARLLVVGPS 1fc6A 222 :EADSQVEVVLHAPG Number of specific fragments extracted= 4 number of extra gaps= 0 total=92 Number of alignments=25 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQ 1fc6A 157 :AGS T0340 16 :GYGFNLHSDKS 1fc6A 162 :GVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASI 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLL T0340 73 :KAREDEARLLVVGP 1fc6A 221 :GEADSQVEVVLHAP Number of specific fragments extracted= 4 number of extra gaps= 0 total=96 Number of alignments=26 # 1fc6A read from 1fc6A/merged-good-all-a2m # found chain 1fc6A in training set T0340 13 :GPQGYGFNLHSDKS 1fc6A 159 :SVTGVGLEITYDGG T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKA 1fc6A 174 :GKDVVVLTPAPGGPAEKAGARAGDVIVTVDGTAVKGMSLYDVSDLLQG T0340 75 :REDEARLLVVGPS 1fc6A 223 :ADSQVEVVLHAPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=99 Number of alignments=27 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq4A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq4A/merged-good-all-a2m.gz for input Trying 1gq4A/merged-good-all-a2m Error: Couldn't open file 1gq4A/merged-good-all-a2m or 1gq4A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kefA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1kefA/merged-good-all-a2m.gz for input Trying 1kefA/merged-good-all-a2m Error: Couldn't open file 1kefA/merged-good-all-a2m or 1kefA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nf3C/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nf3C expands to /projects/compbio/data/pdb/1nf3.pdb.gz 1nf3C:# T0340 read from 1nf3C/merged-good-all-a2m # 1nf3C read from 1nf3C/merged-good-all-a2m # adding 1nf3C to template set # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDK 1nf3C 168 :PLGFYIRDGS T0340 26 :SRP 1nf3C 184 :HGL T0340 29 :GQYIRSVDPGSPAARSG 1nf3C 191 :GIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 5 number of extra gaps= 0 total=104 Number of alignments=28 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 2 :MLRPRLCHLRKGPQ 1nf3C 152 :PETHRRVRLCKYGT T0340 16 :GYGFNLHSDKS 1nf3C 168 :PLGFYIRDGSS T0340 30 :QYIRSVDPGSPAARSG 1nf3C 192 :IFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=108 Number of alignments=29 # 1nf3C read from 1nf3C/merged-good-all-a2m # found chain 1nf3C in template set T0340 4 :RPRLCHLR 1nf3C 154 :THRRVRLC T0340 12 :KGPQGYGFNLHSDKS 1nf3C 164 :GTEKPLGFYIRDGSS T0340 27 :RPGQYIRSVDPGSPAARSG 1nf3C 189 :VPGIFISRLVPGGLAQSTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1nf3C 209 :LAVNDEVLEVNGIEVSGKSLDQVTDMMIANSRNLIITVRPANQRN Number of specific fragments extracted= 4 number of extra gaps= 0 total=112 Number of alignments=30 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1wf7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1wf7A expands to /projects/compbio/data/pdb/1wf7.pdb.gz 1wf7A:# T0340 read from 1wf7A/merged-good-all-a2m # 1wf7A read from 1wf7A/merged-good-all-a2m # adding 1wf7A to template set # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKSRP 1wf7A 13 :GPAPWGFRLQGGKDFN T0340 29 :GQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1wf7A 30 :PLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRAS Number of specific fragments extracted= 3 number of extra gaps= 0 total=115 Number of alignments=31 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 1 :SMLRPRLCHLR 1wf7A 2 :SSGSSGSVSLV T0340 13 :GPQGYGFNLHSDKS 1wf7A 13 :GPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRA T0340 87 :STR 1wf7A 94 :EPV Number of specific fragments extracted= 4 number of extra gaps= 0 total=119 Number of alignments=32 # 1wf7A read from 1wf7A/merged-good-all-a2m # found chain 1wf7A in template set T0340 8 :CHLRKGPQGYGFNLHSDKS 1wf7A 8 :SVSLVGPAPWGFRLQGGKD T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPST 1wf7A 28 :NMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASA Number of specific fragments extracted= 2 number of extra gaps= 0 total=121 Number of alignments=33 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1um7A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1um7A/merged-good-all-a2m.gz for input Trying 1um7A/merged-good-all-a2m Error: Couldn't open file 1um7A/merged-good-all-a2m or 1um7A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f0aA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f0aA expands to /projects/compbio/data/pdb/2f0a.pdb.gz 2f0aA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 2f0aA/merged-good-all-a2m # 2f0aA read from 2f0aA/merged-good-all-a2m # adding 2f0aA to template set # found chain 2f0aA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (2f0aA)M251 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=126 Number of alignments=34 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 5 :PRLCHLR 2f0aA 252 :IITVTLN T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRDI T0340 76 :EDEARLLVVGP 2f0aA 331 :PGPIVLTVAKL Number of specific fragments extracted= 5 number of extra gaps= 1 total=131 Number of alignments=35 # 2f0aA read from 2f0aA/merged-good-all-a2m # found chain 2f0aA in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f0aA)N263 Warning: unaligning (T0340)S87 because last residue in template chain is (2f0aA)E342 T0340 16 :GYGFNLHS 2f0aA 264 :FLGISIVG T0340 24 :DKSRPGQYIRSVDPGSPAARSG 2f0aA 275 :ERGDGGIYIGSIMKGGAVAADG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKA 2f0aA 298 :IEPGDMLLQVNDINFENMSNDDAVRVLRD T0340 75 :REDEARLLVVGP 2f0aA 330 :KPGPIVLTVAKL Number of specific fragments extracted= 4 number of extra gaps= 1 total=135 Number of alignments=36 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7eA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n7eA expands to /projects/compbio/data/pdb/1n7e.pdb.gz 1n7eA:# T0340 read from 1n7eA/merged-good-all-a2m # 1n7eA read from 1n7eA/merged-good-all-a2m # adding 1n7eA to template set # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRP 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7eA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQT T0340 88 :TR 1n7eA 758 :PA Number of specific fragments extracted= 4 number of extra gaps= 0 total=139 Number of alignments=37 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1n7eA)G667 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQ T0340 87 :STRL 1n7eA 757 :QPAS Number of specific fragments extracted= 4 number of extra gaps= 0 total=143 Number of alignments=38 # 1n7eA read from 1n7eA/merged-good-all-a2m # found chain 1n7eA in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 1n7eA 668 :AIIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7eA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1n7eA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQ Number of specific fragments extracted= 3 number of extra gaps= 0 total=146 Number of alignments=39 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9A expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1ky9A/merged-good-all-a2m # 1ky9A read from 1ky9A/merged-good-all-a2m # adding 1ky9A to template set # found chain 1ky9A in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG T0340 88 :TRL 1ky9A 350 :VNL Number of specific fragments extracted= 4 number of extra gaps= 0 total=150 Number of alignments=40 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 26 :S 1ky9A 283 :D T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKAR 1ky9A 322 :AALRAQVGTM T0340 76 :EDEARLLVVGPS 1ky9A 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=154 Number of alignments=41 # 1ky9A read from 1ky9A/merged-good-all-a2m # found chain 1ky9A in template set T0340 24 :DKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGL 1ky9A 282 :VDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSF T0340 66 :AEVVASIKA 1ky9A 322 :AALRAQVGT T0340 75 :REDEARLLVVGPS 1ky9A 333 :VGSKLTLGLLRDG Number of specific fragments extracted= 3 number of extra gaps= 0 total=157 Number of alignments=42 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ky9B/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1ky9B expands to /projects/compbio/data/pdb/1ky9.pdb.gz 1ky9B:# T0340 read from 1ky9B/merged-good-all-a2m # 1ky9B read from 1ky9B/merged-good-all-a2m # adding 1ky9B to template set # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DK 1ky9B 270 :TE T0340 26 :SRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 284 :AQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPS 1ky9B 334 :GSKLTLGLLRDG Number of specific fragments extracted= 4 number of extra gaps= 0 total=161 Number of alignments=43 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set Warning: unaligning (T0340)L21 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)G269 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ky9B)G269 Warning: unaligning (T0340)A74 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ky9B)P332 T0340 24 :DKS 1ky9B 270 :TEL T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 285 :QRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG T0340 76 :EDEARLLVVGPST 1ky9B 334 :GSKLTLGLLRDGK Number of specific fragments extracted= 4 number of extra gaps= 0 total=165 Number of alignments=44 # 1ky9B read from 1ky9B/merged-good-all-a2m # found chain 1ky9B in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1ky9B 283 :DAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISS T0340 65 :HAEVVASIK 1ky9B 321 :FAALRAQVG Number of specific fragments extracted= 2 number of extra gaps= 0 total=167 Number of alignments=45 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1zokA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1zokA/merged-good-all-a2m.gz for input Trying 1zokA/merged-good-all-a2m Error: Couldn't open file 1zokA/merged-good-all-a2m or 1zokA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1mfgA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1mfgA/merged-good-all-a2m # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDK 1mfgA 1291 :LGFSISGGV T0340 26 :SRPGQYIRSVDPGSPA 1mfgA 1309 :DDDGIFVTRVQPEGPA T0340 44 :SG 1mfgA 1325 :SK T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=174 Number of alignments=46 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1mfgA)G1277 Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)T88 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGP 1mfgA 1278 :SMEIRVRVEKDP T0340 16 :GYGFNLHSDKS 1mfgA 1290 :ELGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGP 1mfgA 1365 :IVRE T0340 87 :S 1mfgA 1370 :S Number of specific fragments extracted= 8 number of extra gaps= 2 total=182 Number of alignments=47 # 1mfgA read from 1mfgA/merged-good-all-a2m # found chain 1mfgA in training set Warning: unaligning (T0340)D77 because of BadResidue code BAD_PEPTIDE in next template residue (1mfgA)T1360 Warning: unaligning (T0340)E78 because of BadResidue code BAD_PEPTIDE at template residue (1mfgA)T1360 Warning: unaligning (T0340)L81 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1mfgA)I1364 Warning: unaligning (T0340)L82 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1mfgA)I1364 Warning: unaligning (T0340)R89 because last residue in template chain is (1mfgA)S1371 T0340 3 :LRPRLCHLRKGPQ 1mfgA 1278 :SMEIRVRVEKDPE T0340 17 :YGFNLHSDKS 1mfgA 1291 :LGFSISGGVG T0340 27 :RPGQYIRSVDPGSPAA 1mfgA 1310 :DDGIFVTRVQPEGPAS T0340 45 :G 1mfgA 1326 :K T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARE 1mfgA 1328 :LQPGDKIIQANGYSFINIEHGQAVSLLKTFQ T0340 79 :AR 1mfgA 1361 :VE T0340 83 :VVGPST 1mfgA 1365 :IVREVS Number of specific fragments extracted= 7 number of extra gaps= 2 total=189 Number of alignments=48 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1b8qA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1b8qA expands to /projects/compbio/data/pdb/1b8q.pdb.gz 1b8qA:# T0340 read from 1b8qA/merged-good-all-a2m # 1b8qA read from 1b8qA/merged-good-all-a2m # adding 1b8qA to template set # found chain 1b8qA in template set T0340 4 :RPRLCHLRKGP 1b8qA 8 :NVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1b8qA 84 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=193 Number of alignments=49 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRP 1b8qA 2 :SHMI T0340 6 :RLCHLRKGP 1b8qA 10 :ISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 20 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGP 1b8qA 84 :ETHVVLILRGP Number of specific fragments extracted= 5 number of extra gaps= 0 total=198 Number of alignments=50 # 1b8qA read from 1b8qA/merged-good-all-a2m # found chain 1b8qA in template set T0340 2 :MLRPRLCHLR 1b8qA 6 :EPNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1b8qA 17 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTR 1b8qA 52 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPE Number of specific fragments extracted= 3 number of extra gaps= 0 total=201 Number of alignments=51 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1nteA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1nteA expands to /projects/compbio/data/pdb/1nte.pdb.gz 1nteA:Skipped atom 107, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 281, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 283, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 285, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 287, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 289, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 291, because occupancy 0.400 <= existing 0.600 in 1nteA Skipped atom 332, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 334, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 336, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 338, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 340, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 373, because occupancy 0.500 <= existing 0.500 in 1nteA Skipped atom 595, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 597, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 599, because occupancy 0.300 <= existing 0.700 in 1nteA Skipped atom 601, because occupancy 0.300 <= existing 0.700 in 1nteA # T0340 read from 1nteA/merged-good-all-a2m # 1nteA read from 1nteA/merged-good-all-a2m # adding 1nteA to template set # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=205 Number of alignments=52 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 1 :SM 1nteA 192 :GA T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGFNLHSD 1nteA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA Number of specific fragments extracted= 4 number of extra gaps= 1 total=209 Number of alignments=53 # 1nteA read from 1nteA/merged-good-all-a2m # found chain 1nteA in template set Warning: unaligning (T0340)L3 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1nteA)D195 Warning: unaligning (T0340)R4 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1nteA)D195 T0340 2 :M 1nteA 193 :A T0340 5 :PRLCHLRKGPQG 1nteA 196 :PRTITMHKDSTG T0340 17 :YGF 1nteA 209 :VGF T0340 22 :HSDKS 1nteA 212 :IFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1nteA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 5 number of extra gaps= 1 total=214 Number of alignments=54 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fe5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fe5A expands to /projects/compbio/data/pdb/2fe5.pdb.gz 2fe5A:Skipped atom 9, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 13, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 15, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 17, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 19, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 42, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 44, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 47, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 51, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 53, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 55, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 57, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 59, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 294, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 296, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 298, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 300, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 302, because occupancy 0.400 <= existing 0.600 in 2fe5A Skipped atom 317, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 320, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 431, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 433, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 435, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 437, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 439, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 441, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 443, because occupancy 0.300 <= existing 0.700 in 2fe5A Skipped atom 593, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 597, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 599, because occupancy 0.250 <= existing 0.750 in 2fe5A Skipped atom 618, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 620, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 622, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 624, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 626, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 628, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 630, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 632, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 634, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 636, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 638, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 640, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 642, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 644, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 646, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 648, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 650, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 652, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 654, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 656, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 658, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 660, because occupancy 0.500 <= existing 0.500 in 2fe5A Skipped atom 662, because occupancy 0.500 <= existing 0.500 in 2fe5A # T0340 read from 2fe5A/merged-good-all-a2m # 2fe5A read from 2fe5A/merged-good-all-a2m # adding 2fe5A to template set # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDK 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGI T0340 26 :SRPGQYIRSVDPGSPAARSG 2fe5A 251 :GDNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=217 Number of alignments=55 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set Warning: unaligning (T0340)M2 because first residue in template chain is (2fe5A)S221 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=220 Number of alignments=56 # 2fe5A read from 2fe5A/merged-good-all-a2m # found chain 2fe5A in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKS 2fe5A 222 :MTIMEVNLLKGPKGLGFSIAGGIG T0340 27 :RPGQYIRSVDPGSPAARSG 2fe5A 252 :DNSIYITKIIEGGAAQKDG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fe5A 272 :LQIGDRLLAVNNTNLQDVRHEEAVASLKNTSDMVYLKVAKPG Number of specific fragments extracted= 3 number of extra gaps= 0 total=223 Number of alignments=57 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1r6jA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1r6jA/merged-good-all-a2m # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=226 Number of alignments=58 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 1 :SMLRPRLCHLRKGPQG 1r6jA 192 :GAMDPRTITMHKDSTG T0340 17 :YGFNLHSD 1r6jA 209 :VGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=229 Number of alignments=59 # 1r6jA read from 1r6jA/merged-good-all-a2m # found chain 1r6jA in training set T0340 2 :MLRPRLCHLRK 1r6jA 193 :AMDPRTITMHK T0340 13 :GPQGYGFNLHSD 1r6jA 205 :STGHVGFIFKNG T0340 31 :YIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1r6jA 217 :KITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMP Number of specific fragments extracted= 3 number of extra gaps= 0 total=232 Number of alignments=60 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavA expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavA:# T0340 read from 1qavA/merged-good-all-a2m # 1qavA read from 1qavA/merged-good-all-a2m # adding 1qavA to template set # found chain 1qavA in template set T0340 2 :MLRPRLCHLRKGPQ 1qavA 76 :SLQRRRVTVRKADA T0340 16 :GYGFNLHSDKSRP 1qavA 91 :GLGISIKGGRENK T0340 29 :GQYIRSVDPGSPAARSG 1qavA 105 :PILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=236 Number of alignments=61 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 1 :SMLRPRLCHLRKGPQ 1qavA 75 :GSLQRRRVTVRKADA T0340 16 :GYGFNLHSDKS 1qavA 91 :GLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=240 Number of alignments=62 # 1qavA read from 1qavA/merged-good-all-a2m # found chain 1qavA in template set T0340 3 :LRPRLCHLRK 1qavA 77 :LQRRRVTVRK T0340 13 :GPQGYGFNLHSDKS 1qavA 88 :DAGGLGISIKGGRE T0340 27 :RPGQYIRSVDPGSPAARSG 1qavA 103 :KMPILISKIFKGLAADQTE T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1qavA 123 :LFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKY Number of specific fragments extracted= 4 number of extra gaps= 0 total=244 Number of alignments=63 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1qavB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1qavB expands to /projects/compbio/data/pdb/1qav.pdb.gz 1qavB:# T0340 read from 1qavB/merged-good-all-a2m # 1qavB read from 1qavB/merged-good-all-a2m # adding 1qavB to template set # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGPQ 1qavB 1013 :PNVISVRLFKRKV T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1027 :GLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPS 1qavB 1090 :ETHVVLILRGPE Number of specific fragments extracted= 4 number of extra gaps= 0 total=248 Number of alignments=64 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set Warning: unaligning (T0340)M2 because first residue in template chain is (1qavB)Q1012 T0340 3 :LRPRLCHLRKGP 1qavB 1013 :PNVISVRLFKRK T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1026 :GGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGI T0340 76 :EDEARLLVVGPSTR 1qavB 1090 :ETHVVLILRGPEGF Number of specific fragments extracted= 4 number of extra gaps= 0 total=252 Number of alignments=65 # 1qavB read from 1qavB/merged-good-all-a2m # found chain 1qavB in template set T0340 3 :LRPRLCHLR 1qavB 1013 :PNVISVRLF T0340 12 :KGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1qavB 1023 :RKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKARED 1qavB 1058 :IQAGDIILAVNDRPLVDLSYDSALEVLRGIAS T0340 78 :EARLLVVGPST 1qavB 1092 :HVVLILRGPEG Number of specific fragments extracted= 4 number of extra gaps= 0 total=256 Number of alignments=66 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1m5zA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1m5zA expands to /projects/compbio/data/pdb/1m5z.pdb.gz 1m5zA:# T0340 read from 1m5zA/merged-good-all-a2m # 1m5zA read from 1m5zA/merged-good-all-a2m # adding 1m5zA to template set # found chain 1m5zA in template set Warning: unaligning (T0340)S87 because last residue in template chain is (1m5zA)P106 T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=258 Number of alignments=67 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 1 :SMLRPRLCHLRKGPQ 1m5zA 18 :TPVELHKVTLYKDSG T0340 16 :GYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 35 :DFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=260 Number of alignments=68 # 1m5zA read from 1m5zA/merged-good-all-a2m # found chain 1m5zA in template set T0340 2 :MLRPRLCHLRKGP 1m5zA 19 :PVELHKVTLYKDS T0340 15 :QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1m5zA 34 :EDFGFSVADGLLEKGVYVKNIRPAGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRN Number of specific fragments extracted= 2 number of extra gaps= 0 total=262 Number of alignments=69 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1be9A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1be9A expands to /projects/compbio/data/pdb/1be9.pdb.gz 1be9A:# T0340 read from 1be9A/merged-good-all-a2m # 1be9A read from 1be9A/merged-good-all-a2m # adding 1be9A to template set # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=264 Number of alignments=70 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYK Number of specific fragments extracted= 2 number of extra gaps= 0 total=266 Number of alignments=71 # 1be9A read from 1be9A/merged-good-all-a2m # found chain 1be9A in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1be9A 308 :PREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1be9A 353 :LRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQY Number of specific fragments extracted= 2 number of extra gaps= 0 total=268 Number of alignments=72 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1te0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1te0A expands to /projects/compbio/data/pdb/1te0.pdb.gz 1te0A:# T0340 read from 1te0A/merged-good-all-a2m # 1te0A read from 1te0A/merged-good-all-a2m # adding 1te0A to template set # found chain 1te0A in template set Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)G16 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RP 1te0A 278 :QL T0340 29 :GQYI 1te0A 281 :GIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPS 1te0A 328 :GSVIPVVVMRDD Number of specific fragments extracted= 8 number of extra gaps= 6 total=276 Number of alignments=73 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)P14 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G273 Warning: unaligning (T0340)Q15 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G273 Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)S26 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 27 :RPGQYI 1te0A 279 :LQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKAR 1te0A 314 :SALETMDQVAEI T0340 76 :EDEARLLVVGPST 1te0A 328 :GSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=283 # 1te0A read from 1te0A/merged-good-all-a2m # found chain 1te0A in template set Warning: unaligning (T0340)S23 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G275 Warning: unaligning (T0340)D24 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)D277 Warning: unaligning (T0340)K25 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)D277 Warning: unaligning (T0340)R33 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)E286 Warning: unaligning (T0340)S34 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)E286 Warning: unaligning (T0340)G38 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)G291 Warning: unaligning (T0340)S39 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)G291 Warning: unaligning (T0340)A42 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1te0A)N295 Warning: unaligning (T0340)R43 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1te0A)N295 Warning: unaligning (T0340)S44 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)G297 Warning: unaligning (T0340)G45 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)G297 Warning: unaligning (T0340)D50 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (1te0A)L303 Warning: unaligning (T0340)R51 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1te0A)L303 Warning: unaligning (T0340)V60 because of BadResidue code BAD_PEPTIDE in next template residue (1te0A)I313 Warning: unaligning (T0340)E61 because of BadResidue code BAD_PEPTIDE at template residue (1te0A)I313 T0340 26 :SRPGQYI 1te0A 278 :QLQGIVV T0340 35 :VDP 1te0A 287 :VSP T0340 40 :PA 1te0A 292 :PA T0340 46 :LRAQ 1te0A 298 :IQVN T0340 52 :LIEVNGQN 1te0A 304 :IISVDNKP T0340 64 :RHAEVVASIKA 1te0A 314 :SALETMDQVAE T0340 75 :REDEARLLVVGPST 1te0A 327 :PGSVIPVVVMRDDK Number of specific fragments extracted= 7 number of extra gaps= 6 total=290 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1gq5A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1gq5A/merged-good-all-a2m.gz for input Trying 1gq5A/merged-good-all-a2m Error: Couldn't open file 1gq5A/merged-good-all-a2m or 1gq5A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 2fcfA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2fcfA expands to /projects/compbio/data/pdb/2fcf.pdb.gz 2fcfA:Skipped atom 598, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 602, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 604, because occupancy 0.500 <= existing 0.500 in 2fcfA Skipped atom 606, because occupancy 0.500 <= existing 0.500 in 2fcfA # T0340 read from 2fcfA/merged-good-all-a2m # 2fcfA read from 2fcfA/merged-good-all-a2m # adding 2fcfA to template set # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSII T0340 88 :TR 2fcfA 1245 :TR Number of specific fragments extracted= 5 number of extra gaps= 1 total=295 Number of alignments=74 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 1 :SMLRPRLCHLRKG 2fcfA 1145 :QSMQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI T0340 87 :STRL 2fcfA 1244 :STRL Number of specific fragments extracted= 5 number of extra gaps= 1 total=300 Number of alignments=75 # 2fcfA read from 2fcfA/merged-good-all-a2m # found chain 2fcfA in template set Warning: unaligning (T0340)P14 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)K1160 Warning: unaligning (T0340)Q15 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)K1160 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (2fcfA)G1184 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (2fcfA)G1184 T0340 3 :LRPRLCHLRKG 2fcfA 1147 :MQPRRVELWRE T0340 16 :GYGFNLHSD 2fcfA 1161 :SLGISIVGG T0340 30 :QYIRSVDPGSPAARSG 2fcfA 1185 :IFIKHVLEDSPAGKNG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 2fcfA 1202 :LKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI Number of specific fragments extracted= 4 number of extra gaps= 1 total=304 Number of alignments=76 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1rgrA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1rgrA/merged-good-all-a2m.gz for input Trying 1rgrA/merged-good-all-a2m Error: Couldn't open file 1rgrA/merged-good-all-a2m or 1rgrA/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1lcyA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1lcyA expands to /projects/compbio/data/pdb/1lcy.pdb.gz 1lcyA:# T0340 read from 1lcyA/merged-good-all-a2m # 1lcyA read from 1lcyA/merged-good-all-a2m # adding 1lcyA to template set # found chain 1lcyA in template set T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=307 Number of alignments=77 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 24 :DKS 1lcyA 248 :EPS T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 255 :QHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPST 1lcyA 303 :QLAVQIRRGRE Number of specific fragments extracted= 4 number of extra gaps= 0 total=311 Number of alignments=78 # 1lcyA read from 1lcyA/merged-good-all-a2m # found chain 1lcyA in template set T0340 25 :KSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEG 1lcyA 253 :DVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQN T0340 65 :HAEVVASIKARE 1lcyA 291 :AEDVYEAVRTQS T0340 78 :EARLLVVGPS 1lcyA 303 :QLAVQIRRGR Number of specific fragments extracted= 3 number of extra gaps= 0 total=314 Number of alignments=79 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1sotA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1sotA expands to /projects/compbio/data/pdb/1sot.pdb.gz 1sotA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1sotA/merged-good-all-a2m # 1sotA read from 1sotA/merged-good-all-a2m # adding 1sotA to template set # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)R89 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV Number of specific fragments extracted= 3 number of extra gaps= 0 total=317 Number of alignments=80 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 Warning: unaligning (T0340)V83 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1sotA)Q341 Warning: unaligning (T0340)T88 because of BadResidue code TOO_FEW_ATOMS+CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)Q341 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAR 1sotA 314 :SALETMDQVAEI T0340 76 :EDEARLL 1sotA 328 :GSVIPVV T0340 89 :R 1sotA 342 :L Number of specific fragments extracted= 4 number of extra gaps= 0 total=321 Number of alignments=81 # 1sotA read from 1sotA/merged-good-all-a2m # found chain 1sotA in template set Warning: unaligning (T0340)G29 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1sotA)G281 T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVE 1sotA 282 :IVVNEVSPDGPAANAGIQVNDLIISVDNKPAI T0340 64 :RHAEVVASIKAREDEARL 1sotA 314 :SALETMDQVAEIRPGSVI Number of specific fragments extracted= 2 number of extra gaps= 0 total=323 Number of alignments=82 # Reading fragments from alignment file # Attempting to read fragment alignments from file 2f5yA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 2f5yA expands to /projects/compbio/data/pdb/2f5y.pdb.gz 2f5yA:Skipped atom 397, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 401, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 403, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 405, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 407, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 409, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 411, because occupancy 0.500 <= existing 0.500 in 2f5yA Skipped atom 413, because occupancy 0.500 <= existing 0.500 in 2f5yA # T0340 read from 2f5yA/merged-good-all-a2m # 2f5yA read from 2f5yA/merged-good-all-a2m # adding 2f5yA to template set # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 Warning: unaligning (T0340)S87 because last residue in template chain is (2f5yA)V95 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=326 Number of alignments=83 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=329 Number of alignments=84 # 2f5yA read from 2f5yA/merged-good-all-a2m # found chain 2f5yA in template set Warning: unaligning (T0340)L3 because first residue in template chain is (2f5yA)M14 Warning: unaligning (T0340)R4 because of BadResidue code BAD_PEPTIDE at template residue (2f5yA)R15 Warning: unaligning (T0340)E61 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE in next template residue (2f5yA)H70 Warning: unaligning (T0340)G62 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (2f5yA)H70 T0340 5 :PRLCHLRKGPQGYGFNLHS 2f5yA 16 :YRQITIPRGKDGFGFTICC T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNV 2f5yA 35 :DSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPV T0340 63 :LRHAEVVASIKAREDEARLLVVGP 2f5yA 71 :WKCVELAHEIRSCPSEIILLVWRM Number of specific fragments extracted= 3 number of extra gaps= 1 total=332 Number of alignments=85 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaA expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaA:# T0340 read from 1kwaA/merged-good-all-a2m # 1kwaA read from 1kwaA/merged-good-all-a2m # adding 1kwaA to template set # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=336 Number of alignments=86 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaA)R487 T0340 5 :PRLCHLRKGPQ 1kwaA 488 :SRLVQFQKNTD T0340 16 :GYGFNLHSD 1kwaA 500 :PMGITLKMN T0340 26 :SRPGQYIRSVDPGSPAARSG 1kwaA 509 :ELNHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS T0340 88 :TRL 1kwaA 572 :REF Number of specific fragments extracted= 5 number of extra gaps= 0 total=341 Number of alignments=87 # 1kwaA read from 1kwaA/merged-good-all-a2m # found chain 1kwaA in template set T0340 5 :PRLCHLRK 1kwaA 488 :SRLVQFQK T0340 13 :GPQGYGFNLHSDKS 1kwaA 497 :TDEPMGITLKMNEL T0340 28 :PGQYIRSVDPGSPAARSG 1kwaA 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1kwaA 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYREF Number of specific fragments extracted= 4 number of extra gaps= 0 total=345 Number of alignments=88 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1kwaB/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1kwaB expands to /projects/compbio/data/pdb/1kwa.pdb.gz 1kwaB:# T0340 read from 1kwaB/merged-good-all-a2m # 1kwaB read from 1kwaB/merged-good-all-a2m # adding 1kwaB to template set # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPSY Number of specific fragments extracted= 4 number of extra gaps= 1 total=349 Number of alignments=89 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1kwaB)R487 Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)R27 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRKGPQ 1kwaB 488 :SRLVQFQKNTD T0340 16 :GYGFNLH 1kwaB 500 :PMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVPS Number of specific fragments extracted= 4 number of extra gaps= 1 total=353 Number of alignments=90 # 1kwaB read from 1kwaB/merged-good-all-a2m # found chain 1kwaB in template set Warning: unaligning (T0340)S23 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1kwaB)L510 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1kwaB)L510 T0340 5 :PRLCHLRK 1kwaB 488 :SRLVQFQK T0340 13 :GPQGYGFNLH 1kwaB 497 :TDEPMGITLK T0340 28 :PGQYIRSVDPGSPAARSG 1kwaB 511 :NHCIVARIMHGGMIHRQG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1kwaB 530 :LHVGDEIREINGISVANQTVEQLQKMLREMRGSITFKIVP Number of specific fragments extracted= 4 number of extra gaps= 1 total=357 Number of alignments=91 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1pdr/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1pdr expands to /projects/compbio/data/pdb/1pdr.pdb.gz 1pdr:Warning: there is no chain 1pdr will retry with 1pdrA # T0340 read from 1pdr/merged-good-all-a2m # 1pdr read from 1pdr/merged-good-all-a2m # adding 1pdr to template set # found chain 1pdr in template set T0340 1 :SMLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 460 :ITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=359 Number of alignments=92 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 2 :MLRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 461 :TREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=361 Number of alignments=93 # 1pdr read from 1pdr/merged-good-all-a2m # found chain 1pdr in template set T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSG 1pdr 462 :REPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1pdr 506 :LRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYR Number of specific fragments extracted= 2 number of extra gaps= 0 total=363 Number of alignments=94 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1iu0A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments Warning: Couldn't open file /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m or /projects/compbio/experiments/protein-predict/casp7/T0340/1iu0A/merged-good-all-a2m.gz for input Trying 1iu0A/merged-good-all-a2m Error: Couldn't open file 1iu0A/merged-good-all-a2m or 1iu0A/merged-good-all-a2m.gz for input # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n99A/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1n99A expands to /projects/compbio/data/pdb/1n99.pdb.gz 1n99A:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1n99A/merged-good-all-a2m # 1n99A read from 1n99A/merged-good-all-a2m # adding 1n99A to template set # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=368 Number of alignments=95 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 17 :YGFNLHSD 1n99A 125 :IGLRLKSI T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAR 1n99A 133 :DNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQA T0340 76 :EDEARL 1n99A 183 :GEKITM T0340 84 :VGPS 1n99A 191 :RDRP Number of specific fragments extracted= 5 number of extra gaps= 1 total=373 Number of alignments=96 # 1n99A read from 1n99A/merged-good-all-a2m # found chain 1n99A in template set Warning: unaligning (T0340)P5 because first residue in template chain is (1n99A)P112 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1n99A)I190 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1n99A)I190 T0340 6 :RLCHLRKGPQG 1n99A 113 :REVILCKDQDG T0340 19 :FNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLL 1n99A 125 :IGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITM T0340 85 :GP 1n99A 191 :RD Number of specific fragments extracted= 3 number of extra gaps= 1 total=376 Number of alignments=97 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1g9oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1g9oA/merged-good-all-a2m # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPS 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPE T0340 88 :TR 1g9oA 97 :EQ Number of specific fragments extracted= 2 number of extra gaps= 0 total=378 Number of alignments=98 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1g9oA)R9 T0340 3 :LRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1g9oA 10 :MLPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDP T0340 87 :STRL 1g9oA 96 :DEQL Number of specific fragments extracted= 2 number of extra gaps= 0 total=380 Number of alignments=99 # 1g9oA read from 1g9oA/merged-good-all-a2m # found chain 1g9oA in training set T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGPSTRL 1g9oA 11 :LPRLCCLEKGPNGYGFHLHGEKGKLGQYIRLVEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDE Number of specific fragments extracted= 1 number of extra gaps= 0 total=381 Number of alignments=100 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1l6oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments 1l6oA expands to /projects/compbio/data/pdb/1l6o.pdb.gz 1l6oA:Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M Bad short name: MSE for alphabet: ExtAA Replacing MSE with M # T0340 read from 1l6oA/merged-good-all-a2m # 1l6oA read from 1l6oA/merged-good-all-a2m # adding 1l6oA to template set # found chain 1l6oA in template set Warning: unaligning (T0340)R4 because first residue in template chain is (1l6oA)M251 Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=395 Number of alignments=101 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)A74 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 24 :DKS 1l6oA 275 :ERG T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 75 :R 1l6oA 327 :I T0340 76 :EDEAR 1l6oA 331 :PGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 14 number of extra gaps= 12 total=409 Number of alignments=102 # 1l6oA read from 1l6oA/merged-good-all-a2m # found chain 1l6oA in template set Warning: unaligning (T0340)C8 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T256 Warning: unaligning (T0340)H9 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T256 Warning: unaligning (T0340)G13 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)K261 Warning: unaligning (T0340)P14 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)K261 Warning: unaligning (T0340)Q15 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N263 Warning: unaligning (T0340)G16 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)L265 Warning: unaligning (T0340)Y17 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)L265 Warning: unaligning (T0340)F19 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)S268 Warning: unaligning (T0340)N20 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)S268 Warning: unaligning (T0340)D24 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)N274 Warning: unaligning (T0340)R27 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)G279 Warning: unaligning (T0340)P28 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G279 Warning: unaligning (T0340)G29 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)G280 Warning: unaligning (T0340)A41 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)A293 Warning: unaligning (T0340)A42 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)A293 Warning: unaligning (T0340)N56 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D309 Warning: unaligning (T0340)G57 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)D309 Warning: unaligning (T0340)N59 because of BadResidue code CHAIN_BREAK_BEFORE in next template residue (1l6oA)F312 Warning: unaligning (T0340)V60 because of BadResidue code CHAIN_BREAK_BEFORE at template residue (1l6oA)F312 Warning: unaligning (T0340)G62 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)M315 Warning: unaligning (T0340)L63 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)M315 Warning: unaligning (T0340)R64 because of BadResidue code NON_PLANAR_PEPTIDE+BAD_PEPTIDE at template residue (1l6oA)S316 Warning: unaligning (T0340)K73 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)D326 Warning: unaligning (T0340)L81 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)T337 Warning: unaligning (T0340)L82 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)T337 Warning: unaligning (T0340)V83 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)A339 Warning: unaligning (T0340)V84 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)A339 Warning: unaligning (T0340)P86 because of BadResidue code NON_PLANAR_PEPTIDE in next template residue (1l6oA)E342 Warning: unaligning (T0340)S87 because of BadResidue code NON_PLANAR_PEPTIDE at template residue (1l6oA)E342 Warning: unaligning (T0340)T88 because of BadResidue code BAD_PEPTIDE in next template residue (1l6oA)H344 Warning: unaligning (T0340)R89 because of BadResidue code BAD_PEPTIDE at template residue (1l6oA)H344 T0340 5 :PRL 1l6oA 252 :IIT T0340 10 :LRK 1l6oA 257 :LNM T0340 18 :G 1l6oA 266 :G T0340 21 :LHS 1l6oA 269 :IVG T0340 25 :KS 1l6oA 275 :ER T0340 30 :QYIRSVDPGSP 1l6oA 281 :IYIGSIMKGGA T0340 43 :RSG 1l6oA 294 :ADG T0340 46 :LRAQDRLIEV 1l6oA 298 :IEPGDMLLQV T0340 58 :Q 1l6oA 310 :I T0340 61 :E 1l6oA 313 :E T0340 65 :HAEVVASI 1l6oA 317 :NDDAVRVL T0340 74 :AREDEAR 1l6oA 329 :HKPGPIV T0340 85 :G 1l6oA 340 :K Number of specific fragments extracted= 13 number of extra gaps= 13 total=422 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1q3oA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1q3oA/merged-good-all-a2m # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDK 1q3oA 601 :GFGFVLRGAK T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVGP 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV Number of specific fragments extracted= 3 number of extra gaps= 0 total=425 Number of alignments=103 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLRKGPQ 1q3oA 590 :KTVLLQKKDS T0340 16 :GYGFNLHSDKS 1q3oA 601 :GFGFVLRGAKA T0340 30 :QYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 628 :QYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=428 Number of alignments=104 # 1q3oA read from 1q3oA/merged-good-all-a2m # found chain 1q3oA in training set T0340 6 :RLCHLR 1q3oA 590 :KTVLLQ T0340 12 :KGPQGYGFNLHSDKS 1q3oA 597 :KDSEGFGFVLRGAKA T0340 27 :RPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1q3oA 625 :PALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVM Number of specific fragments extracted= 3 number of extra gaps= 0 total=431 Number of alignments=105 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1n7fA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1n7fA/merged-good-all-a2m # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKSRP 1n7fA 669 :IIYTVELKRYGGPLGITISGTEEPF T0340 29 :GQYIRSVDPGSPAARSG 1n7fA 695 :PIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=434 Number of alignments=106 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=437 Number of alignments=107 # 1n7fA read from 1n7fA/merged-good-all-a2m # found chain 1n7fA in training set Warning: unaligning (T0340)L3 because first residue in template chain is (1n7fA)A668 Warning: unaligning (T0340)P86 because last residue in template chain is (1n7fA)Q753 T0340 4 :RPRLCHLRKGPQGYGFNLHSDKS 1n7fA 669 :IIYTVELKRYGGPLGITISGTEE T0340 27 :RPGQYIRSVDPGSPAARSG 1n7fA 693 :FDPIIISSLTKGGLAERTG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1n7fA 713 :IHIGDRILAINSSSLKGKPLSEAIHLLQMAGETVTLKIKK Number of specific fragments extracted= 3 number of extra gaps= 0 total=440 Number of alignments=108 # Reading fragments from alignment file # Attempting to read fragment alignments from file 1ihjA/merged-good-all-a2m with NO bystroff filtering # adding to alignment library if long or multiple fragments # T0340 read from 1ihjA/merged-good-all-a2m # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDK 1ihjA 26 :KSFGICIVRGE T0340 27 :RP 1ihjA 43 :TK T0340 29 :GQYIRSVDPGSPAARSG 1ihjA 47 :GIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 5 number of extra gaps= 1 total=445 Number of alignments=109 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)D24 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE in next template residue (1ihjA)P41 Warning: unaligning (T0340)K25 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)P41 Warning: unaligning (T0340)S26 because of BadResidue code CHAIN_BREAK_BEFORE+BAD_PEPTIDE at template residue (1ihjA)N42 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHS 1ihjA 26 :KSFGICIVR T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 1 total=449 Number of alignments=110 # 1ihjA read from 1ihjA/merged-good-all-a2m # found chain 1ihjA in training set Warning: unaligning (T0340)M2 because first residue in template chain is (1ihjA)G12 Warning: unaligning (T0340)P86 because last residue in template chain is (1ihjA)F105 T0340 3 :LRPRLCHLRKGP 1ihjA 13 :ELIHMVTLDKTG T0340 15 :QGYGFNLHSDKS 1ihjA 26 :KSFGICIVRGEV T0340 27 :RPGQYIRSVDPGSPAARSG 1ihjA 45 :TTGIFIKGIVPDSPAHLCG T0340 46 :LRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVVG 1ihjA 65 :LKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQT Number of specific fragments extracted= 4 number of extra gaps= 0 total=453 Number of alignments=111 # command:Using radius: 19.0000 NUMB_ALIGNS: 111 evalue: 0 0.0000, weight 1.0000 evalue: 1 0.0000, weight 1.0000 evalue: 2 0.0000, weight 1.0000 evalue: 3 0.0000, weight 0.9999 evalue: 4 0.0000, weight 0.9999 evalue: 5 0.0000, weight 0.9999 evalue: 6 0.0000, weight 1.0000 evalue: 7 0.0000, weight 1.0000 evalue: 8 0.0000, weight 1.0000 evalue: 9 0.0000, weight 0.9996 evalue: 10 0.0000, weight 0.9996 evalue: 11 0.0000, weight 0.9996 evalue: 12 0.0000, weight 1.0000 evalue: 13 0.0000, weight 1.0000 evalue: 14 0.0000, weight 1.0000 evalue: 15 0.0000, weight 1.0000 evalue: 16 0.0000, weight 1.0000 evalue: 17 0.0000, weight 1.0000 evalue: 18 0.0000, weight 1.0000 evalue: 19 0.0000, weight 1.0000 evalue: 20 0.0000, weight 1.0000 evalue: 21 0.0000, weight 1.0000 evalue: 22 0.0000, weight 1.0000 evalue: 23 0.0000, weight 1.0000 evalue: 24 0.0000, weight 1.0000 evalue: 25 0.0000, weight 1.0000 evalue: 26 0.0000, weight 1.0000 evalue: 27 0.0000, weight 1.0000 evalue: 28 0.0000, weight 1.0000 evalue: 29 0.0000, weight 1.0000 evalue: 30 0.0000, weight 1.0000 evalue: 31 0.0000, weight 1.0000 evalue: 32 0.0000, weight 1.0000 evalue: 33 0.0000, weight 1.0000 evalue: 34 0.0000, weight 1.0000 evalue: 35 0.0000, weight 1.0000 evalue: 36 0.0000, weight 1.0000 evalue: 37 0.0000, weight 1.0000 evalue: 38 0.0000, weight 1.0000 evalue: 39 0.0057, weight 0.7073 evalue: 40 0.0057, weight 0.7073 evalue: 41 0.0057, weight 0.7073 evalue: 42 0.0025, weight 0.8736 evalue: 43 0.0025, weight 0.8736 evalue: 44 0.0025, weight 0.8736 evalue: 45 0.0000, weight 1.0000 evalue: 46 0.0000, weight 1.0000 evalue: 47 0.0000, weight 1.0000 evalue: 48 0.0000, weight 0.9999 evalue: 49 0.0000, weight 0.9999 evalue: 50 0.0000, weight 0.9999 evalue: 51 0.0000, weight 1.0000 evalue: 52 0.0000, weight 1.0000 evalue: 53 0.0000, weight 1.0000 evalue: 54 0.0000, weight 1.0000 evalue: 55 0.0000, weight 1.0000 evalue: 56 0.0000, weight 1.0000 evalue: 57 0.0000, weight 1.0000 evalue: 58 0.0000, weight 1.0000 evalue: 59 0.0000, weight 1.0000 evalue: 60 0.0000, weight 1.0000 evalue: 61 0.0000, weight 1.0000 evalue: 62 0.0000, weight 1.0000 evalue: 63 0.0000, weight 0.9999 evalue: 64 0.0000, weight 0.9999 evalue: 65 0.0000, weight 0.9999 evalue: 66 0.0000, weight 1.0000 evalue: 67 0.0000, weight 1.0000 evalue: 68 0.0000, weight 1.0000 evalue: 69 0.0000, weight 1.0000 evalue: 70 0.0000, weight 1.0000 evalue: 71 0.0000, weight 1.0000 evalue: 72 0.0000, weight 1.0000 evalue: 73 0.0000, weight 1.0000 evalue: 74 0.0000, weight 1.0000 evalue: 75 0.0000, weight 1.0000 evalue: 76 0.0000, weight 1.0000 evalue: 77 0.0000, weight 1.0000 evalue: 78 0.0000, weight 1.0000 evalue: 79 0.0175, weight 0.1000 evalue: 80 0.0175, weight 0.1000 evalue: 81 0.0175, weight 0.1000 evalue: 82 0.0000, weight 1.0000 evalue: 83 0.0000, weight 1.0000 evalue: 84 0.0000, weight 1.0000 evalue: 85 0.0000, weight 1.0000 evalue: 86 0.0000, weight 1.0000 evalue: 87 0.0000, weight 1.0000 evalue: 88 0.0000, weight 0.9981 evalue: 89 0.0000, weight 0.9981 evalue: 90 0.0000, weight 0.9981 evalue: 91 0.0000, weight 1.0000 evalue: 92 0.0000, weight 1.0000 evalue: 93 0.0000, weight 1.0000 evalue: 94 0.0000, weight 0.9999 evalue: 95 0.0000, weight 0.9999 evalue: 96 0.0000, weight 0.9999 evalue: 97 0.0000, weight 1.0000 evalue: 98 0.0000, weight 1.0000 evalue: 99 0.0000, weight 1.0000 evalue: 100 0.0000, weight 1.0000 evalue: 101 0.0000, weight 1.0000 evalue: 102 0.0000, weight 1.0000 evalue: 103 0.0000, weight 1.0000 evalue: 104 0.0000, weight 1.0000 evalue: 105 0.0000, weight 1.0000 evalue: 106 0.0000, weight 1.0000 evalue: 107 0.0000, weight 1.0000 evalue: 108 0.0000, weight 1.0000 evalue: 109 0.0000, weight 1.0000 evalue: 110 0.0000, weight 1.0000 RES2ATOM 0 2 RES2ATOM 1 8 RES2ATOM 2 16 RES2ATOM 3 24 RES2ATOM 4 35 RES2ATOM 5 42 RES2ATOM 6 53 RES2ATOM 7 61 RES2ATOM 8 67 RES2ATOM 9 77 RES2ATOM 10 85 RES2ATOM 11 96 RES2ATOM 13 109 RES2ATOM 14 116 RES2ATOM 16 129 RES2ATOM 18 145 RES2ATOM 19 156 RES2ATOM 20 164 RES2ATOM 21 172 RES2ATOM 22 182 RES2ATOM 23 188 RES2ATOM 24 196 RES2ATOM 25 205 RES2ATOM 26 211 RES2ATOM 27 222 RES2ATOM 29 233 RES2ATOM 30 242 RES2ATOM 31 254 RES2ATOM 32 262 RES2ATOM 33 273 RES2ATOM 34 279 RES2ATOM 35 286 RES2ATOM 36 294 RES2ATOM 38 305 RES2ATOM 39 311 RES2ATOM 40 318 RES2ATOM 41 323 RES2ATOM 42 328 RES2ATOM 43 339 RES2ATOM 45 349 RES2ATOM 46 357 RES2ATOM 47 368 RES2ATOM 48 373 RES2ATOM 49 382 RES2ATOM 50 390 RES2ATOM 51 401 RES2ATOM 52 409 RES2ATOM 53 417 RES2ATOM 54 426 RES2ATOM 55 433 RES2ATOM 57 445 RES2ATOM 58 454 RES2ATOM 59 462 RES2ATOM 60 469 RES2ATOM 62 482 RES2ATOM 63 490 RES2ATOM 64 501 RES2ATOM 65 511 RES2ATOM 66 516 RES2ATOM 67 525 RES2ATOM 68 532 RES2ATOM 69 539 RES2ATOM 70 544 RES2ATOM 71 550 RES2ATOM 72 558 RES2ATOM 73 567 RES2ATOM 74 572 RES2ATOM 75 583 RES2ATOM 76 592 RES2ATOM 77 600 RES2ATOM 78 609 RES2ATOM 79 614 RES2ATOM 80 625 RES2ATOM 81 633 RES2ATOM 82 641 RES2ATOM 83 648 RES2ATOM 85 659 RES2ATOM 86 666 RES2ATOM 87 672 RES2ATOM 88 679 RES2ATOM 89 690 Constraint 427 551 5.1573 6.4467 9.6700 107.0345 Constraint 427 545 4.3444 5.4306 8.1458 107.0345 Constraint 427 540 8.2813 10.3517 15.5275 107.0345 Constraint 427 533 8.3726 10.4657 15.6986 107.0345 Constraint 427 526 5.8083 7.2604 10.8906 107.0345 Constraint 427 517 8.1249 10.1561 15.2342 107.0345 Constraint 427 512 10.9570 13.6963 20.5444 107.0345 Constraint 418 551 9.3489 11.6861 17.5291 107.0345 Constraint 418 545 7.9544 9.9430 14.9145 107.0345 Constraint 418 540 11.8612 14.8265 22.2398 107.0345 Constraint 418 533 11.9204 14.9005 22.3508 107.0345 Constraint 418 526 8.2992 10.3740 15.5609 107.0345 Constraint 418 517 10.2372 12.7965 19.1948 107.0345 Constraint 418 512 13.6280 17.0350 25.5525 107.0345 Constraint 410 551 10.8925 13.6156 20.4233 107.0345 Constraint 410 545 10.1339 12.6674 19.0011 107.0345 Constraint 410 540 13.5006 16.8757 25.3136 107.0345 Constraint 410 533 12.5787 15.7234 23.5851 107.0345 Constraint 410 526 8.6572 10.8215 16.2323 107.0345 Constraint 410 517 11.0859 13.8574 20.7860 107.0345 Constraint 402 551 7.2400 9.0500 13.5750 107.0345 Constraint 402 545 8.0518 10.0647 15.0971 107.0345 Constraint 402 540 10.8657 13.5822 20.3732 107.0345 Constraint 402 533 8.8831 11.1038 16.6558 107.0345 Constraint 402 526 5.7178 7.1472 10.7208 107.0345 Constraint 402 517 9.4447 11.8059 17.7088 107.0345 Constraint 402 512 11.2404 14.0504 21.0757 107.0345 Constraint 374 526 13.0789 16.3486 24.5229 107.0345 Constraint 369 551 13.3498 16.6873 25.0309 107.0345 Constraint 295 374 13.2889 16.6112 24.9167 107.0345 Constraint 295 369 9.7210 12.1512 18.2268 107.0345 Constraint 295 358 10.3781 12.9727 19.4590 107.0345 Constraint 287 551 11.2266 14.0333 21.0499 107.0345 Constraint 287 533 12.5601 15.7002 23.5502 107.0345 Constraint 287 402 12.7118 15.8897 23.8346 107.0345 Constraint 287 374 12.3289 15.4111 23.1167 107.0345 Constraint 287 369 8.8866 11.1082 16.6623 107.0345 Constraint 287 358 10.1242 12.6552 18.9829 107.0345 Constraint 280 551 11.2819 14.1024 21.1535 107.0345 Constraint 280 533 12.9291 16.1614 24.2421 107.0345 Constraint 280 427 12.9721 16.2151 24.3227 107.0345 Constraint 280 410 13.9825 17.4782 26.2173 107.0345 Constraint 280 402 10.0312 12.5389 18.8084 107.0345 Constraint 280 374 8.1748 10.2185 15.3277 107.0345 Constraint 280 369 4.9922 6.2402 9.3603 107.0345 Constraint 280 358 5.5931 6.9913 10.4870 107.0345 Constraint 255 551 9.1441 11.4302 17.1453 107.0345 Constraint 255 545 11.7915 14.7393 22.1090 107.0345 Constraint 255 540 13.5571 16.9464 25.4196 107.0345 Constraint 255 533 10.1918 12.7398 19.1097 107.0345 Constraint 255 526 8.8877 11.1096 16.6644 107.0345 Constraint 255 427 9.7465 12.1831 18.2746 107.0345 Constraint 255 418 10.9157 13.6447 20.4670 107.0345 Constraint 255 410 9.3707 11.7134 17.5701 107.0345 Constraint 255 402 5.3952 6.7440 10.1159 107.0345 Constraint 255 374 5.4505 6.8131 10.2196 107.0345 Constraint 255 369 4.5704 5.7130 8.5694 107.0345 Constraint 255 358 5.6349 7.0436 10.5654 107.0345 Constraint 243 551 10.9062 13.6328 20.4492 107.0345 Constraint 243 545 12.3848 15.4811 23.2216 107.0345 Constraint 243 533 10.4635 13.0794 19.6191 107.0345 Constraint 243 526 8.4302 10.5378 15.8066 107.0345 Constraint 243 517 11.9082 14.8853 22.3279 107.0345 Constraint 243 512 11.9897 14.9872 22.4808 107.0345 Constraint 243 427 10.9350 13.6688 20.5031 107.0345 Constraint 243 418 11.2313 14.0391 21.0586 107.0345 Constraint 243 410 8.6712 10.8389 16.2584 107.0345 Constraint 243 402 5.8440 7.3050 10.9575 107.0345 Constraint 243 374 5.3650 6.7063 10.0594 107.0345 Constraint 243 369 6.6409 8.3012 12.4517 107.0345 Constraint 243 358 8.5329 10.6662 15.9993 107.0345 Constraint 545 615 9.5199 11.8999 17.8499 106.1609 Constraint 540 610 10.6863 13.3578 20.0367 106.1609 Constraint 533 615 13.5244 16.9054 25.3582 106.1609 Constraint 533 610 10.4329 13.0411 19.5617 106.1609 Constraint 526 615 11.4311 14.2889 21.4333 106.1609 Constraint 526 610 9.6501 12.0626 18.0939 106.1609 Constraint 427 615 5.9554 7.4442 11.1663 106.1609 Constraint 427 610 5.3669 6.7087 10.0630 106.1609 Constraint 418 615 6.4589 8.0737 12.1105 106.1609 Constraint 418 610 8.5869 10.7337 16.1005 106.1609 Constraint 410 615 9.3018 11.6272 17.4408 106.1609 Constraint 402 615 8.9693 11.2116 16.8173 106.1609 Constraint 402 610 8.6469 10.8086 16.2129 106.1609 Constraint 280 615 13.7572 17.1965 25.7947 106.1609 Constraint 255 615 12.0781 15.0976 22.6464 106.1609 Constraint 391 551 11.6452 14.5565 21.8348 106.0345 Constraint 391 533 12.3781 15.4726 23.2089 106.0345 Constraint 391 526 9.1213 11.4016 17.1025 106.0345 Constraint 383 551 11.3229 14.1536 21.2304 106.0345 Constraint 295 383 13.2007 16.5009 24.7513 106.0345 Constraint 287 383 11.6001 14.5001 21.7502 106.0345 Constraint 280 391 11.2578 14.0722 21.1083 106.0345 Constraint 280 383 7.4586 9.3233 13.9849 106.0345 Constraint 274 551 11.6329 14.5411 21.8117 106.0345 Constraint 274 533 11.5881 14.4852 21.7277 106.0345 Constraint 274 526 12.2607 15.3259 22.9888 106.0345 Constraint 274 402 10.7787 13.4734 20.2102 106.0345 Constraint 274 391 11.5707 14.4633 21.6950 106.0345 Constraint 274 383 9.0684 11.3355 17.0033 106.0345 Constraint 274 374 8.2278 10.2848 15.4272 106.0345 Constraint 274 369 4.9792 6.2240 9.3360 106.0345 Constraint 274 358 8.2426 10.3033 15.4549 106.0345 Constraint 263 551 10.9036 13.6295 20.4442 106.0345 Constraint 263 533 10.0452 12.5565 18.8347 106.0345 Constraint 263 526 10.0064 12.5080 18.7620 106.0345 Constraint 263 512 12.3753 15.4691 23.2037 106.0345 Constraint 263 427 12.9033 16.1292 24.1937 106.0345 Constraint 263 410 12.8456 16.0570 24.0856 106.0345 Constraint 263 402 8.8045 11.0056 16.5084 106.0345 Constraint 263 391 9.0019 11.2524 16.8786 106.0345 Constraint 263 383 7.9167 9.8959 14.8439 106.0345 Constraint 263 374 6.8068 8.5085 12.7627 106.0345 Constraint 263 369 5.1919 6.4898 9.7347 106.0345 Constraint 263 358 8.7381 10.9226 16.3839 106.0345 Constraint 255 391 6.2447 7.8059 11.7089 106.0345 Constraint 255 383 3.8239 4.7799 7.1698 106.0345 Constraint 243 391 4.4009 5.5011 8.2516 106.0345 Constraint 243 383 5.5785 6.9732 10.4598 106.0345 Constraint 410 610 10.9937 13.7422 20.6132 105.1610 Constraint 280 610 11.5753 14.4691 21.7037 105.1610 Constraint 358 615 13.5517 16.9396 25.4093 105.0610 Constraint 255 610 10.6046 13.2557 19.8836 105.0610 Constraint 434 551 7.4311 9.2888 13.9332 105.0345 Constraint 434 545 6.1666 7.7083 11.5624 105.0345 Constraint 434 540 9.9959 12.4949 18.7423 105.0345 Constraint 434 533 11.2115 14.0144 21.0216 105.0345 Constraint 434 526 9.2940 11.6175 17.4262 105.0345 Constraint 434 517 10.6443 13.3054 19.9581 105.0345 Constraint 319 434 12.2514 15.3143 22.9714 105.0345 Constraint 319 402 9.0658 11.3323 16.9984 105.0345 Constraint 255 434 13.0631 16.3289 24.4934 105.0345 Constraint 255 319 6.4921 8.1151 12.1727 105.0345 Constraint 427 502 10.3319 12.9148 19.3722 104.9127 Constraint 418 502 12.3546 15.4433 23.1650 104.9127 Constraint 410 502 11.6736 14.5921 21.8881 104.9127 Constraint 402 502 8.6605 10.8256 16.2384 104.9127 Constraint 255 502 9.9730 12.4662 18.6994 104.9127 Constraint 243 502 8.1071 10.1339 15.2008 104.9127 Constraint 517 610 12.2591 15.3239 22.9859 104.1611 Constraint 434 615 4.4399 5.5499 8.3248 104.1609 Constraint 434 610 5.0027 6.2534 9.3801 104.1609 Constraint 319 615 10.3670 12.9587 19.4380 104.1609 Constraint 319 610 8.0082 10.0103 15.0155 104.1609 Constraint 391 615 12.3822 15.4778 23.2167 104.0610 Constraint 383 615 11.3495 14.1869 21.2803 104.0610 Constraint 383 610 11.3755 14.2194 21.3290 104.0610 Constraint 369 526 13.0849 16.3561 24.5341 104.0403 Constraint 358 551 13.7150 17.1438 25.7157 104.0348 Constraint 280 526 12.8561 16.0702 24.1053 104.0348 Constraint 255 517 12.9479 16.1849 24.2773 104.0348 Constraint 446 551 8.3231 10.4038 15.6057 104.0348 Constraint 446 545 5.1155 6.3943 9.5915 104.0348 Constraint 446 540 8.7013 10.8766 16.3150 104.0348 Constraint 446 533 10.3759 12.9699 19.4549 104.0348 Constraint 446 526 7.4871 9.3589 14.0384 104.0348 Constraint 446 517 7.6196 9.5245 14.2868 104.0348 Constraint 350 551 10.1666 12.7083 19.0624 104.0348 Constraint 350 533 12.9462 16.1828 24.2742 104.0348 Constraint 350 526 11.7125 14.6406 21.9609 104.0348 Constraint 350 427 10.0418 12.5523 18.8284 104.0348 Constraint 312 551 9.6002 12.0003 18.0004 104.0348 Constraint 312 533 13.1552 16.4440 24.6660 104.0348 Constraint 312 427 11.3360 14.1700 21.2551 104.0348 Constraint 312 402 11.7735 14.7169 22.0753 104.0348 Constraint 295 350 9.8184 12.2730 18.4095 104.0348 Constraint 287 350 8.4112 10.5140 15.7710 104.0348 Constraint 280 350 4.7849 5.9812 8.9718 104.0348 Constraint 255 446 13.5757 16.9696 25.4544 104.0348 Constraint 255 350 4.9044 6.1304 9.1957 104.0348 Constraint 243 446 13.7270 17.1587 25.7381 104.0348 Constraint 243 350 9.0028 11.2536 16.8803 104.0348 Constraint 410 512 13.8913 17.3641 26.0462 104.0348 Constraint 463 551 7.5290 9.4112 14.1168 104.0345 Constraint 463 545 5.8445 7.3056 10.9583 104.0345 Constraint 463 540 8.6850 10.8562 16.2843 104.0345 Constraint 463 533 8.2698 10.3372 15.5058 104.0345 Constraint 391 463 7.3645 9.2056 13.8085 104.0345 Constraint 383 463 9.8052 12.2565 18.3847 104.0345 Constraint 374 463 12.7930 15.9912 23.9869 104.0345 Constraint 369 463 13.8074 17.2593 25.8889 104.0345 Constraint 358 463 13.8250 17.2812 25.9219 104.0345 Constraint 319 383 8.0638 10.0798 15.1196 104.0345 Constraint 263 463 11.8480 14.8100 22.2150 104.0345 Constraint 255 463 9.5278 11.9097 17.8645 104.0345 Constraint 243 463 8.6519 10.8148 16.2222 104.0345 Constraint 434 559 9.8081 12.2601 18.3901 104.0345 Constraint 427 559 8.5941 10.7426 16.1139 104.0345 Constraint 418 559 12.9254 16.1567 24.2351 104.0345 Constraint 402 559 11.2650 14.0813 21.1220 104.0345 Constraint 255 559 12.6614 15.8267 23.7401 104.0345 Constraint 369 533 13.9497 17.4371 26.1557 104.0345 Constraint 255 512 13.1472 16.4340 24.6510 104.0345 Constraint 243 540 13.6939 17.1173 25.6760 104.0345 Constraint 391 502 10.4362 13.0452 19.5679 103.9127 Constraint 383 502 12.3714 15.4642 23.1963 103.9127 Constraint 274 502 11.8152 14.7690 22.1535 103.9127 Constraint 263 502 8.8734 11.0917 16.6375 103.9127 Constraint 287 610 12.0214 15.0267 22.5401 103.7390 Constraint 427 573 6.0282 7.5353 11.3029 103.4137 Constraint 446 615 8.2936 10.3670 15.5506 103.1612 Constraint 446 610 8.9446 11.1808 16.7712 103.1612 Constraint 350 615 9.7757 12.2197 18.3295 103.1612 Constraint 350 610 8.9079 11.1349 16.7024 103.1612 Constraint 312 615 10.1309 12.6636 18.9955 103.1612 Constraint 312 610 7.1449 8.9311 13.3966 103.1612 Constraint 463 615 9.8965 12.3707 18.5560 103.1609 Constraint 463 610 9.8524 12.3154 18.4732 103.1609 Constraint 427 584 10.0737 12.5921 18.8882 103.1609 Constraint 427 601 9.1248 11.4060 17.1090 103.1609 Constraint 391 610 12.8209 16.0261 24.0391 103.0611 Constraint 540 615 13.3540 16.6925 25.0387 103.0609 Constraint 391 545 12.1234 15.1543 22.7314 103.0349 Constraint 391 517 12.2306 15.2882 22.9323 103.0349 Constraint 383 533 12.9355 16.1694 24.2541 103.0349 Constraint 383 526 10.5350 13.1688 19.7531 103.0349 Constraint 312 383 11.7008 14.6260 21.9390 103.0348 Constraint 306 551 10.7739 13.4673 20.2010 103.0348 Constraint 306 402 12.5860 15.7325 23.5988 103.0348 Constraint 306 383 11.6649 14.5812 21.8717 103.0348 Constraint 306 369 10.3747 12.9684 19.4526 103.0348 Constraint 274 350 8.3567 10.4458 15.6687 103.0348 Constraint 263 350 9.0576 11.3220 16.9830 103.0348 Constraint 263 418 14.5521 18.1902 27.2853 103.0346 Constraint 274 427 14.1620 17.7025 26.5537 103.0345 Constraint 463 559 10.7589 13.4487 20.1730 103.0345 Constraint 324 551 12.8991 16.1238 24.1857 103.0345 Constraint 324 402 12.6475 15.8094 23.7141 103.0345 Constraint 255 324 9.0076 11.2595 16.8892 103.0345 Constraint 470 551 11.9553 14.9441 22.4162 103.0345 Constraint 470 545 9.9399 12.4248 18.6372 103.0345 Constraint 470 540 12.2839 15.3549 23.0324 103.0345 Constraint 402 470 7.5546 9.4432 14.1648 103.0345 Constraint 391 470 7.6333 9.5416 14.3124 103.0345 Constraint 383 470 11.4717 14.3396 21.5094 103.0345 Constraint 243 470 9.8959 12.3699 18.5548 103.0345 Constraint 243 610 13.4706 16.8383 25.2574 102.8611 Constraint 526 649 11.6832 14.6040 21.9060 102.8610 Constraint 434 649 13.2077 16.5096 24.7644 102.8610 Constraint 427 649 10.6245 13.2807 19.9210 102.8610 Constraint 418 649 7.9641 9.9551 14.9327 102.8610 Constraint 410 649 4.6359 5.7949 8.6923 102.8610 Constraint 402 649 6.6336 8.2920 12.4381 102.8610 Constraint 374 649 8.0605 10.0756 15.1135 102.8610 Constraint 369 649 10.7464 13.4330 20.1495 102.8610 Constraint 358 649 9.0881 11.3601 17.0402 102.8610 Constraint 280 649 12.8895 16.1119 24.1678 102.8610 Constraint 255 649 8.6502 10.8128 16.2192 102.8610 Constraint 243 649 7.9352 9.9190 14.8785 102.8610 Constraint 383 545 13.0714 16.3393 24.5089 102.7349 Constraint 434 568 7.7345 9.6681 14.5021 102.4136 Constraint 427 568 7.9422 9.9277 14.8915 102.4136 Constraint 243 615 14.4155 18.0194 27.0291 102.3137 Constraint 306 615 13.2836 16.6045 24.9068 102.1612 Constraint 306 610 10.0894 12.6118 18.9176 102.1612 Constraint 324 615 13.6269 17.0337 25.5505 102.1609 Constraint 324 610 11.5836 14.4795 21.7192 102.1609 Constraint 418 601 11.3570 14.1962 21.2943 102.0610 Constraint 402 601 12.6923 15.8653 23.7980 102.0610 Constraint 319 551 8.8773 11.0967 16.6450 102.0359 Constraint 319 545 12.4714 15.5892 23.3839 102.0359 Constraint 319 533 11.8290 14.7863 22.1794 102.0359 Constraint 319 526 11.5910 14.4887 21.7330 102.0359 Constraint 319 427 10.3105 12.8881 19.3321 102.0359 Constraint 319 418 12.5589 15.6986 23.5479 102.0359 Constraint 319 410 12.6806 15.8507 23.7761 102.0359 Constraint 243 319 10.6854 13.3567 20.0350 102.0359 Constraint 455 551 11.0447 13.8059 20.7088 102.0348 Constraint 455 545 8.3051 10.3814 15.5720 102.0348 Constraint 455 540 11.5244 14.4055 21.6083 102.0348 Constraint 455 533 12.2858 15.3573 23.0359 102.0348 Constraint 455 526 8.3771 10.4713 15.7070 102.0348 Constraint 350 434 12.1823 15.2279 22.8418 102.0348 Constraint 312 434 11.9803 14.9754 22.4632 102.0348 Constraint 255 455 13.3622 16.7028 25.0542 102.0348 Constraint 243 455 12.3601 15.4501 23.1752 102.0348 Constraint 434 512 13.6887 17.1109 25.6664 102.0345 Constraint 358 610 13.1397 16.4246 24.6369 101.9392 Constraint 350 446 14.2266 17.7832 26.6748 101.9130 Constraint 374 502 13.1353 16.4191 24.6287 101.9127 Constraint 463 649 9.0077 11.2597 16.8895 101.8610 Constraint 391 649 3.8450 4.8062 7.2094 101.8610 Constraint 383 649 5.5637 6.9547 10.4320 101.8610 Constraint 263 649 12.1777 15.2221 22.8332 101.8610 Constraint 287 559 12.5998 15.7498 23.6246 101.6127 Constraint 312 573 9.7433 12.1791 18.2687 101.4139 Constraint 434 573 5.2901 6.6126 9.9189 101.4137 Constraint 434 584 8.0417 10.0522 15.0783 101.1609 Constraint 434 601 6.8370 8.5462 12.8193 101.1609 Constraint 319 601 10.6825 13.3531 20.0296 101.1609 Constraint 455 615 10.3127 12.8909 19.3364 101.0612 Constraint 470 615 12.8983 16.1228 24.1842 101.0610 Constraint 312 545 13.1526 16.4408 24.6612 101.0361 Constraint 319 391 11.4158 14.2697 21.4046 101.0359 Constraint 319 559 11.7796 14.7245 22.0867 101.0359 Constraint 350 545 13.0220 16.2775 24.4163 101.0351 Constraint 383 455 12.6760 15.8450 23.7675 101.0348 Constraint 350 463 11.6655 14.5818 21.8728 101.0348 Constraint 280 340 7.7758 9.7197 14.5796 101.0348 Constraint 255 340 9.6520 12.0650 18.0975 101.0348 Constraint 446 559 10.6325 13.2906 19.9359 101.0348 Constraint 350 559 13.7230 17.1538 25.7306 101.0348 Constraint 312 559 11.4146 14.2683 21.4024 101.0348 Constraint 234 551 7.7676 9.7095 14.5642 101.0345 Constraint 234 545 8.1640 10.2050 15.3076 101.0345 Constraint 234 540 9.7259 12.1573 18.2360 101.0345 Constraint 234 533 7.2763 9.0954 13.6431 101.0345 Constraint 234 526 4.1983 5.2479 7.8719 101.0345 Constraint 234 517 7.5498 9.4373 14.1559 101.0345 Constraint 234 512 8.5541 10.6927 16.0390 101.0345 Constraint 234 427 7.3862 9.2328 13.8492 101.0345 Constraint 234 418 8.2142 10.2677 15.4015 101.0345 Constraint 234 410 6.7533 8.4417 12.6625 101.0345 Constraint 234 402 3.7955 4.7444 7.1166 101.0345 Constraint 234 374 9.4909 11.8636 17.7955 101.0345 Constraint 234 369 10.3530 12.9412 19.4118 101.0345 Constraint 234 358 11.4505 14.3131 21.4697 101.0345 Constraint 263 545 13.5628 16.9535 25.4302 100.9130 Constraint 551 642 10.5886 13.2358 19.8537 100.8612 Constraint 526 642 10.2199 12.7749 19.1623 100.8612 Constraint 434 642 10.5377 13.1722 19.7582 100.8612 Constraint 427 642 8.1308 10.1635 15.2452 100.8612 Constraint 418 642 6.9738 8.7173 13.0759 100.8612 Constraint 410 642 5.4265 6.7831 10.1747 100.8612 Constraint 402 642 4.7055 5.8818 8.8228 100.8612 Constraint 374 642 7.9340 9.9175 14.8763 100.8612 Constraint 369 642 9.1149 11.3937 17.0905 100.8612 Constraint 358 642 6.9039 8.6299 12.9448 100.8612 Constraint 319 642 8.6497 10.8121 16.2182 100.8612 Constraint 287 642 13.2954 16.6193 24.9289 100.8612 Constraint 280 642 9.6365 12.0456 18.0684 100.8612 Constraint 255 642 6.2359 7.7949 11.6923 100.8612 Constraint 243 642 7.8388 9.7985 14.6977 100.8612 Constraint 306 573 12.2254 15.2818 22.9227 100.4139 Constraint 418 568 11.8385 14.7981 22.1972 100.4136 Constraint 340 615 9.0918 11.3648 17.0471 100.1612 Constraint 340 610 8.4520 10.5649 15.8474 100.1612 Constraint 312 584 10.2542 12.8178 19.2266 100.1612 Constraint 312 601 8.4293 10.5366 15.8048 100.1612 Constraint 470 610 13.8865 17.3581 26.0372 100.0611 Constraint 324 391 14.2167 17.7708 26.6563 100.0359 Constraint 263 324 10.9833 13.7291 20.5937 100.0359 Constraint 243 324 13.1904 16.4880 24.7320 100.0359 Constraint 306 374 13.3990 16.7487 25.1231 100.0351 Constraint 391 512 13.6728 17.0910 25.6365 100.0349 Constraint 306 427 13.3203 16.6504 24.9756 100.0348 Constraint 255 329 11.7384 14.6731 22.0096 100.0348 Constraint 234 391 5.4829 6.8536 10.2804 100.0345 Constraint 234 383 7.6844 9.6055 14.4083 100.0345 Constraint 255 470 12.0456 15.0570 22.5856 100.0345 Constraint 319 649 12.5386 15.6733 23.5100 99.8623 Constraint 455 649 9.9600 12.4500 18.6750 99.8613 Constraint 446 649 12.5543 15.6929 23.5394 99.8613 Constraint 350 649 9.4384 11.7980 17.6970 99.8613 Constraint 463 642 8.4268 10.5335 15.8002 99.8612 Constraint 391 642 5.1629 6.4536 9.6805 99.8612 Constraint 383 642 3.6126 4.5158 6.7736 99.8612 Constraint 274 642 11.8308 14.7885 22.1828 99.8612 Constraint 263 642 10.7007 13.3759 20.0638 99.8612 Constraint 402 573 10.1819 12.7273 19.0910 99.7064 Constraint 319 573 10.8309 13.5387 20.3080 99.4146 Constraint 446 568 8.5782 10.7228 16.0842 99.4139 Constraint 463 568 10.5446 13.1807 19.7711 99.4136 Constraint 319 584 12.6587 15.8234 23.7351 99.1613 Constraint 350 601 11.7468 14.6835 22.0253 99.1613 Constraint 340 601 9.4598 11.8248 17.7372 99.1612 Constraint 329 615 12.3686 15.4608 23.1912 99.1612 Constraint 329 610 10.6981 13.3726 20.0590 99.1612 Constraint 329 601 11.2003 14.0004 21.0005 99.1612 Constraint 306 601 12.1164 15.1456 22.7183 99.1612 Constraint 455 610 11.8121 14.7651 22.1476 99.0614 Constraint 446 601 11.5308 14.4135 21.6202 99.0613 Constraint 234 615 12.1694 15.2118 22.8177 99.0610 Constraint 234 610 11.1612 13.9516 20.9273 99.0610 Constraint 263 559 13.2976 16.6220 24.9330 99.0346 Constraint 234 434 11.2674 14.0843 21.1264 99.0345 Constraint 274 610 13.7936 17.2421 25.8631 98.9920 Constraint 410 601 14.1959 17.7449 26.6174 98.9392 Constraint 369 502 13.0932 16.3666 24.5498 98.9184 Constraint 234 502 5.3901 6.7376 10.1064 98.9127 Constraint 545 642 11.6967 14.6209 21.9314 98.8614 Constraint 533 642 13.0901 16.3626 24.5439 98.8614 Constraint 324 642 11.4487 14.3109 21.4663 98.8612 Constraint 551 649 13.5358 16.9198 25.3797 98.8610 Constraint 470 649 8.5711 10.7139 16.0708 98.8610 Constraint 502 642 13.0665 16.3331 24.4996 98.7393 Constraint 418 573 9.6896 12.1120 18.1679 98.7064 Constraint 502 568 12.0312 15.0390 22.5585 98.2918 Constraint 306 584 13.1670 16.4587 24.6881 98.1613 Constraint 551 626 7.2362 9.0453 13.5680 98.1609 Constraint 545 626 8.4716 10.5895 15.8842 98.1609 Constraint 540 626 12.0426 15.0533 22.5799 98.1609 Constraint 533 626 10.8820 13.6025 20.4038 98.1609 Constraint 526 626 8.5139 10.6424 15.9636 98.1609 Constraint 517 626 11.9365 14.9207 22.3810 98.1609 Constraint 434 626 6.4190 8.0238 12.0356 98.1609 Constraint 427 626 4.6672 5.8340 8.7510 98.1609 Constraint 418 626 5.6141 7.0176 10.5265 98.1609 Constraint 410 626 6.7897 8.4871 12.7306 98.1609 Constraint 402 626 4.8551 6.0689 9.1033 98.1609 Constraint 358 626 9.7236 12.1546 18.2318 98.1609 Constraint 319 626 7.4156 9.2695 13.9043 98.1609 Constraint 280 626 10.0443 12.5553 18.8330 98.1609 Constraint 255 626 7.5713 9.4641 14.1962 98.1609 Constraint 463 601 13.6635 17.0793 25.6190 98.0611 Constraint 243 626 10.0154 12.5192 18.7789 98.0609 Constraint 455 559 13.9314 17.4142 26.1213 98.0406 Constraint 263 517 13.4429 16.8036 25.2054 98.0403 Constraint 340 551 11.7782 14.7227 22.0841 98.0362 Constraint 340 427 11.5645 14.4556 21.6834 98.0362 Constraint 274 340 11.9137 14.8921 22.3382 98.0362 Constraint 263 340 13.4184 16.7729 25.1594 98.0362 Constraint 319 463 12.5837 15.7296 23.5944 98.0359 Constraint 340 434 12.3259 15.4073 23.1110 98.0348 Constraint 243 312 14.4356 18.0445 27.0667 98.0348 Constraint 234 446 9.5566 11.9458 17.9187 98.0348 Constraint 234 350 10.1151 12.6439 18.9659 98.0348 Constraint 234 463 4.3970 5.4962 8.2443 98.0345 Constraint 234 559 11.0966 13.8707 20.8060 98.0345 Constraint 173 551 10.4376 13.0471 19.5706 97.9918 Constraint 173 545 12.3559 15.4449 23.1674 97.9918 Constraint 173 540 12.5183 15.6479 23.4719 97.9918 Constraint 173 533 8.6542 10.8177 16.2266 97.9918 Constraint 173 526 8.2392 10.2990 15.4484 97.9918 Constraint 173 517 11.3576 14.1971 21.2956 97.9918 Constraint 173 512 10.0383 12.5479 18.8218 97.9918 Constraint 173 502 6.2149 7.7686 11.6529 97.9918 Constraint 173 427 12.1853 15.2316 22.8474 97.9918 Constraint 173 418 13.7160 17.1450 25.7175 97.9918 Constraint 173 410 11.9055 14.8819 22.3228 97.9918 Constraint 173 402 8.2363 10.2954 15.4431 97.9918 Constraint 173 391 8.3929 10.4912 15.7368 97.9918 Constraint 173 383 8.9958 11.2447 16.8671 97.9918 Constraint 173 374 8.2101 10.2626 15.3939 97.9918 Constraint 173 369 7.9656 9.9569 14.9354 97.9918 Constraint 173 358 11.0387 13.7984 20.6976 97.9918 Constraint 173 287 11.6673 14.5841 21.8761 97.9918 Constraint 173 280 9.9974 12.4968 18.7452 97.9918 Constraint 173 274 7.0882 8.8602 13.2904 97.9918 Constraint 173 263 3.5223 4.4029 6.6043 97.9918 Constraint 173 255 6.3021 7.8777 11.8165 97.9918 Constraint 173 243 4.1927 5.2408 7.8613 97.9918 Constraint 274 649 14.1227 17.6533 26.4800 97.8624 Constraint 455 642 10.3598 12.9498 19.4246 97.8615 Constraint 446 642 11.3039 14.1298 21.1947 97.8615 Constraint 350 642 5.5233 6.9041 10.3562 97.8615 Constraint 312 642 11.4969 14.3711 21.5567 97.8615 Constraint 502 649 13.7437 17.1796 25.7695 97.7391 Constraint 446 573 7.8920 9.8650 14.7975 97.7066 Constraint 512 573 12.2920 15.3650 23.0475 97.7064 Constraint 410 573 12.4983 15.6228 23.4342 97.7064 Constraint 255 573 12.6649 15.8312 23.7468 97.7064 Constraint 402 568 12.0340 15.0425 22.5637 97.4139 Constraint 455 568 12.5442 15.6803 23.5204 97.4139 Constraint 350 573 12.0729 15.0911 22.6367 97.4139 Constraint 427 593 10.5486 13.1857 19.7786 97.1609 Constraint 463 626 7.4372 9.2965 13.9447 97.1609 Constraint 391 626 8.4107 10.5134 15.7701 97.1609 Constraint 383 626 7.1535 8.9418 13.4127 97.1609 Constraint 324 626 11.0442 13.8053 20.7080 97.1609 Constraint 369 626 11.3808 14.2260 21.3390 97.0610 Constraint 287 626 12.3023 15.3779 23.0668 97.0610 Constraint 340 418 12.7436 15.9295 23.8943 97.0362 Constraint 274 329 11.9855 14.9819 22.4729 97.0362 Constraint 306 533 13.0614 16.3267 24.4901 97.0351 Constraint 306 559 12.2804 15.3505 23.0257 97.0351 Constraint 263 540 13.9702 17.4628 26.1942 97.0346 Constraint 234 470 6.8536 8.5670 12.8504 97.0345 Constraint 287 573 13.5889 16.9861 25.4792 96.9919 Constraint 165 615 12.5908 15.7385 23.6078 96.9918 Constraint 165 610 10.2503 12.8129 19.2193 96.9918 Constraint 165 551 6.2309 7.7886 11.6829 96.9918 Constraint 165 545 8.6728 10.8411 16.2616 96.9918 Constraint 165 540 9.4705 11.8381 17.7572 96.9918 Constraint 165 533 5.7726 7.2157 10.8236 96.9918 Constraint 165 526 5.3035 6.6293 9.9440 96.9918 Constraint 165 517 9.1984 11.4980 17.2470 96.9918 Constraint 165 512 8.7748 10.9685 16.4527 96.9918 Constraint 165 502 5.8692 7.3365 11.0047 96.9918 Constraint 165 427 8.3074 10.3843 15.5764 96.9918 Constraint 165 418 10.7053 13.3816 20.0725 96.9918 Constraint 165 410 9.9497 12.4371 18.6557 96.9918 Constraint 165 402 5.4622 6.8278 10.2417 96.9918 Constraint 165 391 7.9548 9.9436 14.9153 96.9918 Constraint 165 383 7.8518 9.8148 14.7222 96.9918 Constraint 165 374 9.2492 11.5615 17.3422 96.9918 Constraint 165 369 8.4749 10.5937 15.8905 96.9918 Constraint 165 358 10.3161 12.8952 19.3427 96.9918 Constraint 165 295 13.4623 16.8279 25.2419 96.9918 Constraint 165 287 9.8263 12.2828 18.4242 96.9918 Constraint 165 280 8.5366 10.6708 16.0062 96.9918 Constraint 165 274 7.1908 8.9885 13.4828 96.9918 Constraint 165 263 4.9756 6.2195 9.3293 96.9918 Constraint 165 255 4.7855 5.9818 8.9727 96.9918 Constraint 165 243 5.2669 6.5837 9.8755 96.9918 Constraint 434 502 13.7606 17.2008 25.8012 96.9127 Constraint 470 642 10.1053 12.6316 18.9474 96.8612 Constraint 234 649 8.5974 10.7467 16.1201 96.8610 Constraint 263 329 14.4995 18.1244 27.1866 96.7362 Constraint 312 568 13.0834 16.3542 24.5313 96.4152 Constraint 502 573 12.9677 16.2097 24.3145 96.2919 Constraint 374 626 11.3703 14.2128 21.3192 96.0611 Constraint 551 634 10.5789 13.2236 19.8354 96.0611 Constraint 545 634 10.2445 12.8056 19.2084 96.0611 Constraint 533 634 13.5514 16.9392 25.4088 96.0611 Constraint 526 634 10.1132 12.6414 18.9622 96.0611 Constraint 517 634 12.7902 15.9878 23.9817 96.0611 Constraint 434 634 7.5278 9.4097 14.1145 96.0611 Constraint 427 634 6.2921 7.8651 11.7977 96.0611 Constraint 418 634 3.2879 4.1099 6.1648 96.0611 Constraint 410 634 3.9887 4.9859 7.4789 96.0611 Constraint 402 634 5.9884 7.4856 11.2283 96.0611 Constraint 358 634 11.3947 14.2434 21.3650 96.0611 Constraint 280 634 13.4740 16.8424 25.2637 96.0611 Constraint 255 634 10.0220 12.5275 18.7912 96.0611 Constraint 243 634 10.9727 13.7158 20.5738 96.0611 Constraint 274 626 12.3767 15.4709 23.2063 96.0610 Constraint 263 626 11.7310 14.6637 21.9956 96.0610 Constraint 234 319 11.0738 13.8422 20.7633 96.0359 Constraint 234 455 8.6231 10.7789 16.1683 96.0348 Constraint 263 610 13.8127 17.2658 25.8988 95.9923 Constraint 173 463 10.1691 12.7114 19.0671 95.9918 Constraint 146 615 11.3173 14.1466 21.2199 95.9918 Constraint 146 610 8.4616 10.5771 15.8656 95.9918 Constraint 146 568 12.8091 16.0114 24.0171 95.9918 Constraint 146 551 7.2253 9.0317 13.5475 95.9918 Constraint 146 545 11.0004 13.7505 20.6258 95.9918 Constraint 146 540 12.4002 15.5002 23.2504 95.9918 Constraint 146 533 9.1670 11.4587 17.1881 95.9918 Constraint 146 526 9.4017 11.7522 17.6283 95.9918 Constraint 146 512 13.2459 16.5574 24.8360 95.9918 Constraint 146 502 11.0272 13.7840 20.6760 95.9918 Constraint 146 463 11.0328 13.7910 20.6864 95.9918 Constraint 146 434 12.1318 15.1647 22.7471 95.9918 Constraint 146 427 9.4836 11.8545 17.7817 95.9918 Constraint 146 418 12.1311 15.1639 22.7459 95.9918 Constraint 146 410 11.9147 14.8934 22.3401 95.9918 Constraint 146 402 7.4473 9.3091 13.9636 95.9918 Constraint 146 391 10.1079 12.6348 18.9522 95.9918 Constraint 146 383 7.3689 9.2111 13.8166 95.9918 Constraint 146 374 9.3498 11.6872 17.5309 95.9918 Constraint 146 369 7.0353 8.7941 13.1911 95.9918 Constraint 146 358 7.8239 9.7799 14.6698 95.9918 Constraint 146 319 3.7760 4.7200 7.0800 95.9918 Constraint 146 295 8.8236 11.0295 16.5442 95.9918 Constraint 146 287 5.3888 6.7359 10.1039 95.9918 Constraint 146 280 4.1534 5.1917 7.7876 95.9918 Constraint 146 274 5.4411 6.8014 10.2021 95.9918 Constraint 146 263 6.3737 7.9672 11.9507 95.9918 Constraint 146 255 4.3282 5.4103 8.1154 95.9918 Constraint 146 243 8.2632 10.3290 15.4935 95.9918 Constraint 545 649 13.7717 17.2146 25.8220 95.8623 Constraint 340 649 12.8573 16.0716 24.1075 95.8613 Constraint 243 559 14.1083 17.6354 26.4530 95.7346 Constraint 463 573 9.8798 12.3497 18.5246 95.7064 Constraint 280 573 14.0226 17.5283 26.2924 95.2920 Constraint 455 626 9.5030 11.8787 17.8181 95.1612 Constraint 446 626 8.5298 10.6622 15.9933 95.1612 Constraint 350 626 6.1604 7.7005 11.5508 95.1612 Constraint 312 626 8.8841 11.1052 16.6577 95.1612 Constraint 434 593 8.5139 10.6424 15.9636 95.1609 Constraint 319 593 11.8129 14.7661 22.1491 95.1609 Constraint 483 551 8.5803 10.7254 16.0881 95.1140 Constraint 418 483 8.1669 10.2086 15.3129 95.1140 Constraint 410 483 8.3586 10.4483 15.6724 95.1140 Constraint 402 483 7.6231 9.5289 14.2934 95.1140 Constraint 391 483 9.8625 12.3281 18.4922 95.1140 Constraint 255 483 11.8111 14.7639 22.1458 95.1140 Constraint 243 483 10.1301 12.6626 18.9940 95.1140 Constraint 374 634 12.2640 15.3300 22.9950 95.0612 Constraint 369 634 13.5187 16.8984 25.3475 95.0612 Constraint 463 634 7.1968 8.9960 13.4939 95.0611 Constraint 391 634 7.7134 9.6418 14.4627 95.0611 Constraint 383 634 8.1168 10.1460 15.2190 95.0611 Constraint 502 626 12.3952 15.4940 23.2411 95.0391 Constraint 312 526 13.5221 16.9026 25.3539 95.0363 Constraint 274 463 14.1635 17.7044 26.5566 95.0345 Constraint 280 463 14.0497 17.5622 26.3433 95.0345 Constraint 280 559 13.8615 17.3268 25.9903 95.0345 Constraint 173 350 11.0244 13.7805 20.6707 94.9921 Constraint 146 573 10.4767 13.0958 19.6438 94.9919 Constraint 173 649 11.9492 14.9365 22.4047 94.9919 Constraint 146 649 12.1307 15.1633 22.7450 94.9919 Constraint 130 649 14.1673 17.7091 26.5637 94.9919 Constraint 130 615 9.1678 11.4597 17.1895 94.9919 Constraint 130 610 5.2032 6.5040 9.7559 94.9919 Constraint 130 568 9.9587 12.4484 18.6726 94.9919 Constraint 130 551 5.6725 7.0906 10.6359 94.9919 Constraint 130 545 9.5434 11.9292 17.8938 94.9919 Constraint 130 540 11.1564 13.9455 20.9183 94.9919 Constraint 130 533 9.1737 11.4671 17.2007 94.9919 Constraint 130 526 9.8718 12.3397 18.5095 94.9919 Constraint 130 517 13.2736 16.5919 24.8879 94.9919 Constraint 130 512 13.6417 17.0521 25.5782 94.9919 Constraint 130 502 12.6486 15.8108 23.7161 94.9919 Constraint 130 463 11.4368 14.2961 21.4441 94.9919 Constraint 130 434 9.6505 12.0631 18.0947 94.9919 Constraint 130 427 8.2350 10.2937 15.4406 94.9919 Constraint 130 418 11.7325 14.6656 21.9983 94.9919 Constraint 130 410 12.8669 16.0837 24.1255 94.9919 Constraint 130 402 8.8924 11.1155 16.6732 94.9919 Constraint 130 391 12.7127 15.8909 23.8364 94.9919 Constraint 130 383 10.3122 12.8903 19.3354 94.9919 Constraint 130 374 13.2796 16.5995 24.8993 94.9919 Constraint 130 369 11.2329 14.0411 21.0617 94.9919 Constraint 130 358 11.0286 13.7858 20.6787 94.9919 Constraint 130 319 4.4815 5.6019 8.4028 94.9919 Constraint 130 295 10.5052 13.1315 19.6973 94.9919 Constraint 130 287 6.9444 8.6805 13.0207 94.9919 Constraint 130 280 7.5272 9.4090 14.1135 94.9919 Constraint 130 274 9.4691 11.8364 17.7546 94.9919 Constraint 130 263 10.4695 13.0869 19.6304 94.9919 Constraint 130 255 8.0941 10.1176 15.1764 94.9919 Constraint 130 243 11.7703 14.7129 22.0693 94.9919 Constraint 165 463 7.6147 9.5184 14.2775 94.9918 Constraint 165 434 11.9502 14.9378 22.4067 94.9918 Constraint 157 551 8.5925 10.7406 16.1109 94.9918 Constraint 157 545 12.0671 15.0839 22.6259 94.9918 Constraint 157 540 12.1668 15.2085 22.8128 94.9918 Constraint 157 533 8.1375 10.1719 15.2579 94.9918 Constraint 157 526 9.3799 11.7249 17.5873 94.9918 Constraint 157 512 11.4956 14.3694 21.5542 94.9918 Constraint 157 502 9.0235 11.2793 16.9190 94.9918 Constraint 157 463 12.0052 15.0065 22.5097 94.9918 Constraint 157 427 11.7799 14.7249 22.0873 94.9918 Constraint 157 402 9.1952 11.4940 17.2410 94.9918 Constraint 157 391 11.1198 13.8997 20.8496 94.9918 Constraint 157 383 9.4609 11.8261 17.7392 94.9918 Constraint 157 374 9.7267 12.1583 18.2375 94.9918 Constraint 157 369 7.3258 9.1573 13.7359 94.9918 Constraint 157 358 10.0700 12.5875 18.8812 94.9918 Constraint 157 319 7.8924 9.8655 14.7982 94.9918 Constraint 157 295 9.9343 12.4179 18.6268 94.9918 Constraint 157 287 6.3210 7.9013 11.8519 94.9918 Constraint 157 280 6.3031 7.8789 11.8183 94.9918 Constraint 157 274 3.6001 4.5001 6.7502 94.9918 Constraint 157 263 3.7862 4.7328 7.0992 94.9918 Constraint 157 255 5.6878 7.1098 10.6646 94.9918 Constraint 157 243 7.6722 9.5903 14.3854 94.9918 Constraint 146 559 10.0467 12.5584 18.8376 94.9918 Constraint 146 324 6.8095 8.5119 12.7678 94.9918 Constraint 306 642 12.5401 15.6751 23.5127 94.8617 Constraint 340 642 8.7668 10.9585 16.4377 94.8615 Constraint 234 642 8.0264 10.0330 15.0496 94.8612 Constraint 455 573 11.7788 14.7235 22.0852 94.7066 Constraint 340 573 11.9854 14.9818 22.4727 94.4152 Constraint 234 568 12.4336 15.5420 23.3130 94.4136 Constraint 427 491 10.6126 13.2657 19.8986 94.2921 Constraint 418 491 12.1551 15.1939 22.7908 94.2921 Constraint 410 491 12.0387 15.0484 22.5726 94.2921 Constraint 402 491 10.3639 12.9549 19.4323 94.2921 Constraint 243 491 11.1518 13.9397 20.9095 94.2921 Constraint 312 593 8.9456 11.1821 16.7731 94.1612 Constraint 340 626 7.6532 9.5665 14.3498 94.1612 Constraint 329 626 11.1622 13.9528 20.9292 94.1612 Constraint 306 626 10.9946 13.7432 20.6148 94.1612 Constraint 470 626 10.7687 13.4609 20.1913 94.1609 Constraint 483 615 12.9274 16.1592 24.2388 94.1141 Constraint 483 649 11.9928 14.9910 22.4865 94.1140 Constraint 483 559 10.7927 13.4908 20.2362 94.1140 Constraint 446 593 12.7652 15.9566 23.9348 94.0612 Constraint 263 634 14.2143 17.7679 26.6519 94.0612 Constraint 517 615 13.6600 17.0750 25.6126 94.0611 Constraint 340 410 13.1669 16.4586 24.6879 94.0362 Constraint 329 551 13.5495 16.9369 25.4054 94.0362 Constraint 329 402 14.0276 17.5346 26.3018 94.0348 Constraint 165 446 11.5311 14.4138 21.6207 93.9921 Constraint 165 350 8.6365 10.7956 16.1934 93.9921 Constraint 165 312 11.4899 14.3624 21.5435 93.9921 Constraint 165 306 10.9116 13.6395 20.4592 93.9921 Constraint 130 573 7.0861 8.8576 13.2864 93.9920 Constraint 157 610 11.8797 14.8497 22.2745 93.9919 Constraint 165 649 11.0423 13.8029 20.7044 93.9919 Constraint 157 649 14.0321 17.5401 26.3102 93.9919 Constraint 157 517 12.9115 16.1393 24.2090 93.9919 Constraint 157 410 13.8047 17.2559 25.8838 93.9919 Constraint 130 559 7.7948 9.7435 14.6153 93.9919 Constraint 130 324 7.9265 9.9081 14.8622 93.9919 Constraint 165 559 9.1648 11.4560 17.1841 93.9918 Constraint 157 559 10.4380 13.0475 19.5713 93.9918 Constraint 173 470 12.1129 15.1412 22.7118 93.9918 Constraint 165 470 10.9823 13.7279 20.5918 93.9918 Constraint 173 559 12.7993 15.9992 23.9988 93.9918 Constraint 502 634 13.9131 17.3913 26.0870 93.9392 Constraint 329 642 12.4459 15.5574 23.3361 93.8615 Constraint 319 568 13.8330 17.2913 25.9369 93.4153 Constraint 263 491 12.8717 16.0896 24.1344 93.2921 Constraint 491 559 11.0939 13.8674 20.8011 93.2921 Constraint 324 601 13.2146 16.5182 24.7774 93.1667 Constraint 329 593 12.4456 15.5569 23.3354 93.1612 Constraint 483 610 12.3042 15.3802 23.0703 93.1141 Constraint 483 568 10.5944 13.2430 19.8645 93.1140 Constraint 319 634 11.2982 14.1228 21.1842 93.0624 Constraint 455 634 7.1599 8.9499 13.4249 93.0614 Constraint 446 634 8.0467 10.0584 15.0876 93.0614 Constraint 350 634 9.1751 11.4689 17.2033 93.0614 Constraint 312 634 13.1444 16.4305 24.6458 93.0614 Constraint 526 601 13.6677 17.0846 25.6270 93.0612 Constraint 358 526 13.8462 17.3078 25.9617 93.0407 Constraint 287 526 13.6763 17.0953 25.6430 93.0404 Constraint 173 319 11.5551 14.4438 21.6657 92.9931 Constraint 146 517 13.3387 16.6733 25.0100 92.9921 Constraint 173 491 10.0517 12.5646 18.8470 92.9921 Constraint 173 483 10.6553 13.3192 19.9787 92.9921 Constraint 146 350 5.0594 6.3243 9.4864 92.9921 Constraint 146 312 6.7030 8.3788 12.5682 92.9921 Constraint 146 306 5.7834 7.2293 10.8439 92.9921 Constraint 173 642 11.2157 14.0196 21.0294 92.9921 Constraint 146 642 8.5860 10.7325 16.0988 92.9921 Constraint 130 642 10.0861 12.6077 18.9115 92.9921 Constraint 369 610 14.2706 17.8383 26.7575 92.9920 Constraint 157 573 12.8033 16.0041 24.0061 92.9919 Constraint 165 573 10.7925 13.4906 20.2359 92.9919 Constraint 165 568 11.7328 14.6660 21.9989 92.9918 Constraint 287 427 14.1427 17.6784 26.5176 92.9184 Constraint 243 340 13.6101 17.0127 25.5190 92.4152 Constraint 491 568 11.7222 14.6527 21.9791 92.2921 Constraint 234 626 8.3601 10.4502 15.6752 92.1609 Constraint 263 483 12.8135 16.0168 24.0253 92.1197 Constraint 383 483 12.5744 15.7180 23.5769 92.1143 Constraint 483 642 11.8652 14.8315 22.2473 92.1142 Constraint 340 634 10.8349 13.5436 20.3155 92.0614 Constraint 418 593 13.6479 17.0599 25.5898 92.0612 Constraint 470 634 8.6518 10.8148 16.2222 92.0611 Constraint 234 312 14.0539 17.5674 26.3510 92.0348 Constraint 312 374 14.5202 18.1502 27.2253 92.0348 Constraint 183 551 10.3761 12.9701 19.4552 91.9978 Constraint 183 545 11.0159 13.7699 20.6548 91.9978 Constraint 183 540 11.3522 14.1903 21.2854 91.9978 Constraint 183 533 8.3081 10.3851 15.5776 91.9978 Constraint 183 526 6.6372 8.2965 12.4448 91.9978 Constraint 183 517 9.0329 11.2911 16.9366 91.9978 Constraint 183 512 8.4535 10.5668 15.8502 91.9978 Constraint 183 502 4.5314 5.6643 8.4964 91.9978 Constraint 183 427 11.2168 14.0210 21.0315 91.9978 Constraint 183 418 12.2145 15.2682 22.9022 91.9978 Constraint 183 410 10.3854 12.9817 19.4726 91.9978 Constraint 183 402 7.6593 9.5741 14.3612 91.9978 Constraint 183 391 7.7321 9.6651 14.4977 91.9978 Constraint 183 383 10.0044 12.5056 18.7583 91.9978 Constraint 183 374 9.9508 12.4385 18.6577 91.9978 Constraint 183 369 10.7529 13.4412 20.1618 91.9978 Constraint 183 358 13.0586 16.3233 24.4849 91.9978 Constraint 183 350 12.7648 15.9560 23.9339 91.9978 Constraint 183 280 12.8935 16.1169 24.1753 91.9978 Constraint 183 274 10.6462 13.3077 19.9616 91.9978 Constraint 183 263 7.0993 8.8741 13.3112 91.9978 Constraint 183 255 8.2430 10.3038 15.4556 91.9978 Constraint 165 319 8.5327 10.6659 15.9989 91.9931 Constraint 173 324 13.9029 17.3786 26.0679 91.9931 Constraint 173 306 13.4568 16.8210 25.2316 91.9924 Constraint 130 483 13.6260 17.0325 25.5488 91.9922 Constraint 130 446 12.3650 15.4562 23.1844 91.9922 Constraint 130 350 6.9970 8.7463 13.1194 91.9922 Constraint 130 312 4.1896 5.2370 7.8555 91.9922 Constraint 130 306 5.5745 6.9682 10.4522 91.9922 Constraint 165 491 9.2767 11.5959 17.3938 91.9921 Constraint 165 483 8.7770 10.9713 16.4569 91.9921 Constraint 165 455 12.0930 15.1163 22.6744 91.9921 Constraint 157 350 8.8184 11.0230 16.5345 91.9921 Constraint 157 312 10.4511 13.0639 19.5958 91.9921 Constraint 157 306 8.4517 10.5646 15.8469 91.9921 Constraint 165 642 9.0253 11.2817 16.9225 91.9921 Constraint 157 642 11.4889 14.3611 21.5416 91.9921 Constraint 146 601 12.1892 15.2366 22.8548 91.9919 Constraint 130 584 9.1426 11.4283 17.1424 91.9919 Constraint 130 601 8.4900 10.6125 15.9187 91.9919 Constraint 165 234 4.2718 5.3398 8.0097 91.9918 Constraint 324 427 14.3288 17.9110 26.8665 91.9127 Constraint 234 573 11.6638 14.5798 21.8697 91.7064 Constraint 255 491 13.2287 16.5359 24.8038 91.2924 Constraint 243 434 14.5917 18.2396 27.3595 91.2921 Constraint 374 551 14.1726 17.7158 26.5737 91.1140 Constraint 165 324 11.7926 14.7407 22.1111 90.9931 Constraint 157 324 9.6126 12.0157 18.0236 90.9931 Constraint 157 491 12.9125 16.1407 24.2110 90.9922 Constraint 146 340 8.1986 10.2483 15.3724 90.9921 Constraint 502 610 13.4875 16.8594 25.2890 90.9394 Constraint 374 470 13.5221 16.9026 25.3539 90.7346 Constraint 483 573 11.2711 14.0889 21.1334 90.4067 Constraint 391 491 12.0964 15.1205 22.6808 90.2924 Constraint 306 593 12.0950 15.1188 22.6781 90.1670 Constraint 340 593 11.6752 14.5939 21.8909 90.1625 Constraint 446 584 11.2278 14.0348 21.0522 90.0923 Constraint 234 634 9.2172 11.5215 17.2822 90.0611 Constraint 183 491 7.2271 9.0339 13.5509 89.9978 Constraint 183 483 7.7972 9.7465 14.6197 89.9978 Constraint 183 463 8.0722 10.0903 15.1354 89.9978 Constraint 183 455 11.9988 14.9985 22.4977 89.9978 Constraint 146 483 13.0932 16.3665 24.5498 89.9924 Constraint 383 573 13.8130 17.2663 25.8995 89.9924 Constraint 130 340 7.5830 9.4787 14.2180 89.9922 Constraint 146 446 13.6409 17.0512 25.5768 89.9921 Constraint 146 329 9.2235 11.5293 17.2940 89.9921 Constraint 86 615 8.1687 10.2109 15.3163 89.9921 Constraint 86 610 6.1167 7.6458 11.4687 89.9921 Constraint 86 573 8.6555 10.8194 16.2291 89.9921 Constraint 86 551 11.0093 13.7616 20.6424 89.9921 Constraint 86 427 11.3310 14.1638 21.2457 89.9921 Constraint 86 418 13.8811 17.3514 26.0271 89.9921 Constraint 86 402 13.6413 17.0516 25.5774 89.9921 Constraint 86 350 10.3922 12.9903 19.4854 89.9921 Constraint 86 312 5.2774 6.5967 9.8951 89.9921 Constraint 86 306 8.9727 11.2159 16.8239 89.9921 Constraint 86 287 11.9003 14.8754 22.3131 89.9921 Constraint 86 280 12.3712 15.4639 23.1959 89.9921 Constraint 86 255 13.7840 17.2300 25.8450 89.9921 Constraint 78 615 6.1605 7.7007 11.5510 89.9921 Constraint 78 610 3.9378 4.9223 7.3834 89.9921 Constraint 78 573 7.5600 9.4500 14.1750 89.9921 Constraint 78 551 8.2415 10.3019 15.4528 89.9921 Constraint 78 545 11.0783 13.8478 20.7717 89.9921 Constraint 78 533 12.5287 15.6608 23.4913 89.9921 Constraint 78 526 12.0796 15.0995 22.6493 89.9921 Constraint 78 446 12.1607 15.2009 22.8013 89.9921 Constraint 78 427 8.2322 10.2903 15.4354 89.9921 Constraint 78 418 10.6026 13.2532 19.8798 89.9921 Constraint 78 410 12.1421 15.1777 22.7665 89.9921 Constraint 78 402 9.4417 11.8021 17.7032 89.9921 Constraint 78 391 12.9421 16.1777 24.2665 89.9921 Constraint 78 383 10.2004 12.7505 19.1257 89.9921 Constraint 78 358 10.7666 13.4583 20.1874 89.9921 Constraint 78 350 6.3820 7.9776 11.9663 89.9921 Constraint 78 312 4.1760 5.2199 7.8299 89.9921 Constraint 78 306 7.4269 9.2836 13.9254 89.9921 Constraint 78 287 9.8038 12.2548 18.3822 89.9921 Constraint 78 280 9.0733 11.3416 17.0124 89.9921 Constraint 78 255 9.5459 11.9323 17.8985 89.9921 Constraint 157 234 8.6099 10.7624 16.1436 89.9918 Constraint 146 234 8.7310 10.9138 16.3706 89.9918 Constraint 157 568 13.8591 17.3239 25.9858 89.9918 Constraint 173 626 12.1453 15.1816 22.7724 89.9918 Constraint 146 626 7.5703 9.4629 14.1943 89.9918 Constraint 517 642 13.6365 17.0456 25.5685 89.8684 Constraint 189 512 8.9058 11.1322 16.6984 89.7451 Constraint 189 502 5.4098 6.7622 10.1434 89.7451 Constraint 223 410 9.0397 11.2996 16.9494 89.7348 Constraint 189 391 8.3240 10.4050 15.6074 89.4524 Constraint 491 573 13.4116 16.7645 25.1468 89.2921 Constraint 340 584 12.8709 16.0886 24.1329 89.1628 Constraint 234 483 5.7452 7.1815 10.7722 89.1140 Constraint 483 626 10.8138 13.5172 20.2758 89.1140 Constraint 312 418 13.9337 17.4171 26.1257 89.0406 Constraint 263 470 13.8938 17.3672 26.0508 89.0345 Constraint 183 649 11.2499 14.0624 21.0936 88.9979 Constraint 183 470 9.4066 11.7583 17.6374 88.9978 Constraint 165 340 12.5067 15.6333 23.4500 88.9934 Constraint 130 329 8.3888 10.4860 15.7291 88.9922 Constraint 78 165 10.7178 13.3972 20.0958 88.9921 Constraint 173 295 14.5866 18.2333 27.3499 88.9921 Constraint 78 374 13.9587 17.4483 26.1725 88.9921 Constraint 78 369 12.5034 15.6293 23.4439 88.9921 Constraint 78 295 12.0551 15.0689 22.6033 88.9921 Constraint 78 274 12.2695 15.3369 23.0054 88.9921 Constraint 78 263 13.1629 16.4537 24.6805 88.9921 Constraint 78 243 13.3336 16.6671 25.0006 88.9921 Constraint 130 234 10.6493 13.3116 19.9674 88.9919 Constraint 130 593 8.6933 10.8666 16.3000 88.9919 Constraint 130 626 7.0054 8.7567 13.1350 88.9919 Constraint 165 626 8.5324 10.6655 15.9982 88.9918 Constraint 157 626 11.0643 13.8304 20.7456 88.9918 Constraint 146 593 12.9420 16.1775 24.2663 88.9918 Constraint 223 391 7.8967 9.8708 14.8062 88.7348 Constraint 223 455 9.8738 12.3423 18.5134 88.7348 Constraint 223 402 9.2556 11.5694 17.3542 88.7348 Constraint 223 374 12.0415 15.0519 22.5779 88.7348 Constraint 189 526 7.3812 9.2265 13.8398 88.4524 Constraint 189 517 9.0853 11.3567 17.0350 88.4524 Constraint 189 470 9.0653 11.3317 16.9975 88.4524 Constraint 189 463 8.4597 10.5746 15.8619 88.4524 Constraint 189 410 10.6193 13.2741 19.9112 88.4524 Constraint 189 402 8.6995 10.8744 16.3116 88.4524 Constraint 234 491 7.4209 9.2761 13.9142 88.2921 Constraint 234 306 14.0601 17.5751 26.3626 88.0352 Constraint 324 573 14.3340 17.9175 26.8762 87.9995 Constraint 157 483 12.9998 16.2498 24.3747 87.9979 Constraint 165 329 14.2876 17.8595 26.7892 87.9934 Constraint 86 559 12.3609 15.4512 23.1768 87.9921 Constraint 86 434 10.1312 12.6640 18.9960 87.9921 Constraint 86 319 8.4515 10.5644 15.8466 87.9921 Constraint 78 568 11.6703 14.5879 21.8818 87.9921 Constraint 78 559 10.8720 13.5900 20.3851 87.9921 Constraint 78 463 12.1537 15.1921 22.7882 87.9921 Constraint 78 434 8.4453 10.5566 15.8349 87.9921 Constraint 78 319 5.1711 6.4638 9.6958 87.9921 Constraint 78 146 7.1263 8.9079 13.3618 87.9921 Constraint 68 615 4.0477 5.0596 7.5894 87.9921 Constraint 68 610 5.7713 7.2141 10.8212 87.9921 Constraint 68 573 9.2535 11.5668 17.3502 87.9921 Constraint 68 568 13.6023 17.0029 25.5044 87.9921 Constraint 68 551 11.1430 13.9287 20.8931 87.9921 Constraint 68 545 12.6618 15.8272 23.7409 87.9921 Constraint 68 463 13.0513 16.3142 24.4712 87.9921 Constraint 68 455 13.8961 17.3701 26.0552 87.9921 Constraint 68 446 12.0276 15.0345 22.5518 87.9921 Constraint 68 434 7.9683 9.9604 14.9406 87.9921 Constraint 68 427 9.0982 11.3728 17.0592 87.9921 Constraint 68 418 9.7931 12.2413 18.3620 87.9921 Constraint 68 410 11.8046 14.7558 22.1337 87.9921 Constraint 68 402 10.8883 13.6104 20.4155 87.9921 Constraint 68 391 13.8546 17.3183 25.9774 87.9921 Constraint 68 383 11.6003 14.5004 21.7506 87.9921 Constraint 68 358 12.4883 15.6103 23.4155 87.9921 Constraint 68 350 8.6585 10.8231 16.2347 87.9921 Constraint 68 319 8.9407 11.1758 16.7637 87.9921 Constraint 68 312 8.1778 10.2223 15.3335 87.9921 Constraint 68 306 11.5629 14.4536 21.6803 87.9921 Constraint 68 280 12.6008 15.7510 23.6266 87.9921 Constraint 68 255 12.3084 15.3855 23.0782 87.9921 Constraint 68 146 11.0888 13.8611 20.7916 87.9921 Constraint 62 615 5.7424 7.1780 10.7670 87.9921 Constraint 62 610 6.9406 8.6757 13.0136 87.9921 Constraint 62 573 10.5638 13.2047 19.8071 87.9921 Constraint 62 551 10.4676 13.0845 19.6267 87.9921 Constraint 62 545 12.3615 15.4519 23.1779 87.9921 Constraint 62 526 12.4281 15.5352 23.3028 87.9921 Constraint 62 463 11.1049 13.8811 20.8217 87.9921 Constraint 62 455 12.6426 15.8032 23.7048 87.9921 Constraint 62 446 11.9767 14.9709 22.4564 87.9921 Constraint 62 434 9.2568 11.5710 17.3566 87.9921 Constraint 62 427 8.4196 10.5245 15.7867 87.9921 Constraint 62 418 8.4442 10.5552 15.8329 87.9921 Constraint 62 410 9.0021 11.2526 16.8789 87.9921 Constraint 62 402 7.8133 9.7667 14.6500 87.9921 Constraint 62 391 9.9179 12.3974 18.5961 87.9921 Constraint 62 383 7.2520 9.0651 13.5976 87.9921 Constraint 62 374 11.4679 14.3348 21.5023 87.9921 Constraint 62 369 11.2513 14.0641 21.0962 87.9921 Constraint 62 358 8.3047 10.3809 15.5713 87.9921 Constraint 62 350 4.9646 6.2058 9.3087 87.9921 Constraint 62 319 6.8858 8.6073 12.9109 87.9921 Constraint 62 312 8.2906 10.3633 15.5450 87.9921 Constraint 62 306 10.5369 13.1711 19.7567 87.9921 Constraint 62 280 9.6065 12.0081 18.0122 87.9921 Constraint 62 255 8.5691 10.7114 16.0671 87.9921 Constraint 62 243 11.7251 14.6564 21.9845 87.9921 Constraint 62 146 8.6072 10.7590 16.1385 87.9921 Constraint 54 615 5.2321 6.5401 9.8102 87.9921 Constraint 54 610 8.9770 11.2213 16.8319 87.9921 Constraint 54 551 12.6964 15.8705 23.8058 87.9921 Constraint 54 545 13.2168 16.5209 24.7814 87.9921 Constraint 54 526 13.7736 17.2170 25.8255 87.9921 Constraint 54 446 11.0969 13.8711 20.8067 87.9921 Constraint 54 427 8.9806 11.2257 16.8386 87.9921 Constraint 54 418 6.9954 8.7443 13.1164 87.9921 Constraint 54 410 8.0414 10.0517 15.0776 87.9921 Constraint 54 402 9.2904 11.6130 17.4194 87.9921 Constraint 54 391 10.7977 13.4971 20.2457 87.9921 Constraint 54 383 9.6768 12.0961 18.1441 87.9921 Constraint 54 358 11.5735 14.4668 21.7003 87.9921 Constraint 54 350 9.1248 11.4060 17.1089 87.9921 Constraint 54 312 12.3325 15.4156 23.1234 87.9921 Constraint 54 255 11.8410 14.8012 22.2018 87.9921 Constraint 54 243 13.8748 17.3435 26.0152 87.9921 Constraint 43 615 8.8959 11.1199 16.6798 87.9921 Constraint 43 446 13.6941 17.1176 25.6764 87.9921 Constraint 43 427 11.0232 13.7789 20.6684 87.9921 Constraint 43 418 8.9750 11.2187 16.8281 87.9921 Constraint 43 410 8.0105 10.0131 15.0197 87.9921 Constraint 43 402 8.9425 11.1782 16.7673 87.9921 Constraint 43 391 8.7387 10.9233 16.3850 87.9921 Constraint 43 383 6.9139 8.6424 12.9636 87.9921 Constraint 43 374 10.5964 13.2455 19.8683 87.9921 Constraint 43 369 11.7949 14.7436 22.1154 87.9921 Constraint 43 358 8.2531 10.3164 15.4746 87.9921 Constraint 43 350 7.4524 9.3156 13.9733 87.9921 Constraint 43 255 9.9895 12.4869 18.7303 87.9921 Constraint 43 243 11.8310 14.7887 22.1831 87.9921 Constraint 86 340 7.2592 9.0741 13.6111 87.9921 Constraint 78 340 4.8662 6.0827 9.1240 87.9921 Constraint 146 634 11.4642 14.3303 21.4955 87.9920 Constraint 223 649 10.2499 12.8124 19.2186 87.8613 Constraint 223 463 8.1015 10.1269 15.1904 87.7348 Constraint 223 383 11.7411 14.6764 22.0147 87.7348 Constraint 223 526 9.1154 11.3942 17.0913 87.7348 Constraint 223 517 10.1804 12.7255 19.0882 87.7348 Constraint 223 512 11.1810 13.9763 20.9644 87.7348 Constraint 470 573 13.9687 17.4609 26.1914 87.7068 Constraint 189 455 11.7320 14.6649 21.9974 87.4524 Constraint 329 573 13.6467 17.0584 25.5875 87.4156 Constraint 274 559 13.4148 16.7686 25.1528 87.4137 Constraint 255 601 14.4144 18.0180 27.0271 87.1977 Constraint 350 593 13.7170 17.1462 25.7193 87.1614 Constraint 526 593 14.2867 17.8583 26.7875 87.1612 Constraint 483 634 10.7244 13.4056 20.1083 87.1141 Constraint 512 610 13.8398 17.2997 25.9496 87.0670 Constraint 540 634 14.0065 17.5081 26.2621 87.0613 Constraint 350 455 14.5155 18.1444 27.2166 87.0406 Constraint 319 540 14.2697 17.8372 26.7558 87.0363 Constraint 183 319 13.6229 17.0286 25.5429 86.9992 Constraint 183 642 11.3229 14.1536 21.2304 86.9981 Constraint 157 340 12.2793 15.3491 23.0237 86.9934 Constraint 43 610 11.3029 14.1286 21.1929 86.9922 Constraint 43 280 12.0356 15.0445 22.5668 86.9922 Constraint 78 649 13.2101 16.5127 24.7690 86.9922 Constraint 68 649 12.9389 16.1736 24.2604 86.9922 Constraint 62 649 9.0501 11.3126 16.9689 86.9922 Constraint 62 130 8.2697 10.3372 15.5058 86.9922 Constraint 146 584 13.0623 16.3278 24.4918 86.9921 Constraint 78 157 11.2773 14.0966 21.1450 86.9921 Constraint 62 165 11.1231 13.9039 20.8559 86.9921 Constraint 54 165 13.9166 17.3958 26.0937 86.9921 Constraint 43 165 13.2552 16.5690 24.8535 86.9921 Constraint 86 584 7.7675 9.7094 14.5640 86.9921 Constraint 78 584 8.9368 11.1710 16.7565 86.9921 Constraint 86 324 10.2813 12.8517 19.2775 86.9921 Constraint 78 324 8.2164 10.2705 15.4057 86.9921 Constraint 68 324 11.3387 14.1734 21.2601 86.9921 Constraint 62 324 9.4746 11.8433 17.7650 86.9921 Constraint 62 287 12.2892 15.3615 23.0422 86.9921 Constraint 62 274 13.0023 16.2529 24.3794 86.9921 Constraint 62 263 13.0828 16.3536 24.5303 86.9921 Constraint 110 610 10.7294 13.4117 20.1175 86.9921 Constraint 110 573 10.4109 13.0136 19.5204 86.9921 Constraint 110 551 11.8846 14.8557 22.2836 86.9921 Constraint 110 312 8.4306 10.5382 15.8073 86.9921 Constraint 110 306 9.6239 12.0299 18.0449 86.9921 Constraint 110 287 11.1535 13.9418 20.9127 86.9921 Constraint 54 573 11.9427 14.9284 22.3926 86.9921 Constraint 86 601 4.5202 5.6503 8.4754 86.9921 Constraint 86 329 7.6922 9.6152 14.4228 86.9921 Constraint 78 601 5.7600 7.2000 10.8000 86.9921 Constraint 78 329 7.0593 8.8241 13.2362 86.9921 Constraint 173 634 13.9705 17.4632 26.1948 86.9921 Constraint 130 634 11.4825 14.3531 21.5297 86.9921 Constraint 165 634 11.1493 13.9366 20.9048 86.9920 Constraint 350 502 13.8189 17.2736 25.9105 86.9192 Constraint 223 545 12.7826 15.9782 23.9673 86.7348 Constraint 223 427 12.3053 15.3816 23.0725 86.7348 Constraint 223 418 11.3510 14.1887 21.2831 86.7348 Constraint 189 483 7.6789 9.5986 14.3979 86.7051 Constraint 223 502 8.2080 10.2600 15.3901 86.6130 Constraint 189 383 10.8836 13.6044 20.4067 86.4524 Constraint 189 374 10.7625 13.4531 20.1797 86.4524 Constraint 189 369 11.9442 14.9303 22.3954 86.4524 Constraint 189 274 12.1581 15.1976 22.7964 86.4524 Constraint 189 263 8.7047 10.8808 16.3213 86.4524 Constraint 306 526 13.9246 17.4058 26.1086 86.0410 Constraint 189 491 6.9391 8.6739 13.0108 85.9978 Constraint 183 446 12.8630 16.0788 24.1182 85.9978 Constraint 157 329 12.7628 15.9535 23.9303 85.9934 Constraint 62 157 12.6294 15.7867 23.6801 85.9921 Constraint 54 463 11.2204 14.0254 21.0382 85.9921 Constraint 54 455 11.0354 13.7942 20.6913 85.9921 Constraint 54 434 8.8874 11.1092 16.6638 85.9921 Constraint 54 319 11.3279 14.1598 21.2398 85.9921 Constraint 54 146 12.6402 15.8002 23.7004 85.9921 Constraint 43 463 12.0598 15.0747 22.6121 85.9921 Constraint 43 455 12.6940 15.8675 23.8012 85.9921 Constraint 43 434 12.2422 15.3028 22.9541 85.9921 Constraint 43 319 10.7235 13.4044 20.1066 85.9921 Constraint 43 146 11.8788 14.8485 22.2727 85.9921 Constraint 86 568 12.5294 15.6617 23.4925 85.9921 Constraint 86 545 13.3965 16.7457 25.1185 85.9921 Constraint 68 340 6.3100 7.8874 11.8312 85.9921 Constraint 62 340 5.0014 6.2517 9.3776 85.9921 Constraint 117 610 10.1702 12.7127 19.0691 85.9921 Constraint 117 573 9.9120 12.3900 18.5850 85.9921 Constraint 117 568 11.3336 14.1670 21.2506 85.9921 Constraint 117 551 10.0562 12.5703 18.8554 85.9921 Constraint 117 312 7.5729 9.4662 14.1992 85.9921 Constraint 117 306 7.8615 9.8269 14.7403 85.9921 Constraint 117 287 8.6942 10.8677 16.3016 85.9921 Constraint 110 559 10.6859 13.3574 20.0361 85.9921 Constraint 54 340 9.0592 11.3240 16.9860 85.9921 Constraint 43 340 8.7644 10.9555 16.4332 85.9921 Constraint 223 533 12.1451 15.1813 22.7720 85.7348 Constraint 223 470 6.6689 8.3361 12.5041 85.7348 Constraint 189 649 11.4553 14.3192 21.4788 85.4525 Constraint 512 626 13.8972 17.3716 26.0573 85.1611 Constraint 157 418 14.4502 18.0628 27.0941 84.9980 Constraint 183 559 12.7646 15.9558 23.9336 84.9978 Constraint 54 374 13.8915 17.3643 26.0465 84.9924 Constraint 54 280 13.8541 17.3176 25.9764 84.9924 Constraint 86 642 13.0631 16.3288 24.4933 84.9924 Constraint 78 642 8.8671 11.0839 16.6258 84.9924 Constraint 68 642 9.0931 11.3664 17.0495 84.9924 Constraint 62 642 4.9766 6.2207 9.3310 84.9924 Constraint 54 649 8.6877 10.8597 16.2895 84.9922 Constraint 54 130 11.9906 14.9883 22.4824 84.9922 Constraint 43 649 6.2472 7.8090 11.7135 84.9922 Constraint 43 130 12.7288 15.9110 23.8665 84.9922 Constraint 68 165 13.8370 17.2962 25.9443 84.9921 Constraint 68 584 10.0222 12.5277 18.7916 84.9921 Constraint 43 324 12.6441 15.8051 23.7076 84.9921 Constraint 68 601 5.1265 6.4081 9.6121 84.9921 Constraint 68 329 9.3799 11.7249 17.5873 84.9921 Constraint 62 470 13.5611 16.9513 25.4270 84.9921 Constraint 62 329 8.9714 11.2143 16.8215 84.9921 Constraint 62 173 14.2657 17.8321 26.7481 84.9921 Constraint 117 559 8.9965 11.2456 16.8685 84.9921 Constraint 110 319 11.5602 14.4503 21.6754 84.9921 Constraint 97 615 9.5098 11.8872 17.8308 84.9921 Constraint 97 610 5.5732 6.9665 10.4497 84.9921 Constraint 97 573 6.4966 8.1208 12.1811 84.9921 Constraint 97 551 8.2836 10.3545 15.5317 84.9921 Constraint 97 312 5.1091 6.3863 9.5795 84.9921 Constraint 97 306 7.9077 9.8846 14.8269 84.9921 Constraint 97 287 10.1355 12.6694 19.0040 84.9921 Constraint 54 470 12.5484 15.6855 23.5283 84.9921 Constraint 43 470 12.7751 15.9688 23.9532 84.9921 Constraint 43 312 12.7961 15.9952 23.9928 84.9921 Constraint 319 502 13.5849 16.9811 25.4717 84.9199 Constraint 280 502 13.5645 16.9557 25.4335 84.9189 Constraint 189 551 11.3262 14.1578 21.2366 84.7451 Constraint 189 545 11.4041 14.2551 21.3826 84.7451 Constraint 189 533 9.1516 11.4395 17.1592 84.7451 Constraint 189 427 11.7034 14.6293 21.9439 84.7451 Constraint 391 540 14.3813 17.9767 26.9650 84.7409 Constraint 212 410 10.1578 12.6973 19.0460 84.7406 Constraint 559 634 14.3430 17.9287 26.8930 84.1198 Constraint 418 584 12.8529 16.0662 24.0993 84.0925 Constraint 402 593 14.3453 17.9316 26.8974 84.0610 Constraint 183 626 12.2556 15.3195 22.9793 83.9978 Constraint 62 601 8.7401 10.9252 16.3878 83.9922 Constraint 54 601 9.8046 12.2557 18.3836 83.9922 Constraint 78 234 12.4195 15.5243 23.2865 83.9921 Constraint 110 584 8.8833 11.1042 16.6563 83.9921 Constraint 86 593 5.4326 6.7908 10.1862 83.9921 Constraint 78 593 7.7113 9.6392 14.4588 83.9921 Constraint 78 540 13.6928 17.1159 25.6739 83.9921 Constraint 62 559 14.0989 17.6236 26.4355 83.9921 Constraint 117 601 11.4195 14.2744 21.4116 83.9921 Constraint 117 319 9.8242 12.2802 18.4204 83.9921 Constraint 97 350 10.7137 13.3921 20.0882 83.9921 Constraint 97 295 12.9788 16.2235 24.3352 83.9921 Constraint 97 280 11.6046 14.5058 21.7586 83.9921 Constraint 212 391 8.8142 11.0177 16.5266 83.7406 Constraint 212 526 10.4765 13.0956 19.6434 83.7406 Constraint 212 517 11.1654 13.9567 20.9350 83.7406 Constraint 212 455 10.9625 13.7032 20.5547 83.7406 Constraint 212 402 10.5925 13.2406 19.8609 83.7406 Constraint 491 626 13.8279 17.2849 25.9274 83.2924 Constraint 410 568 14.2540 17.8175 26.7263 83.1200 Constraint 287 391 14.7493 18.4367 27.6550 83.0403 Constraint 234 324 14.5234 18.1543 27.2314 83.0360 Constraint 455 601 14.6070 18.2587 27.3880 82.9924 Constraint 54 642 6.3027 7.8783 11.8175 82.9924 Constraint 43 642 4.4348 5.5435 8.3152 82.9924 Constraint 43 601 13.0517 16.3146 24.4719 82.9923 Constraint 173 455 14.3282 17.9103 26.8654 82.9922 Constraint 117 584 9.8672 12.3340 18.5009 82.9921 Constraint 97 568 9.7147 12.1433 18.2150 82.9921 Constraint 97 559 8.7169 10.8961 16.3441 82.9921 Constraint 97 319 8.1486 10.1857 15.2786 82.9921 Constraint 97 545 11.1242 13.9052 20.8578 82.9921 Constraint 97 427 10.1524 12.6906 19.0358 82.9921 Constraint 97 402 12.6512 15.8140 23.7211 82.9921 Constraint 97 340 9.2675 11.5844 17.3766 82.9921 Constraint 97 255 12.6858 15.8572 23.7858 82.9921 Constraint 212 649 10.9711 13.7139 20.5709 82.8670 Constraint 418 660 12.9106 16.1382 24.2073 82.8631 Constraint 410 660 9.6751 12.0939 18.1408 82.8631 Constraint 402 660 9.8905 12.3631 18.5447 82.8631 Constraint 374 660 5.4904 6.8630 10.2945 82.8631 Constraint 358 660 7.7813 9.7266 14.5900 82.8631 Constraint 350 660 10.3489 12.9362 19.4043 82.8631 Constraint 255 660 9.0735 11.3419 17.0128 82.8631 Constraint 243 660 8.0514 10.0642 15.0964 82.8631 Constraint 212 463 9.4330 11.7913 17.6869 82.7406 Constraint 223 446 12.4716 15.5895 23.3842 82.7348 Constraint 189 418 12.2487 15.3109 22.9664 82.4524 Constraint 491 634 14.4358 18.0448 27.0672 82.1924 Constraint 223 483 7.8430 9.8037 14.7055 82.1140 Constraint 173 610 14.2379 17.7974 26.6961 81.9982 Constraint 183 634 13.1416 16.4270 24.6405 81.9980 Constraint 78 455 14.3436 17.9295 26.8943 81.9978 Constraint 62 584 12.6334 15.7918 23.6877 81.9924 Constraint 43 551 13.8949 17.3686 26.0529 81.9924 Constraint 36 418 7.6361 9.5451 14.3176 81.9924 Constraint 36 410 5.7464 7.1831 10.7746 81.9924 Constraint 36 402 8.8967 11.1209 16.6813 81.9924 Constraint 36 391 7.6741 9.5927 14.3890 81.9924 Constraint 36 383 8.2698 10.3373 15.5059 81.9924 Constraint 36 374 11.5394 14.4243 21.6364 81.9924 Constraint 36 358 10.9707 13.7134 20.5702 81.9924 Constraint 36 350 10.6778 13.3472 20.0209 81.9924 Constraint 36 255 11.5386 14.4233 21.6349 81.9924 Constraint 36 243 11.7898 14.7372 22.1059 81.9924 Constraint 117 533 11.9503 14.9378 22.4068 81.9921 Constraint 62 234 11.4328 14.2910 21.4365 81.9921 Constraint 54 234 12.9169 16.1461 24.2191 81.9921 Constraint 43 234 12.3338 15.4172 23.1258 81.9921 Constraint 97 165 12.2770 15.3463 23.0194 81.9921 Constraint 68 593 8.7025 10.8781 16.3171 81.9921 Constraint 97 584 6.3183 7.8979 11.8469 81.9921 Constraint 97 434 9.8118 12.2647 18.3971 81.9921 Constraint 97 324 10.4987 13.1234 19.6851 81.9921 Constraint 97 533 12.0033 15.0041 22.5062 81.9921 Constraint 86 626 9.4769 11.8462 17.7692 81.9921 Constraint 78 626 5.5545 6.9432 10.4147 81.9921 Constraint 68 626 6.1792 7.7240 11.5860 81.9921 Constraint 62 626 4.0164 5.0205 7.5307 81.9921 Constraint 110 601 10.5153 13.1441 19.7161 81.9921 Constraint 110 340 13.0533 16.3167 24.4750 81.9921 Constraint 97 601 6.2160 7.7699 11.6549 81.9921 Constraint 97 329 9.2063 11.5079 17.2618 81.9921 Constraint 54 329 12.8961 16.1201 24.1802 81.9921 Constraint 43 329 12.5673 15.7091 23.5637 81.9921 Constraint 391 660 6.1104 7.6380 11.4570 81.8631 Constraint 383 660 6.3030 7.8787 11.8181 81.8631 Constraint 206 470 10.1124 12.6405 18.9607 81.7408 Constraint 206 402 12.2527 15.3159 22.9739 81.7408 Constraint 212 470 7.6818 9.6022 14.4034 81.7406 Constraint 212 374 12.5655 15.7069 23.5603 81.7406 Constraint 212 502 9.2214 11.5268 17.2901 81.6187 Constraint 197 470 10.1418 12.6773 19.0159 81.0335 Constraint 197 402 11.7046 14.6308 21.9462 81.0335 Constraint 157 634 14.3798 17.9747 26.9621 80.9977 Constraint 36 446 12.4950 15.6188 23.4282 80.9925 Constraint 36 427 11.0575 13.8218 20.7327 80.9925 Constraint 62 593 11.8428 14.8035 22.2052 80.9922 Constraint 97 418 13.7371 17.1714 25.7571 80.9921 Constraint 117 593 9.2074 11.5093 17.2639 80.9921 Constraint 110 593 7.8004 9.7505 14.6257 80.9921 Constraint 97 274 13.7668 17.2085 25.8128 80.9921 Constraint 62 295 13.7298 17.1623 25.7434 80.9921 Constraint 110 329 11.5822 14.4777 21.7165 80.9921 Constraint 223 491 8.3024 10.3780 15.5670 80.9921 Constraint 369 660 8.5892 10.7365 16.1047 80.8633 Constraint 234 660 11.0074 13.7592 20.6388 80.8631 Constraint 223 642 11.9214 14.9018 22.3527 80.8615 Constraint 212 383 12.6150 15.7688 23.6531 80.7406 Constraint 470 568 14.3350 17.9187 26.8781 80.4197 Constraint 280 418 14.5978 18.2472 27.3709 80.0404 Constraint 306 545 14.4788 18.0984 27.1477 80.0353 Constraint 206 526 10.9556 13.6945 20.5417 80.0335 Constraint 68 287 13.9148 17.3935 26.0903 79.9978 Constraint 36 615 10.1241 12.6551 18.9826 79.9926 Constraint 36 610 13.1532 16.4415 24.6623 79.9926 Constraint 36 526 13.8311 17.2889 25.9334 79.9925 Constraint 36 649 4.3355 5.4194 8.1291 79.9924 Constraint 36 642 5.7545 7.1931 10.7896 79.9924 Constraint 86 446 14.4713 18.0891 27.1336 79.9924 Constraint 86 634 13.0394 16.2992 24.4488 79.9923 Constraint 78 634 9.5604 11.9505 17.9258 79.9923 Constraint 68 634 8.2276 10.2845 15.4268 79.9923 Constraint 62 634 6.1422 7.6778 11.5166 79.9923 Constraint 54 593 13.3983 16.7479 25.1219 79.9922 Constraint 68 559 13.8889 17.3611 26.0417 79.9922 Constraint 68 526 14.0648 17.5809 26.3714 79.9922 Constraint 68 234 14.3498 17.9373 26.9059 79.9921 Constraint 54 626 5.8571 7.3214 10.9820 79.9921 Constraint 43 626 7.1106 8.8883 13.3324 79.9921 Constraint 287 593 14.1061 17.6327 26.4490 79.7449 Constraint 383 517 14.1461 17.6826 26.5239 79.7421 Constraint 212 512 11.8898 14.8622 22.2933 79.7406 Constraint 533 601 14.0221 17.5277 26.2915 79.1669 Constraint 329 584 13.6174 17.0217 25.5325 79.1619 Constraint 350 470 14.1047 17.6309 26.4463 79.0364 Constraint 234 340 13.7780 17.2224 25.8337 79.0362 Constraint 329 427 14.3455 17.9319 26.8978 79.0348 Constraint 197 391 10.5165 13.1456 19.7184 79.0338 Constraint 197 463 10.6083 13.2604 19.8906 79.0335 Constraint 197 410 12.4785 15.5981 23.3971 79.0335 Constraint 43 526 14.2827 17.8534 26.7801 78.9981 Constraint 117 329 10.8478 13.5597 20.3396 78.9934 Constraint 54 369 14.5931 18.2414 27.3622 78.9927 Constraint 36 483 13.8229 17.2786 25.9179 78.9925 Constraint 36 463 10.6106 13.2632 19.8948 78.9925 Constraint 36 455 10.1308 12.6635 18.9953 78.9925 Constraint 36 434 12.4709 15.5886 23.3830 78.9925 Constraint 36 369 13.6644 17.0805 25.6208 78.9924 Constraint 117 324 11.0260 13.7825 20.6738 78.9921 Constraint 97 540 12.4725 15.5907 23.3860 78.9921 Constraint 97 593 4.8366 6.0458 9.0687 78.9921 Constraint 280 601 14.3078 17.8848 26.8272 78.9450 Constraint 206 391 10.5993 13.2491 19.8736 78.7411 Constraint 206 463 11.1186 13.8983 20.8474 78.7408 Constraint 223 551 13.4139 16.7674 25.1511 78.7348 Constraint 197 526 9.9119 12.3899 18.5849 78.6189 Constraint 197 502 7.3579 9.1974 13.7962 78.6189 Constraint 206 502 8.5618 10.7022 16.0533 78.6189 Constraint 263 660 11.1612 13.9515 20.9272 78.1161 Constraint 280 545 14.6149 18.2686 27.4029 78.0350 Constraint 117 340 12.0762 15.0953 22.6429 77.9935 Constraint 36 470 9.7502 12.1878 18.2817 77.9925 Constraint 54 634 4.3544 5.4429 8.1644 77.9923 Constraint 43 634 5.9034 7.3792 11.0688 77.9923 Constraint 110 324 12.6293 15.7866 23.6799 77.9922 Constraint 110 568 11.7168 14.6460 21.9690 77.9921 Constraint 280 660 12.0292 15.0365 22.5547 77.8646 Constraint 189 642 11.8590 14.8237 22.2356 77.4527 Constraint 559 642 14.3634 17.9543 26.9314 77.1199 Constraint 212 483 8.6709 10.8386 16.2578 77.1197 Constraint 36 165 13.8638 17.3298 25.9947 76.9925 Constraint 97 642 13.4334 16.7918 25.1877 76.9924 Constraint 36 146 14.1702 17.7127 26.5691 76.9924 Constraint 97 526 12.9200 16.1501 24.2251 76.9921 Constraint 374 533 14.5684 18.2104 27.3157 76.0403 Constraint 86 165 14.3918 17.9898 26.9846 75.9978 Constraint 54 324 13.7248 17.1560 25.7341 75.9978 Constraint 212 491 8.8741 11.0927 16.6390 75.9978 Constraint 36 319 13.8272 17.2840 25.9261 75.9937 Constraint 517 584 13.7466 17.1833 25.7749 75.9934 Constraint 36 234 11.6694 14.5867 21.8800 75.9924 Constraint 36 340 12.7441 15.9301 23.8952 75.9924 Constraint 117 280 11.4347 14.2934 21.4402 75.9921 Constraint 255 568 14.6557 18.3196 27.4794 75.9921 Constraint 86 383 14.3350 17.9188 26.8782 75.9921 Constraint 97 626 9.7308 12.1635 18.2452 75.9921 Constraint 319 446 14.5085 18.1356 27.2034 75.9143 Constraint 223 634 12.3949 15.4937 23.2405 75.8614 Constraint 212 418 12.3151 15.3939 23.0908 75.7406 Constraint 223 540 13.5921 16.9901 25.4851 75.7348 Constraint 197 483 9.0883 11.3603 17.0405 75.4126 Constraint 206 483 9.8901 12.3627 18.5440 75.1199 Constraint 146 491 13.9501 17.4376 26.1564 74.9983 Constraint 86 295 13.2483 16.5604 24.8406 74.9978 Constraint 97 446 13.2796 16.5995 24.8992 74.9921 Constraint 319 660 13.2203 16.5254 24.7881 74.8646 Constraint 287 601 14.2279 17.7848 26.6773 74.7448 Constraint 410 559 14.4734 18.0917 27.1376 74.7406 Constraint 312 463 14.4476 18.0595 27.0892 74.0419 Constraint 306 434 14.5536 18.1921 27.2881 74.0407 Constraint 197 491 7.4806 9.3508 14.0261 73.9980 Constraint 86 358 14.4380 18.0475 27.0713 73.9978 Constraint 117 295 11.0233 13.7792 20.6688 73.9960 Constraint 463 584 13.4534 16.8167 25.2251 73.9940 Constraint 54 483 14.5554 18.1942 27.2913 73.9927 Constraint 36 634 5.1330 6.4163 9.6244 73.9924 Constraint 36 626 8.6807 10.8508 16.2763 73.9924 Constraint 383 601 14.5700 18.2125 27.3187 73.9922 Constraint 463 660 12.6924 15.8655 23.7983 73.8634 Constraint 223 626 13.3123 16.6403 24.9605 73.8614 Constraint 206 410 12.2019 15.2524 22.8786 73.7408 Constraint 212 427 13.4687 16.8358 25.2537 73.7406 Constraint 189 350 13.4805 16.8506 25.2759 73.4540 Constraint 206 491 8.4726 10.5908 15.8862 72.9980 Constraint 78 173 14.3260 17.9075 26.8612 72.9978 Constraint 173 660 11.2767 14.0959 21.1439 72.9942 Constraint 165 660 11.9978 14.9972 22.4958 72.9942 Constraint 62 533 14.1000 17.6250 26.4375 72.9922 Constraint 97 463 14.1579 17.6974 26.5460 72.9921 Constraint 287 502 14.0500 17.5625 26.3438 72.9186 Constraint 189 280 13.9452 17.4315 26.1473 72.7454 Constraint 295 626 14.5102 18.1378 27.2067 72.4197 Constraint 117 350 12.5107 15.6384 23.4575 71.9960 Constraint 117 274 12.2669 15.3336 23.0005 71.9960 Constraint 43 573 14.3069 17.8836 26.8254 71.9940 Constraint 391 573 14.2434 17.8042 26.7063 71.9937 Constraint 243 573 14.5037 18.1296 27.1944 71.9924 Constraint 324 634 14.3767 17.9709 26.9563 71.9450 Constraint 197 517 9.8019 12.2524 18.3785 71.7453 Constraint 350 483 14.2581 17.8226 26.7339 71.1215 Constraint 206 517 10.7124 13.3906 20.0858 71.0335 Constraint 62 568 14.3085 17.8857 26.8285 70.9995 Constraint 183 660 11.6995 14.6244 21.9366 70.9980 Constraint 189 446 12.4754 15.5943 23.3914 70.9978 Constraint 146 470 14.2163 17.7704 26.6556 70.9976 Constraint 97 634 13.6721 17.0902 25.6353 70.9923 Constraint 189 540 10.9826 13.7282 20.5923 70.7451 Constraint 350 584 14.0270 17.5338 26.3007 70.0624 Constraint 491 642 14.6072 18.2591 27.3886 69.9986 Constraint 146 660 12.5290 15.6613 23.4919 69.9955 Constraint 62 660 11.8393 14.7991 22.1986 69.9940 Constraint 117 545 12.8788 16.0985 24.1477 69.9921 Constraint 340 660 13.9007 17.3759 26.0638 69.8685 Constraint 223 660 11.6838 14.6047 21.9071 69.8632 Constraint 206 512 10.4458 13.0573 19.5860 69.6189 Constraint 212 533 12.8198 16.0247 24.0371 69.6187 Constraint 43 306 14.1202 17.6502 26.4753 68.9981 Constraint 110 280 13.7611 17.2014 25.8021 68.9941 Constraint 470 660 12.1739 15.2174 22.8261 68.9940 Constraint 402 584 13.3734 16.7168 25.0752 68.9935 Constraint 197 512 9.1557 11.4446 17.1670 68.7453 Constraint 306 568 14.5982 18.2477 27.3716 68.4145 Constraint 340 463 14.0236 17.5295 26.2943 68.0421 Constraint 274 512 14.1030 17.6288 26.4431 68.0404 Constraint 54 660 12.8287 16.0358 24.0537 67.9940 Constraint 43 660 9.1433 11.4291 17.1436 67.9940 Constraint 62 483 14.2005 17.7506 26.6259 67.9936 Constraint 43 263 14.1832 17.7290 26.5936 67.9927 Constraint 97 383 14.1620 17.7025 26.5538 67.9923 Constraint 117 626 13.1306 16.4132 24.6198 67.9923 Constraint 189 626 12.5845 15.7307 23.5960 67.7466 Constraint 274 660 12.3609 15.4511 23.1766 66.9955 Constraint 212 642 12.7810 15.9762 23.9644 66.8673 Constraint 197 533 10.9768 13.7210 20.5815 66.7453 Constraint 223 369 13.6713 17.0891 25.6336 66.6134 Constraint 383 491 14.5445 18.1806 27.2710 66.2983 Constraint 324 593 13.7872 17.2340 25.8510 66.1670 Constraint 117 540 12.5195 15.6494 23.4741 65.9922 Constraint 173 312 14.7505 18.4381 27.6571 65.9921 Constraint 340 545 13.9701 17.4626 26.1939 65.0366 Constraint 197 383 13.2010 16.5012 24.7518 65.0338 Constraint 540 642 14.6111 18.2639 27.3958 64.8686 Constraint 517 649 14.1053 17.6316 26.4474 64.8685 Constraint 206 455 12.3784 15.4730 23.2095 64.7409 Constraint 54 306 14.5431 18.1788 27.2682 63.9981 Constraint 157 660 13.2852 16.6065 24.9098 63.9955 Constraint 36 660 8.8689 11.0862 16.6292 63.9943 Constraint 36 223 13.5639 16.9549 25.4323 63.9925 Constraint 312 540 14.4899 18.1123 27.1685 63.0366 Constraint 25 649 6.0641 7.5802 11.3703 62.9981 Constraint 25 642 7.8665 9.8331 14.7497 62.9981 Constraint 25 391 9.4099 11.7623 17.6435 62.9981 Constraint 25 383 9.1814 11.4767 17.2150 62.9981 Constraint 25 358 10.6290 13.2863 19.9294 62.9981 Constraint 25 350 11.6844 14.6054 21.9082 62.9981 Constraint 183 610 14.0685 17.5856 26.3784 62.9981 Constraint 110 295 12.6161 15.7701 23.6552 62.9979 Constraint 189 559 12.6710 15.8387 23.7581 62.7456 Constraint 274 545 14.7407 18.4259 27.6388 62.1199 Constraint 340 526 13.7846 17.2307 25.8461 62.0424 Constraint 197 374 12.4003 15.5004 23.2506 62.0335 Constraint 25 470 13.0027 16.2534 24.3801 61.9982 Constraint 25 418 11.4828 14.3534 21.5302 61.9982 Constraint 25 410 9.2081 11.5101 17.2651 61.9982 Constraint 25 402 11.6064 14.5080 21.7620 61.9982 Constraint 25 255 12.7952 15.9940 23.9911 61.9982 Constraint 117 255 13.1022 16.3778 24.5667 61.9963 Constraint 165 584 14.0618 17.5772 26.3658 61.9927 Constraint 97 234 14.4145 18.0181 27.0272 61.9923 Constraint 189 634 12.8101 16.0127 24.0190 61.4540 Constraint 340 559 14.1087 17.6358 26.4538 61.4157 Constraint 197 455 12.0716 15.0895 22.6342 61.0337 Constraint 25 615 13.2949 16.6186 24.9279 60.9983 Constraint 173 573 14.6844 18.3554 27.5332 60.9981 Constraint 165 601 14.1949 17.7437 26.6155 60.9981 Constraint 78 483 14.4921 18.1151 27.1727 60.9980 Constraint 183 568 14.2116 17.7645 26.6468 60.9978 Constraint 86 157 14.1007 17.6259 26.4388 60.9978 Constraint 206 533 12.0567 15.0709 22.6063 60.8721 Constraint 189 319 14.2560 17.8200 26.7300 60.7467 Constraint 295 610 14.5328 18.1660 27.2490 60.4199 Constraint 491 610 14.4732 18.0915 27.1372 60.1984 Constraint 183 287 14.2234 17.7792 26.6689 59.9982 Constraint 25 374 11.0849 13.8561 20.7842 59.9981 Constraint 295 642 14.6748 18.3435 27.5153 59.8673 Constraint 212 446 13.1407 16.4259 24.6389 59.7406 Constraint 197 649 12.7430 15.9288 23.8932 59.1614 Constraint 329 634 14.0954 17.6192 26.4288 59.0673 Constraint 470 559 14.5434 18.1793 27.2689 59.0406 Constraint 25 455 13.9233 17.4042 26.1063 58.9995 Constraint 25 243 12.9518 16.1897 24.2846 58.9982 Constraint 25 463 13.9633 17.4541 26.1812 58.9982 Constraint 173 446 14.4699 18.0873 27.1310 58.9981 Constraint 117 427 12.8732 16.0915 24.1373 58.9925 Constraint 212 660 11.5852 14.4815 21.7222 58.8671 Constraint 312 391 14.6447 18.3059 27.4588 58.0406 Constraint 157 615 14.5944 18.2430 27.3645 57.9981 Constraint 54 584 13.2559 16.5699 24.8549 57.9934 Constraint 212 634 13.0765 16.3456 24.5184 57.8672 Constraint 189 660 11.3975 14.2469 21.3703 57.7053 Constraint 25 427 14.4970 18.1212 27.1819 56.9995 Constraint 212 545 13.2531 16.5664 24.8496 56.8731 Constraint 274 410 14.7926 18.4907 27.7360 56.0405 Constraint 263 573 14.6511 18.3139 27.4708 55.9990 Constraint 17 649 5.8775 7.3469 11.0204 55.9982 Constraint 17 642 8.8915 11.1144 16.6716 55.9982 Constraint 17 391 8.7275 10.9093 16.3640 55.9982 Constraint 17 383 9.2391 11.5489 17.3233 55.9982 Constraint 25 634 8.8448 11.0560 16.5840 55.9982 Constraint 25 340 13.4705 16.8381 25.2572 55.9982 Constraint 183 573 13.8888 17.3610 26.0415 55.9981 Constraint 491 649 14.6635 18.3294 27.4940 54.9994 Constraint 17 418 12.5553 15.6941 23.5412 54.9983 Constraint 17 410 9.5627 11.9533 17.9300 54.9983 Constraint 25 626 11.4508 14.3134 21.4702 54.9983 Constraint 17 358 10.7764 13.4705 20.2057 54.9982 Constraint 110 615 13.7518 17.1898 25.7846 54.9942 Constraint 97 358 14.5632 18.2041 27.3061 54.9927 Constraint 206 545 13.5087 16.8859 25.3289 54.8725 Constraint 36 545 14.2890 17.8613 26.7920 53.9997 Constraint 17 374 10.0103 12.5129 18.7693 53.9982 Constraint 130 455 14.3044 17.8806 26.8208 53.9981 Constraint 110 350 14.0723 17.5904 26.3856 53.9945 Constraint 206 649 12.0190 15.0237 22.5356 53.8673 Constraint 189 358 13.0221 16.2776 24.4164 53.4537 Constraint 312 410 14.7976 18.4970 27.7455 53.4198 Constraint 17 402 11.7650 14.7062 22.0593 52.9983 Constraint 146 455 14.5800 18.2250 27.3375 52.9980 Constraint 358 667 10.0186 12.5233 18.7849 52.8654 Constraint 197 551 12.9828 16.2285 24.3427 52.7454 Constraint 197 418 13.4106 16.7632 25.1448 52.0337 Constraint 17 350 12.4337 15.5422 23.3133 51.9983 Constraint 183 434 14.0020 17.5025 26.2538 51.9981 Constraint 146 223 13.9457 17.4322 26.1483 51.9924 Constraint 374 667 8.0692 10.0865 15.1298 51.8654 Constraint 369 667 11.2735 14.0919 21.1379 51.8654 Constraint 243 667 10.8450 13.5563 20.3344 51.8654 Constraint 391 667 8.7501 10.9377 16.4065 51.8653 Constraint 383 667 9.0899 11.3624 17.0435 51.8653 Constraint 287 545 14.6803 18.3504 27.5256 51.6186 Constraint 197 642 13.9980 17.4975 26.2462 51.1603 Constraint 383 559 14.5142 18.1427 27.2141 51.1203 Constraint 295 551 14.3854 17.9818 26.9727 51.0404 Constraint 25 234 13.8545 17.3181 25.9771 50.9982 Constraint 97 263 14.7473 18.4341 27.6512 50.9982 Constraint 43 545 14.6386 18.2983 27.4474 49.9999 Constraint 43 274 14.5611 18.2014 27.3020 49.9999 Constraint 36 551 14.3704 17.9630 26.9445 49.9997 Constraint 36 280 14.6508 18.3135 27.4702 49.9985 Constraint 17 255 12.3900 15.4874 23.2312 49.9983 Constraint 25 369 13.1399 16.4249 24.6374 49.9983 Constraint 117 434 12.7598 15.9498 23.9247 49.9925 Constraint 206 660 12.2016 15.2520 22.8780 49.8673 Constraint 255 667 11.6957 14.6197 21.9295 49.8654 Constraint 410 667 11.3136 14.1421 21.2131 49.8653 Constraint 402 667 12.1782 15.2228 22.8341 49.8653 Constraint 197 545 11.9280 14.9100 22.3650 49.7454 Constraint 197 540 11.5388 14.4235 21.6352 49.7454 Constraint 17 243 11.6430 14.5537 21.8305 48.9984 Constraint 17 470 12.0908 15.1135 22.6702 48.9983 Constraint 17 634 10.3188 12.8984 19.3477 48.9983 Constraint 17 626 12.9154 16.1442 24.2164 48.9983 Constraint 117 263 13.4634 16.8292 25.2438 48.9982 Constraint 25 660 7.9544 9.9430 14.9144 48.9981 Constraint 110 533 13.2936 16.6170 24.9255 48.9925 Constraint 350 667 12.4474 15.5592 23.3388 48.8654 Constraint 533 649 14.7639 18.4549 27.6823 48.8612 Constraint 463 593 14.4942 18.1177 27.1766 48.0683 Constraint 62 183 14.0091 17.5114 26.2671 47.9996 Constraint 455 584 13.9879 17.4849 26.2273 47.9993 Constraint 130 491 14.5953 18.2441 27.3661 47.9984 Constraint 17 369 12.6370 15.7963 23.6945 47.9984 Constraint 358 470 14.6910 18.3637 27.5456 47.9981 Constraint 86 533 14.5583 18.1979 27.2969 47.9980 Constraint 483 584 14.3091 17.8864 26.8295 47.9936 Constraint 110 434 12.9655 16.2069 24.3104 47.9924 Constraint 324 649 14.6363 18.2953 27.4430 47.8682 Constraint 329 434 14.5423 18.1779 27.2668 47.4198 Constraint 374 483 14.1804 17.7255 26.5883 47.1202 Constraint 36 212 13.4894 16.8618 25.2927 46.9982 Constraint 117 526 13.3298 16.6622 24.9933 46.9945 Constraint 197 446 12.9829 16.2286 24.3429 46.7455 Constraint 197 427 12.9772 16.2215 24.3323 46.7455 Constraint 287 584 14.3015 17.8768 26.8153 46.7451 Constraint 78 517 14.8814 18.6018 27.9027 45.9996 Constraint 117 615 13.1332 16.4165 24.6247 45.9962 Constraint 427 660 13.9049 17.3811 26.0716 45.9958 Constraint 526 660 13.5983 16.9979 25.4969 45.9957 Constraint 206 540 12.9465 16.1831 24.2746 45.8723 Constraint 306 391 14.8325 18.5407 27.8110 45.7423 Constraint 17 234 13.2178 16.5222 24.7833 44.9985 Constraint 17 660 6.8687 8.5858 12.8787 44.9982 Constraint 110 545 13.3688 16.7110 25.0664 44.9925 Constraint 319 483 14.5225 18.1531 27.2297 44.1215 Constraint 197 369 13.3123 16.6404 24.9605 44.0351 Constraint 568 642 14.6879 18.3598 27.5398 43.9995 Constraint 36 130 14.8867 18.6084 27.9126 43.9984 Constraint 274 573 14.7665 18.4581 27.6871 43.9981 Constraint 157 434 14.1588 17.6985 26.5478 43.9980 Constraint 157 470 14.6008 18.2510 27.3765 43.9978 Constraint 117 402 13.9426 17.4282 26.1423 43.9963 Constraint 110 626 13.8677 17.3346 26.0020 43.9944 Constraint 455 660 13.7647 17.2059 25.8088 43.8636 Constraint 197 274 13.8736 17.3420 26.0130 43.6192 Constraint 324 559 14.5702 18.2128 27.3192 43.4160 Constraint 324 660 13.5609 16.9511 25.4266 42.9994 Constraint 17 463 13.7205 17.1506 25.7259 42.9985 Constraint 36 183 13.8947 17.3684 26.0526 42.9984 Constraint 110 427 13.5248 16.9060 25.3590 42.9925 Constraint 212 369 13.5985 16.9981 25.4971 42.7421 Constraint 206 418 13.2435 16.5544 24.8316 42.7413 Constraint 306 634 14.5661 18.2076 27.3115 42.0676 Constraint 189 434 13.7994 17.2493 25.8739 41.9996 Constraint 43 157 14.7401 18.4251 27.6376 41.9985 Constraint 43 173 14.8496 18.5620 27.8429 41.9928 Constraint 110 540 13.2133 16.5166 24.7749 41.9925 Constraint 234 667 12.9461 16.1826 24.2739 41.8653 Constraint 197 660 12.0983 15.1228 22.6843 41.4141 Constraint 212 626 13.9921 17.4901 26.2352 40.8687 Constraint 197 559 14.1551 17.6939 26.5408 39.7455 Constraint 206 374 11.5302 14.4128 21.6192 39.7411 Constraint 206 446 13.8199 17.2749 25.9123 39.0342 Constraint 189 610 13.9993 17.4991 26.2487 39.0000 Constraint 189 573 13.3928 16.7410 25.1115 38.9999 Constraint 189 568 13.1035 16.3794 24.5691 38.9999 Constraint 369 470 14.9148 18.6435 27.9653 38.9996 Constraint 130 470 14.7387 18.4234 27.6351 38.9978 Constraint 43 667 10.4797 13.0996 19.6494 38.9962 Constraint 340 533 14.3284 17.9105 26.8657 38.0424 Constraint 324 533 14.5683 18.2103 27.3155 38.0422 Constraint 212 551 13.5691 16.9614 25.4420 37.9997 Constraint 223 358 14.2242 17.7802 26.6703 37.9985 Constraint 17 455 13.8346 17.2933 25.9399 37.9983 Constraint 78 502 14.6260 18.2825 27.4238 37.9980 Constraint 263 667 13.2098 16.5123 24.7684 37.9964 Constraint 223 350 14.3138 17.8923 26.8384 37.6207 Constraint 391 673 10.9583 13.6979 20.5468 37.5791 Constraint 383 673 10.6538 13.3173 19.9759 37.5791 Constraint 374 673 9.3850 11.7312 17.5968 37.5791 Constraint 243 673 12.4332 15.5415 23.3123 37.5791 Constraint 17 223 13.5929 16.9911 25.4866 36.9983 Constraint 68 157 14.6175 18.2719 27.4079 36.9980 Constraint 36 667 10.0307 12.5384 18.8076 36.9964 Constraint 358 502 14.3955 17.9943 26.9915 36.9189 Constraint 206 551 13.7171 17.1463 25.7195 36.8734 Constraint 287 615 14.5399 18.1749 27.2624 35.7455 Constraint 369 673 11.6314 14.5392 21.8088 35.5792 Constraint 212 540 13.0415 16.3018 24.4527 34.9998 Constraint 502 660 13.8854 17.3568 26.0352 34.9959 Constraint 223 667 12.2235 15.2793 22.9190 34.8653 Constraint 206 383 11.9646 14.9558 22.4337 34.7424 Constraint 358 673 10.3000 12.8750 19.3125 34.5791 Constraint 255 673 12.9622 16.2028 24.3042 34.5791 Constraint 206 427 13.4342 16.7927 25.1891 34.0345 Constraint 86 526 14.6995 18.3744 27.5616 33.9980 Constraint 173 667 13.2462 16.5577 24.8365 33.9963 Constraint 212 667 11.7402 14.6753 22.0129 33.8673 Constraint 312 446 14.6526 18.3158 27.4737 33.2984 Constraint 280 593 14.7848 18.4810 27.7215 33.1686 Constraint 410 584 14.5079 18.1349 27.2023 32.9999 Constraint 374 610 14.7516 18.4395 27.6592 32.9986 Constraint 43 183 14.3092 17.8865 26.8297 32.9986 Constraint 25 667 8.2995 10.3744 15.5616 32.9983 Constraint 68 369 14.6186 18.2733 27.4099 32.9983 Constraint 165 593 14.6856 18.3570 27.5355 32.9979 Constraint 36 601 14.6704 18.3380 27.5070 32.9929 Constraint 418 667 13.6512 17.0640 25.5960 32.8666 Constraint 206 369 13.3268 16.6586 24.9878 32.7424 Constraint 391 559 14.7202 18.4002 27.6003 32.1216 Constraint 350 568 14.7558 18.4447 27.6671 30.9999 Constraint 117 369 14.4166 18.0208 27.0312 30.9996 Constraint 110 274 14.0693 17.5866 26.3799 30.9985 Constraint 62 667 13.3624 16.7030 25.0545 30.9975 Constraint 165 667 14.1512 17.6890 26.5335 30.9963 Constraint 206 642 12.6685 15.8356 23.7534 30.8689 Constraint 234 601 14.8813 18.6016 27.9024 30.7468 Constraint 324 584 14.0679 17.5849 26.3773 30.0674 Constraint 36 189 13.2114 16.5143 24.7714 29.9995 Constraint 17 183 14.0383 17.5479 26.3218 29.9986 Constraint 68 533 14.8684 18.5855 27.8783 29.9983 Constraint 78 183 14.1275 17.6593 26.4890 29.9982 Constraint 470 667 12.8744 16.0930 24.1395 29.7435 Constraint 274 540 14.5255 18.1568 27.2353 29.4202 Constraint 340 446 14.7429 18.4286 27.6429 29.1215 Constraint 9 391 10.9037 13.6296 20.4444 28.9997 Constraint 9 383 9.8048 12.2560 18.3839 28.9997 Constraint 9 374 10.7496 13.4370 20.1555 28.9997 Constraint 9 358 10.1439 12.6799 19.0199 28.9997 Constraint 17 667 7.9963 9.9954 14.9930 28.9984 Constraint 189 667 11.8878 14.8597 22.2896 28.7055 Constraint 329 559 14.5541 18.1927 27.2890 28.4160 Constraint 280 434 14.5555 18.1944 27.2916 28.2983 Constraint 197 634 14.0543 17.5679 26.3518 28.1604 Constraint 234 584 14.4092 18.0115 27.0172 27.9999 Constraint 43 483 14.8552 18.5690 27.8535 27.9999 Constraint 9 649 8.0402 10.0503 15.0754 27.9998 Constraint 9 642 9.4475 11.8093 17.7140 27.9998 Constraint 9 410 11.5509 14.4387 21.6580 27.9998 Constraint 9 350 11.9355 14.9194 22.3791 27.9998 Constraint 25 319 14.3797 17.9746 26.9620 27.9996 Constraint 280 667 13.3851 16.7314 25.0971 27.8670 Constraint 287 540 14.6761 18.3451 27.5177 27.6192 Constraint 319 517 14.1576 17.6970 26.5455 27.0421 Constraint 573 649 14.6217 18.2772 27.4158 26.9998 Constraint 183 667 13.2266 16.5333 24.8000 26.9982 Constraint 274 483 14.1548 17.6935 26.5402 26.1202 Constraint 374 680 10.4095 13.0119 19.5179 26.0983 Constraint 324 526 14.0970 17.6212 26.4319 26.0421 Constraint 54 568 14.7256 18.4070 27.6104 26.0000 Constraint 9 402 13.1703 16.4629 24.6943 25.9998 Constraint 9 255 13.0588 16.3235 24.4852 25.9998 Constraint 17 340 14.2795 17.8493 26.7740 25.9996 Constraint 36 673 12.0728 15.0910 22.6365 25.9985 Constraint 86 274 14.6012 18.2515 27.3773 25.9980 Constraint 502 615 14.7785 18.4732 27.7098 25.9467 Constraint 43 189 14.1279 17.6598 26.4898 24.9998 Constraint 97 517 14.5430 18.1787 27.2680 24.9926 Constraint 463 667 13.5241 16.9051 25.3577 24.8655 Constraint 410 673 12.5857 15.7321 23.5981 24.5804 Constraint 402 673 13.2548 16.5685 24.8527 24.5791 Constraint 9 634 11.2244 14.0305 21.0458 23.9999 Constraint 36 573 14.3647 17.9558 26.9337 23.9999 Constraint 9 243 13.2708 16.5885 24.8827 23.9998 Constraint 17 280 14.5919 18.2399 27.3598 23.9998 Constraint 43 673 11.5663 14.4578 21.6867 23.9985 Constraint 157 601 14.6200 18.2750 27.4125 23.9983 Constraint 350 673 12.5175 15.6468 23.4702 23.5807 Constraint 350 540 14.6988 18.3735 27.5603 23.4218 Constraint 391 680 10.9207 13.6508 20.4762 23.0982 Constraint 62 189 14.1438 17.6797 26.5196 22.9998 Constraint 97 369 14.8423 18.5529 27.8294 22.9997 Constraint 54 667 13.5598 16.9497 25.4246 22.9996 Constraint 130 660 14.6698 18.3373 27.5059 22.9978 Constraint 9 369 12.1099 15.1374 22.7061 21.9998 Constraint 17 263 14.4554 18.0693 27.1039 21.9998 Constraint 197 568 14.6772 18.3465 27.5197 21.9986 Constraint 117 512 12.9906 16.2382 24.3573 21.9983 Constraint 117 517 13.4944 16.8680 25.3019 21.9945 Constraint 206 634 12.8551 16.0688 24.1033 21.8689 Constraint 358 680 10.5383 13.1729 19.7593 21.8056 Constraint 383 680 10.5230 13.1537 19.7306 21.8055 Constraint 223 434 13.4647 16.8309 25.2464 21.7423 Constraint 212 358 14.1532 17.6916 26.5373 21.6206 Constraint 274 491 14.4052 18.0066 27.0098 21.2983 Constraint 340 568 14.3915 17.9894 26.9841 21.1217 Constraint 319 512 14.3591 17.9489 26.9233 21.0424 Constraint 295 402 14.1971 17.7464 26.6196 21.0408 Constraint 512 584 14.3605 17.9506 26.9259 21.0000 Constraint 25 146 14.7588 18.4485 27.6727 20.9999 Constraint 9 660 9.1170 11.3963 17.0944 20.9997 Constraint 25 673 9.9755 12.4694 18.7040 20.9985 Constraint 206 667 10.8259 13.5324 20.2987 20.8685 Constraint 263 673 14.0341 17.5427 26.3140 20.5805 Constraint 358 533 14.6335 18.2918 27.4377 20.4203 Constraint 274 517 14.4817 18.1021 27.1532 20.4199 Constraint 369 483 14.6098 18.2623 27.3934 20.1216 Constraint 369 680 11.6057 14.5072 21.7607 20.0983 Constraint 306 540 14.6727 18.3408 27.5112 20.0427 Constraint 350 517 14.2976 17.8720 26.8080 20.0424 Constraint 9 340 12.6855 15.8568 23.7852 19.9999 Constraint 117 358 14.6495 18.3118 27.4677 19.9999 Constraint 173 340 14.4565 18.0706 27.1059 19.9996 Constraint 17 673 9.9915 12.4894 18.7341 19.9985 Constraint 117 502 13.5207 16.9009 25.3513 19.9983 Constraint 117 234 13.8846 17.3557 26.0336 19.9982 Constraint 512 642 14.3726 17.9657 26.9485 19.8686 Constraint 383 512 14.3093 17.8866 26.8299 19.7410 Constraint 9 626 12.8542 16.0677 24.1015 19.0000 Constraint 9 470 13.9819 17.4774 26.2161 18.9999 Constraint 9 418 13.2809 16.6011 24.9016 18.9999 Constraint 17 615 14.4363 18.0454 27.0681 18.9998 Constraint 17 212 11.1947 13.9933 20.9900 18.9986 Constraint 43 287 14.7401 18.4251 27.6377 18.9986 Constraint 183 615 14.3934 17.9918 26.9877 18.9984 Constraint 117 446 13.1440 16.4300 24.6449 18.9984 Constraint 173 568 14.6020 18.2525 27.3788 18.9982 Constraint 110 526 14.3126 17.8907 26.8361 18.9967 Constraint 483 660 12.7858 15.9823 23.9734 18.9960 Constraint 287 512 14.7758 18.4697 27.7045 18.6190 Constraint 25 280 14.4026 18.0032 27.0048 17.9999 Constraint 255 584 14.4716 18.0895 27.1342 17.9999 Constraint 117 383 14.7175 18.3969 27.5954 17.9999 Constraint 287 660 14.3787 17.9734 26.9601 17.9997 Constraint 157 584 14.0592 17.5740 26.3609 17.9986 Constraint 274 667 13.8960 17.3699 26.0549 17.9979 Constraint 306 502 14.1139 17.6424 26.4636 17.9206 Constraint 287 463 14.5615 18.2019 27.3028 17.9190 Constraint 206 358 13.4546 16.8182 25.2274 17.7426 Constraint 197 667 11.3317 14.1647 21.2470 17.4144 Constraint 243 680 11.8902 14.8628 22.2942 17.0983 Constraint 512 634 14.3934 17.9917 26.9876 17.0687 Constraint 306 463 14.6632 18.3290 27.4935 17.0427 Constraint 36 173 14.9740 18.7175 28.0762 17.0000 Constraint 157 446 13.5574 16.9468 25.4202 16.9982 Constraint 340 667 13.9225 17.4031 26.1047 16.8689 Constraint 319 667 14.1936 17.7420 26.6130 16.8669 Constraint 280 673 13.1875 16.4844 24.7266 16.5809 Constraint 197 358 13.8206 17.2758 25.9137 16.0354 Constraint 9 615 14.1520 17.6900 26.5351 16.0000 Constraint 9 280 13.8965 17.3706 26.0560 15.9999 Constraint 17 165 14.0396 17.5494 26.3242 15.9998 Constraint 36 206 13.5726 16.9657 25.4486 15.9998 Constraint 117 463 13.7272 17.1590 25.7385 15.9997 Constraint 62 502 14.7562 18.4453 27.6679 15.9996 Constraint 43 680 11.3017 14.1272 21.1907 15.9985 Constraint 25 680 10.9389 13.6736 20.5105 15.9985 Constraint 68 295 14.2517 17.8147 26.7220 15.9983 Constraint 173 434 14.2679 17.8348 26.7522 15.9981 Constraint 551 660 14.5367 18.1708 27.2563 15.9960 Constraint 255 680 12.3060 15.3825 23.0738 15.8056 Constraint 295 533 14.0783 17.5979 26.3969 15.0411 Constraint 17 173 14.1354 17.6692 26.5038 14.9999 Constraint 25 212 13.2829 16.6036 24.9054 14.9998 Constraint 173 673 14.3924 17.9905 26.9858 14.9997 Constraint 517 601 14.5813 18.2266 27.3400 14.9997 Constraint 43 223 13.1991 16.4989 24.7484 14.9995 Constraint 358 601 14.7751 18.4689 27.7033 14.9987 Constraint 117 483 14.5749 18.2186 27.3279 14.9984 Constraint 287 568 14.6103 18.2629 27.3944 14.9983 Constraint 78 470 14.7306 18.4132 27.6198 14.9983 Constraint 146 667 13.9827 17.4784 26.2176 14.9978 Constraint 97 410 14.7167 18.3959 27.5938 14.9926 Constraint 223 673 14.0393 17.5491 26.3236 14.8734 Constraint 402 680 12.0903 15.1128 22.6692 14.8055 Constraint 206 626 13.2163 16.5204 24.7805 14.1618 Constraint 383 540 14.8022 18.5027 27.7541 14.1215 Constraint 410 680 10.9225 13.6531 20.4797 14.0982 Constraint 517 593 14.0132 17.5165 26.2747 14.0688 Constraint 206 350 13.7935 17.2418 25.8628 14.0354 Constraint 17 427 13.8744 17.3430 26.0145 13.9998 Constraint 25 189 13.6974 17.1217 25.6826 13.9998 Constraint 374 691 11.7503 14.6879 22.0318 13.9991 Constraint 36 680 10.5910 13.2387 19.8581 13.9985 Constraint 350 680 12.8740 16.0925 24.1388 13.8059 Constraint 234 673 13.8466 17.3082 25.9624 13.5805 Constraint 234 680 13.5124 16.8905 25.3357 13.0982 Constraint 206 559 13.7546 17.1932 25.7898 13.0000 Constraint 17 189 12.6231 15.7788 23.6682 12.9999 Constraint 189 673 13.5563 16.9454 25.4181 12.9999 Constraint 9 319 13.8206 17.2758 25.9136 12.9999 Constraint 9 146 14.8898 18.6123 27.9184 12.9999 Constraint 491 660 14.5208 18.1510 27.2265 12.9999 Constraint 223 610 13.8091 17.2614 25.8921 12.9998 Constraint 78 660 14.0685 17.5856 26.3784 12.9996 Constraint 86 463 14.4978 18.1223 27.1835 12.9996 Constraint 369 691 13.5272 16.9090 25.3635 12.9991 Constraint 358 691 12.4336 15.5420 23.3130 12.9991 Constraint 369 615 14.7813 18.4766 27.7150 12.9986 Constraint 157 593 14.7706 18.4632 27.6948 12.9985 Constraint 17 680 10.3088 12.8860 19.3290 12.9985 Constraint 212 350 14.2739 17.8423 26.7635 12.8734 Constraint 197 626 13.5497 16.9371 25.4057 12.7473 Constraint 383 691 12.8665 16.0831 24.1247 12.7064 Constraint 312 649 14.6040 18.2550 27.3825 12.1204 Constraint 280 512 14.7480 18.4350 27.6526 12.0411 Constraint 3 649 9.9208 12.4009 18.6014 11.9999 Constraint 3 642 11.2090 14.0113 21.0169 11.9999 Constraint 3 391 12.4062 15.5078 23.2617 11.9999 Constraint 3 383 11.0299 13.7874 20.6811 11.9999 Constraint 3 374 11.0896 13.8620 20.7929 11.9999 Constraint 3 358 10.4923 13.1154 19.6730 11.9999 Constraint 25 165 14.8992 18.6240 27.9361 11.9999 Constraint 62 540 14.6912 18.3640 27.5460 11.9999 Constraint 9 234 14.7058 18.3822 27.5734 11.9999 Constraint 62 673 13.3088 16.6360 24.9540 11.9999 Constraint 9 324 14.7850 18.4812 27.7218 11.9999 Constraint 306 660 14.2891 17.8614 26.7921 11.9997 Constraint 110 255 14.0808 17.6010 26.4015 11.9987 Constraint 455 593 14.5291 18.1613 27.2420 11.9986 Constraint 223 559 14.1853 17.7316 26.5975 11.9985 Constraint 263 434 14.5018 18.1273 27.1910 11.9984 Constraint 68 243 14.5545 18.1932 27.2898 11.9983 Constraint 455 667 13.5671 16.9589 25.4384 11.8687 Constraint 280 680 14.0508 17.5635 26.3452 11.8056 Constraint 280 517 14.7340 18.4176 27.6263 11.0425 Constraint 183 306 14.2160 17.7700 26.6550 10.9999 Constraint 295 660 14.5166 18.1457 27.2186 10.9998 Constraint 223 615 13.2125 16.5156 24.7734 10.9998 Constraint 62 680 13.5225 16.9031 25.3546 10.9985 Constraint 206 673 13.5108 16.8885 25.3327 10.8735 Constraint 189 287 13.8281 17.2851 25.9277 10.7472 Constraint 319 455 14.6560 18.3201 27.4801 10.2997 Constraint 274 634 14.7671 18.4589 27.6884 10.1986 Constraint 206 568 14.7952 18.4940 27.7411 10.0000 Constraint 43 584 15.0329 18.7911 28.1866 10.0000 Constraint 3 634 13.0521 16.3152 24.4728 9.9999 Constraint 3 410 13.0772 16.3465 24.5197 9.9999 Constraint 3 350 12.7354 15.9192 23.8788 9.9999 Constraint 78 189 14.2193 17.7741 26.6612 9.9999 Constraint 197 434 14.0727 17.5909 26.3863 9.9996 Constraint 62 223 13.0443 16.3054 24.4581 9.9995 Constraint 287 434 13.5132 16.8915 25.3372 9.9984 Constraint 86 540 14.5134 18.1418 27.2127 9.9983 Constraint 312 502 13.9134 17.3917 26.0876 9.9209 Constraint 255 593 14.9604 18.7005 28.0508 9.8688 Constraint 295 559 13.3408 16.6759 25.0139 9.4202 Constraint 319 470 15.0201 18.7751 28.1627 9.2997 Constraint 358 434 14.1130 17.6412 26.4618 9.2987 Constraint 280 540 14.6472 18.3090 27.4635 9.2986 Constraint 43 212 14.1019 17.6273 26.4410 9.0000 Constraint 36 263 15.0417 18.8021 28.2031 9.0000 Constraint 3 660 7.7246 9.6557 14.4836 8.9999 Constraint 17 483 14.0228 17.5285 26.2927 8.9999 Constraint 189 615 13.7757 17.2196 25.8294 8.9999 Constraint 223 568 14.4781 18.0977 27.1465 8.9998 Constraint 243 568 14.8257 18.5322 27.7983 8.9998 Constraint 25 206 12.9607 16.2009 24.3013 8.9998 Constraint 117 418 14.1269 17.6586 26.4879 8.9997 Constraint 324 545 14.7716 18.4646 27.6968 8.9997 Constraint 117 243 14.7908 18.4885 27.7328 8.9997 Constraint 25 223 12.8731 16.0914 24.1370 8.9996 Constraint 374 491 14.4425 18.0532 27.0798 8.9986 Constraint 97 483 14.4198 18.0248 27.0372 8.9986 Constraint 97 455 14.1158 17.6448 26.4672 8.9984 Constraint 324 502 14.4380 18.0476 27.0713 8.9206 Constraint 470 673 13.6024 17.0030 25.5045 8.8732 Constraint 418 680 11.9607 14.9509 22.4263 8.8069 Constraint 197 350 13.9476 17.4345 26.1518 8.6208 Constraint 374 517 14.8703 18.5879 27.8819 8.6205 Constraint 274 673 13.1487 16.4358 24.6537 8.5809 Constraint 319 673 13.2014 16.5017 24.7526 8.5809 Constraint 418 673 12.1445 15.1807 22.7710 8.5805 Constraint 295 573 13.7290 17.1612 25.7418 8.4216 Constraint 340 540 14.6739 18.3423 27.5135 8.1218 Constraint 280 483 14.0799 17.5999 26.3998 8.1215 Constraint 306 418 14.6881 18.3601 27.5401 8.1205 Constraint 54 517 14.9443 18.6804 28.0206 8.0000 Constraint 117 189 14.7679 18.4599 27.6898 8.0000 Constraint 3 340 13.4802 16.8502 25.2753 8.0000 Constraint 3 402 14.2859 17.8573 26.7860 7.9999 Constraint 3 369 12.2115 15.2644 22.8966 7.9999 Constraint 3 255 13.3428 16.6785 25.0177 7.9999 Constraint 197 673 12.9464 16.1830 24.2745 7.9999 Constraint 223 680 12.4411 15.5513 23.3270 7.9998 Constraint 117 634 14.5618 18.2023 27.3034 7.9998 Constraint 97 502 14.7720 18.4650 27.6976 7.9997 Constraint 25 691 11.5763 14.4703 21.7055 7.9991 Constraint 280 584 14.1066 17.6332 26.4498 7.9990 Constraint 183 680 14.1027 17.6284 26.4426 7.9987 Constraint 263 680 13.1760 16.4700 24.7051 7.9986 Constraint 110 446 14.1309 17.6636 26.4954 7.9986 Constraint 97 512 14.6641 18.3301 27.4952 7.9984 Constraint 97 173 14.3609 17.9511 26.9266 7.9983 Constraint 324 667 13.7189 17.1486 25.7230 7.9981 Constraint 157 667 14.0960 17.6200 26.4300 7.9979 Constraint 463 680 13.3010 16.6263 24.9395 7.8070 Constraint 340 680 14.0892 17.6114 26.4172 7.8059 Constraint 329 526 13.8250 17.2812 25.9219 7.7427 Constraint 197 280 13.7878 17.2348 25.8522 7.6208 Constraint 324 673 13.1054 16.3817 24.5726 7.5809 Constraint 295 584 14.1907 17.7384 26.6076 7.3207 Constraint 329 649 14.9728 18.7159 28.0739 7.1217 Constraint 183 673 14.4904 18.1130 27.1695 7.0000 Constraint 25 446 14.2750 17.8437 26.7656 7.0000 Constraint 189 680 13.6849 17.1062 25.6593 6.9999 Constraint 17 206 11.4286 14.2857 21.4286 6.9999 Constraint 17 446 14.5652 18.2065 27.3097 6.9999 Constraint 223 319 13.9700 17.4625 26.1938 6.9998 Constraint 130 223 13.8969 17.3712 26.0567 6.9998 Constraint 78 223 14.6654 18.3317 27.4976 6.9998 Constraint 54 223 12.2268 15.2835 22.9252 6.9998 Constraint 117 491 14.6802 18.3502 27.5253 6.9997 Constraint 17 691 11.7459 14.6824 22.0236 6.9991 Constraint 43 691 11.9175 14.8969 22.3453 6.9991 Constraint 212 680 13.7177 17.1471 25.7207 6.9991 Constraint 274 680 14.8351 18.5439 27.8158 6.9987 Constraint 86 369 14.1448 17.6810 26.5215 6.9984 Constraint 533 660 14.9918 18.7397 28.1096 6.9961 Constraint 427 667 13.6205 17.0256 25.5384 6.8689 Constraint 512 649 14.0666 17.5832 26.3749 6.8688 Constraint 234 593 14.2091 17.7614 26.6421 6.8688 Constraint 340 673 12.2436 15.3045 22.9568 6.5809 Constraint 324 410 14.5682 18.2103 27.3154 6.2997 Constraint 324 434 12.8779 16.0974 24.1461 6.2984 Constraint 263 455 14.7260 18.4076 27.6113 6.2984 Constraint 312 517 14.2679 17.8349 26.7524 6.1218 Constraint 502 584 14.2514 17.8142 26.7213 6.0000 Constraint 243 329 15.0268 18.7835 28.1753 6.0000 Constraint 212 559 13.5178 16.8972 25.3458 6.0000 Constraint 146 673 13.9374 17.4218 26.1326 6.0000 Constraint 25 434 14.0197 17.5247 26.2870 6.0000 Constraint 36 197 14.6633 18.3291 27.4936 6.0000 Constraint 3 626 13.6737 17.0921 25.6381 6.0000 Constraint 212 434 14.3599 17.9498 26.9248 6.0000 Constraint 3 243 12.8270 16.0337 24.0506 5.9999 Constraint 263 568 14.9353 18.6691 28.0036 5.9999 Constraint 17 526 13.4976 16.8720 25.3080 5.9999 Constraint 9 667 10.0524 12.5655 18.8483 5.9999 Constraint 54 673 13.0668 16.3335 24.5002 5.9999 Constraint 117 642 14.1761 17.7201 26.5802 5.9999 Constraint 223 573 14.0637 17.5796 26.3694 5.9998 Constraint 470 680 11.3620 14.2025 21.3038 5.9998 Constraint 17 319 13.3547 16.6934 25.0401 5.9998 Constraint 68 660 13.6487 17.0608 25.5913 5.9998 Constraint 329 660 14.1709 17.7136 26.5704 5.9997 Constraint 391 691 10.5425 13.1781 19.7671 5.9991 Constraint 243 691 12.2169 15.2711 22.9067 5.9991 Constraint 173 680 13.4720 16.8400 25.2600 5.9987 Constraint 165 680 14.4787 18.0984 27.1476 5.9987 Constraint 110 402 14.4985 18.1231 27.1846 5.9987 Constraint 36 329 14.0716 17.5895 26.3843 5.9987 Constraint 374 455 14.8775 18.5968 27.8952 5.9986 Constraint 287 446 14.4837 18.1047 27.1570 5.9984 Constraint 263 446 13.3812 16.7265 25.0897 5.9984 Constraint 157 455 13.7992 17.2490 25.8735 5.9984 Constraint 446 660 14.4836 18.1045 27.1568 5.9980 Constraint 206 280 13.8949 17.3686 26.0529 5.8735 Constraint 615 680 13.0573 16.3217 24.4825 5.8070 Constraint 427 680 14.0268 17.5335 26.3003 5.8070 Constraint 455 673 14.3948 17.9935 26.9903 5.5808 Constraint 463 673 12.5677 15.7096 23.5644 5.5806 Constraint 350 512 14.3740 17.9675 26.9513 5.4218 Constraint 329 533 14.5679 18.2099 27.3149 5.4218 Constraint 312 512 14.8947 18.6184 27.9276 5.4218 Constraint 295 593 12.8267 16.0333 24.0500 5.4216 Constraint 295 427 13.5240 16.9050 25.3575 5.4216 Constraint 295 391 14.2643 17.8303 26.7455 5.4216 Constraint 340 517 13.8458 17.3072 25.9608 5.1218 Constraint 329 545 14.2204 17.7754 26.6632 5.1218 Constraint 234 329 15.1184 18.8981 28.3471 5.1218 Constraint 329 418 14.5174 18.1468 27.2201 5.1216 Constraint 512 593 15.0071 18.7588 28.1382 5.1216 Constraint 455 680 12.2250 15.2813 22.9220 5.0999 Constraint 212 610 14.7844 18.4805 27.7208 5.0000 Constraint 212 568 14.6539 18.3174 27.4762 5.0000 Constraint 54 189 13.1980 16.4975 24.7463 5.0000 Constraint 206 434 14.0759 17.5949 26.3923 5.0000 Constraint 17 197 12.9103 16.1379 24.2068 4.9999 Constraint 9 455 13.6183 17.0229 25.5343 4.9999 Constraint 545 660 14.9607 18.7009 28.0514 4.9999 Constraint 54 680 12.3458 15.4323 23.1484 4.9998 Constraint 212 673 13.0226 16.2783 24.4175 4.8736 Constraint 319 680 13.7322 17.1652 25.7478 4.8069 Constraint 626 691 13.4486 16.8107 25.2161 4.7064 Constraint 402 691 11.8289 14.7861 22.1792 4.7064 Constraint 255 691 13.0012 16.2515 24.3773 4.7064 Constraint 234 691 13.7859 17.2323 25.8485 4.7064 Constraint 329 673 13.2826 16.6032 24.9049 4.5809 Constraint 526 673 13.8061 17.2577 25.8865 4.5806 Constraint 350 491 15.1027 18.8784 28.3176 4.2999 Constraint 329 667 14.7804 18.4755 27.7132 4.1219 Constraint 295 615 14.4912 18.1140 27.1711 4.0996 Constraint 9 463 14.1314 17.6643 26.4964 4.0000 Constraint 3 667 9.4058 11.7572 17.6358 4.0000 Constraint 25 183 14.5635 18.2044 27.3066 4.0000 Constraint 189 691 13.1159 16.3949 24.5923 4.0000 Constraint 110 517 14.3593 17.9491 26.9237 4.0000 Constraint 43 206 13.0688 16.3359 24.5039 4.0000 Constraint 3 418 14.6324 18.2905 27.4357 4.0000 Constraint 3 263 14.6758 18.3448 27.5171 3.9999 Constraint 280 568 14.7115 18.3894 27.5840 3.9999 Constraint 68 540 15.0242 18.7803 28.1705 3.9999 Constraint 68 470 14.5286 18.1607 27.2411 3.9999 Constraint 68 374 14.1507 17.6884 26.5326 3.9999 Constraint 62 517 14.4880 18.1100 27.1649 3.9999 Constraint 9 223 13.4517 16.8146 25.2219 3.9999 Constraint 9 206 11.5129 14.3911 21.5867 3.9999 Constraint 197 573 14.8078 18.5097 27.7646 3.9999 Constraint 36 324 14.8427 18.5533 27.8300 3.9999 Constraint 512 615 14.2241 17.7801 26.6702 3.9999 Constraint 17 146 12.8889 16.1111 24.1666 3.9998 Constraint 97 183 13.3970 16.7462 25.1193 3.9997 Constraint 86 410 14.0923 17.6154 26.4230 3.9997 Constraint 86 391 14.0903 17.6129 26.4194 3.9997 Constraint 86 263 14.2715 17.8394 26.7591 3.9997 Constraint 410 691 11.1903 13.9879 20.9819 3.9991 Constraint 36 691 9.6018 12.0023 18.0034 3.9991 Constraint 206 319 14.2221 17.7776 26.6664 3.8735 Constraint 434 667 14.4172 18.0215 27.0323 3.8691 Constraint 197 319 14.4652 18.0815 27.1223 3.7472 Constraint 189 324 14.4140 18.0176 27.0263 3.7472 Constraint 189 306 13.8319 17.2898 25.9347 3.7472 Constraint 189 295 14.9638 18.7047 28.0571 3.7472 Constraint 295 673 13.9857 17.4822 26.2232 3.7073 Constraint 340 502 13.7220 17.1525 25.7287 3.3000 Constraint 324 463 15.0207 18.7758 28.1637 3.2997 Constraint 295 601 13.0846 16.3557 24.5336 3.2997 Constraint 491 584 14.3516 17.9395 26.9093 3.0000 Constraint 383 584 14.2865 17.8581 26.7872 3.0000 Constraint 274 584 14.0297 17.5371 26.3056 3.0000 Constraint 263 584 13.9488 17.4360 26.1540 3.0000 Constraint 243 584 15.1293 18.9116 28.3675 3.0000 Constraint 212 615 14.6143 18.2679 27.4018 3.0000 Constraint 173 584 14.7275 18.4094 27.6141 3.0000 Constraint 36 584 14.9337 18.6671 28.0006 3.0000 Constraint 36 517 14.5348 18.1685 27.2527 3.0000 Constraint 25 197 14.2110 17.7638 26.6456 3.0000 Constraint 17 434 15.1894 18.9867 28.4801 3.0000 Constraint 3 673 12.6232 15.7790 23.6686 3.0000 Constraint 206 680 14.7008 18.3759 27.5639 3.0000 Constraint 212 691 12.0702 15.0877 22.6316 3.0000 Constraint 206 691 14.3924 17.9905 26.9858 3.0000 Constraint 68 483 14.6048 18.2560 27.3840 3.0000 Constraint 483 680 14.3139 17.8924 26.8386 3.0000 Constraint 483 601 14.9848 18.7310 28.0964 3.0000 Constraint 197 610 14.8735 18.5919 27.8878 3.0000 Constraint 25 610 14.6449 18.3061 27.4591 3.0000 Constraint 62 206 14.1243 17.6553 26.4830 3.0000 Constraint 54 206 13.9715 17.4644 26.1966 3.0000 Constraint 206 615 14.0718 17.5897 26.3846 3.0000 Constraint 206 610 13.9160 17.3951 26.0926 3.0000 Constraint 391 568 14.9450 18.6813 28.0219 2.9999 Constraint 383 568 14.6815 18.3518 27.5277 2.9999 Constraint 374 545 14.4207 18.0258 27.0387 2.9999 Constraint 358 573 15.0384 18.7980 28.1971 2.9999 Constraint 340 470 14.8979 18.6224 27.9336 2.9999 Constraint 25 324 14.8277 18.5347 27.8020 2.9999 Constraint 17 610 15.1986 18.9983 28.4974 2.9999 Constraint 17 551 14.8018 18.5023 27.7534 2.9999 Constraint 17 502 14.2526 17.8157 26.7236 2.9999 Constraint 17 491 14.7551 18.4438 27.6657 2.9999 Constraint 17 274 14.1873 17.7341 26.6011 2.9999 Constraint 17 157 14.8256 18.5320 27.7981 2.9999 Constraint 9 212 10.8670 13.5837 20.3756 2.9999 Constraint 9 189 11.7351 14.6688 22.0033 2.9999 Constraint 86 183 14.5059 18.1323 27.1985 2.9999 Constraint 86 173 14.1450 17.6812 26.5218 2.9999 Constraint 68 183 13.7177 17.1472 25.7207 2.9999 Constraint 68 173 14.7023 18.3778 27.5668 2.9999 Constraint 78 667 14.4194 18.0242 27.0363 2.9999 Constraint 68 667 14.5589 18.1986 27.2979 2.9999 Constraint 17 324 13.7997 17.2497 25.8745 2.9999 Constraint 9 680 13.9535 17.4418 26.1628 2.9999 Constraint 9 673 12.0656 15.0819 22.6229 2.9999 Constraint 25 263 15.0458 18.8073 28.2109 2.9998 Constraint 312 660 14.7198 18.3997 27.5995 2.9997 Constraint 165 673 14.8402 18.5503 27.8254 2.9997 Constraint 324 418 14.7751 18.4689 27.7033 2.9997 Constraint 295 434 13.5622 16.9527 25.4291 2.9997 Constraint 287 418 14.9791 18.7239 28.0858 2.9997 Constraint 287 410 14.6285 18.2856 27.4284 2.9997 Constraint 374 512 14.9738 18.7173 28.0760 2.9987 Constraint 374 446 14.5364 18.1705 27.2558 2.9987 Constraint 358 455 14.4731 18.0914 27.1371 2.9987 Constraint 358 446 13.7662 17.2077 25.8115 2.9987 Constraint 306 446 13.7105 17.1381 25.7071 2.9987 Constraint 280 446 13.2917 16.6146 24.9219 2.9987 Constraint 274 568 14.6629 18.3286 27.4930 2.9987 Constraint 274 446 13.0867 16.3584 24.5376 2.9987 Constraint 274 434 14.0413 17.5517 26.3275 2.9987 Constraint 274 418 15.0334 18.7918 28.1877 2.9987 Constraint 146 680 14.6188 18.2736 27.4103 2.9987 Constraint 110 369 14.5063 18.1329 27.1993 2.9987 Constraint 110 358 14.5578 18.1973 27.2959 2.9987 Constraint 110 263 13.5670 16.9588 25.4382 2.9987 Constraint 36 312 14.1322 17.6652 26.4979 2.9987 Constraint 25 329 14.2548 17.8185 26.7278 2.9987 Constraint 25 312 14.9769 18.7211 28.0816 2.9987 Constraint 295 667 14.1044 17.6305 26.4458 2.9981 Constraint 287 667 14.6933 18.3667 27.5500 2.9981 Constraint 526 691 14.0008 17.5010 26.2515 2.7073 Constraint 526 680 14.0230 17.5288 26.2931 2.7073 Constraint 463 691 13.0728 16.3410 24.5116 2.7073 Constraint 418 691 12.9761 16.2202 24.3303 2.7073 Constraint 350 691 12.0001 15.0001 22.5001 2.7064 Constraint 340 691 11.8857 14.8571 22.2856 2.7064 Constraint 280 691 13.8425 17.3032 25.9547 2.7064 Constraint 369 512 14.9716 18.7145 28.0718 2.6209 Constraint 427 673 11.6529 14.5661 21.8491 2.5809 Constraint 306 512 14.0716 17.5895 26.3842 2.4219 Constraint 295 545 14.5482 18.1853 27.2779 2.4219 Constraint 295 540 14.3198 17.8998 26.8497 2.4219 Constraint 295 526 11.5768 14.4710 21.7065 2.4219 Constraint 295 512 13.8738 17.3423 26.0134 2.4219 Constraint 295 463 14.9022 18.6278 27.9417 2.4219 Constraint 410 593 14.9734 18.7168 28.0752 2.3219 Constraint 287 634 13.9333 17.4167 26.1250 2.1998 Constraint 358 483 13.4582 16.8227 25.2340 2.1219 Constraint 340 512 14.9953 18.7441 28.1162 2.1219 Constraint 340 483 12.8800 16.1000 24.1500 2.1219 Constraint 340 455 14.5863 18.2329 27.3493 2.1219 Constraint 329 463 15.1538 18.9422 28.4133 2.1219 Constraint 312 483 13.8243 17.2804 25.9206 2.1219 Constraint 306 517 14.6554 18.3193 27.4789 2.1219 Constraint 306 483 12.9970 16.2463 24.3694 2.1219 Constraint 295 483 12.5111 15.6389 23.4584 2.1219 Constraint 287 483 13.9708 17.4634 26.1952 2.1219 Constraint 306 667 14.5902 18.2377 27.3566 2.0000 Constraint 212 573 13.8681 17.3351 26.0027 2.0000 Constraint 197 691 13.9437 17.4296 26.1444 2.0000 Constraint 130 212 14.6209 18.2761 27.4142 2.0000 Constraint 97 243 15.1965 18.9957 28.4935 2.0000 Constraint 9 446 14.7323 18.4153 27.6230 2.0000 Constraint 9 434 15.1266 18.9082 28.3623 2.0000 Constraint 9 427 14.1690 17.7113 26.5669 2.0000 Constraint 3 680 13.9701 17.4626 26.1939 2.0000 Constraint 197 680 14.5538 18.1922 27.2883 2.0000 Constraint 483 691 14.1407 17.6759 26.5138 2.0000 Constraint 470 691 8.6995 10.8744 16.3116 2.0000 Constraint 455 691 11.9791 14.9739 22.4608 2.0000 Constraint 446 680 14.7039 18.3799 27.5699 2.0000 Constraint 223 691 9.9695 12.4619 18.6928 2.0000 Constraint 183 691 13.7615 17.2018 25.8027 2.0000 Constraint 173 691 15.1577 18.9471 28.4206 2.0000 Constraint 3 324 13.5547 16.9434 25.4151 2.0000 Constraint 3 319 13.3125 16.6407 24.9610 2.0000 Constraint 3 280 12.2100 15.2625 22.8938 2.0000 Constraint 3 274 14.7037 18.3796 27.5694 2.0000 Constraint 3 146 14.4154 18.0192 27.0289 2.0000 Constraint 206 573 13.3590 16.6988 25.0482 2.0000 Constraint 130 206 13.8223 17.2779 25.9168 2.0000 Constraint 3 470 13.5108 16.8885 25.3328 1.9999 Constraint 3 234 14.0045 17.5056 26.2585 1.9999 Constraint 3 223 13.1761 16.4701 24.7052 1.9999 Constraint 3 212 10.1972 12.7465 19.1198 1.9999 Constraint 3 206 9.3364 11.6705 17.5057 1.9999 Constraint 3 197 13.6254 17.0318 25.5477 1.9999 Constraint 3 189 10.7184 13.3980 20.0970 1.9999 Constraint 3 183 15.1556 18.9445 28.4167 1.9999 Constraint 3 173 13.6045 17.0056 25.5085 1.9999 Constraint 183 601 14.9741 18.7176 28.0764 1.9999 Constraint 183 340 12.2637 15.3296 22.9944 1.9999 Constraint 183 329 14.0564 17.5706 26.3558 1.9999 Constraint 183 324 11.7994 14.7492 22.1238 1.9999 Constraint 183 312 11.5731 14.4664 21.6996 1.9999 Constraint 183 295 13.6193 17.0241 25.5362 1.9999 Constraint 173 615 12.8530 16.0662 24.0993 1.9999 Constraint 173 329 13.0443 16.3054 24.4581 1.9999 Constraint 54 183 13.4440 16.8050 25.2075 1.9999 Constraint 86 649 13.2674 16.5843 24.8764 1.9999 Constraint 526 667 13.7551 17.1939 25.7909 1.9998 Constraint 502 667 14.5775 18.2219 27.3329 1.9998 Constraint 483 667 13.6934 17.1167 25.6751 1.9998 Constraint 263 691 14.6688 18.3360 27.5040 1.9991 Constraint 62 691 12.5449 15.6812 23.5217 1.9991 Constraint 54 691 12.6868 15.8586 23.7878 1.9991 Constraint 502 593 15.1356 18.9195 28.3793 1.7473 Constraint 446 667 14.7528 18.4411 27.6616 1.7473 Constraint 197 287 14.6619 18.3273 27.4910 1.7473 Constraint 274 691 14.8463 18.5578 27.8367 1.7073 Constraint 610 673 8.8369 11.0461 16.5691 1.5809 Constraint 601 673 10.4867 13.1084 19.6626 1.5809 Constraint 551 673 11.1004 13.8755 20.8133 1.5809 Constraint 446 673 13.3635 16.7043 25.0565 1.5809 Constraint 434 673 10.8298 13.5373 20.3059 1.5809 Constraint 312 673 9.1095 11.3869 17.0804 1.5809 Constraint 306 673 10.9194 13.6492 20.4738 1.5809 Constraint 287 673 14.0985 17.6231 26.4346 1.5809 Constraint 319 491 14.2583 17.8229 26.7343 1.3000 Constraint 329 568 13.5262 16.9078 25.3617 1.0000 Constraint 324 568 14.2772 17.8465 26.7698 1.0000 Constraint 223 340 14.2449 17.8062 26.7093 1.0000 Constraint 212 319 14.8170 18.5213 27.7819 1.0000 Constraint 110 512 10.8001 13.5001 20.2501 1.0000 Constraint 110 502 12.9547 16.1934 24.2900 1.0000 Constraint 110 491 13.9796 17.4745 26.2118 1.0000 Constraint 110 463 15.1649 18.9562 28.4343 1.0000 Constraint 86 517 14.6576 18.3221 27.4831 1.0000 Constraint 86 502 14.7703 18.4629 27.6943 1.0000 Constraint 86 483 14.7111 18.3889 27.5833 1.0000 Constraint 86 455 14.9521 18.6902 28.0353 1.0000 Constraint 86 374 14.0206 17.5257 26.2886 1.0000 Constraint 86 243 13.0034 16.2543 24.3814 1.0000 Constraint 86 234 12.2043 15.2554 22.8831 1.0000 Constraint 68 517 14.9850 18.7312 28.0968 1.0000 Constraint 68 274 13.2803 16.6003 24.9005 1.0000 Constraint 68 263 12.9499 16.1874 24.2810 1.0000 Constraint 68 223 15.1063 18.8828 28.3242 1.0000 Constraint 62 212 13.0269 16.2836 24.4254 1.0000 Constraint 54 212 11.7560 14.6950 22.0425 1.0000 Constraint 3 329 14.7044 18.3805 27.5707 1.0000 Constraint 3 78 14.8013 18.5017 27.7525 1.0000 Constraint 54 287 15.1644 18.9555 28.4332 1.0000 Constraint 206 287 14.6040 18.2550 27.3825 1.0000 Constraint 78 206 13.5837 16.9797 25.4695 1.0000 Constraint 491 615 14.6060 18.2575 27.3863 0.9999 Constraint 274 615 13.0820 16.3525 24.5288 0.9999 Constraint 263 615 13.4028 16.7535 25.1303 0.9999 Constraint 197 615 14.3882 17.9853 26.9779 0.9999 Constraint 189 340 14.9546 18.6933 28.0399 0.9999 Constraint 189 312 14.5332 18.1666 27.2498 0.9999 Constraint 183 593 14.7717 18.4646 27.6969 0.9999 Constraint 183 584 14.4528 18.0660 27.0990 0.9999 Constraint 54 157 15.1354 18.9192 28.3788 0.9999 Constraint 559 649 15.1467 18.9333 28.4000 0.9999 Constraint 434 660 12.3723 15.4654 23.1980 0.9999 Constraint 295 634 14.9221 18.6526 27.9789 0.9999 Constraint 110 642 14.6715 18.3393 27.5090 0.9999 Constraint 110 634 14.7295 18.4119 27.6178 0.9999 Constraint 17 329 13.7680 17.2099 25.8149 0.9999 Constraint 17 312 14.4006 18.0008 27.0012 0.9999 Constraint 17 130 14.0939 17.6174 26.4261 0.9999 Constraint 9 329 15.0236 18.7795 28.1693 0.9999 Constraint 502 673 14.2327 17.7909 26.6864 0.8736 Constraint 610 680 7.5780 9.4725 14.2087 0.8073 Constraint 601 680 5.6436 7.0545 10.5818 0.8073 Constraint 434 680 11.1619 13.9523 20.9285 0.8073 Constraint 329 680 7.1578 8.9472 13.4208 0.8073 Constraint 324 680 10.7257 13.4071 20.1107 0.8073 Constraint 312 680 6.3664 7.9580 11.9369 0.8073 Constraint 615 691 10.0164 12.5205 18.7808 0.7073 Constraint 610 691 6.3427 7.9284 11.8926 0.7073 Constraint 601 691 6.5187 8.1484 12.2226 0.7073 Constraint 593 691 3.3943 4.2428 6.3642 0.7073 Constraint 593 680 5.4826 6.8533 10.2799 0.7073 Constraint 593 673 5.3121 6.6402 9.9602 0.7073 Constraint 584 691 4.2720 5.3400 8.0099 0.7073 Constraint 584 680 5.0225 6.2782 9.4173 0.7073 Constraint 584 673 7.9807 9.9758 14.9637 0.7073 Constraint 573 691 5.1863 6.4829 9.7243 0.7073 Constraint 573 680 8.7851 10.9814 16.4720 0.7073 Constraint 573 673 7.3944 9.2430 13.8645 0.7073 Constraint 568 691 9.0680 11.3350 17.0024 0.7073 Constraint 568 680 13.1444 16.4305 24.6457 0.7073 Constraint 568 673 11.2775 14.0968 21.1453 0.7073 Constraint 559 691 7.9900 9.9875 14.9813 0.7073 Constraint 559 680 12.1561 15.1952 22.7928 0.7073 Constraint 559 673 9.7951 12.2439 18.3659 0.7073 Constraint 551 691 7.2110 9.0137 13.5206 0.7073 Constraint 551 680 10.0691 12.5863 18.8795 0.7073 Constraint 545 691 9.9878 12.4848 18.7272 0.7073 Constraint 545 680 12.7766 15.9708 23.9561 0.7073 Constraint 545 673 9.4052 11.7565 17.6347 0.7073 Constraint 540 691 11.8032 14.7541 22.1311 0.7073 Constraint 540 673 12.2435 15.3043 22.9565 0.7073 Constraint 533 691 11.4628 14.3285 21.4927 0.7073 Constraint 533 680 14.7752 18.4690 27.7035 0.7073 Constraint 533 673 11.3388 14.1735 21.2603 0.7073 Constraint 517 691 14.2113 17.7641 26.6462 0.7073 Constraint 517 673 12.6630 15.8287 23.7430 0.7073 Constraint 512 691 14.8566 18.5707 27.8561 0.7073 Constraint 512 673 14.2863 17.8579 26.7869 0.7073 Constraint 483 673 13.4506 16.8133 25.2199 0.7073 Constraint 446 691 14.7127 18.3908 27.5862 0.7073 Constraint 434 691 10.8703 13.5878 20.3818 0.7073 Constraint 427 691 10.5041 13.1302 19.6952 0.7073 Constraint 329 691 8.5389 10.6736 16.0104 0.7073 Constraint 324 691 11.6705 14.5881 21.8822 0.7073 Constraint 319 691 9.7935 12.2418 18.3627 0.7073 Constraint 312 691 5.6004 7.0005 10.5007 0.7073 Constraint 306 691 7.3457 9.1821 13.7731 0.7073 Constraint 306 680 8.6749 10.8436 16.2654 0.7073 Constraint 295 691 10.9191 13.6489 20.4734 0.7073 Constraint 295 680 12.2567 15.3209 22.9813 0.7073 Constraint 287 691 14.8021 18.5027 27.7540 0.7073 Constraint 295 502 11.2840 14.1050 21.1575 0.3000 Constraint 280 491 12.1946 15.2433 22.8650 0.3000 Constraint 280 470 13.6517 17.0646 25.5969 0.3000 Constraint 280 455 14.6110 18.2638 27.3957 0.3000 Constraint 274 470 15.0476 18.8095 28.2142 0.3000 Constraint 287 680 15.1019 18.8774 28.3161 0.1000 Constraint 680 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 691 0.8000 1.0000 1.5000 0.0000 Constraint 673 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 691 0.8000 1.0000 1.5000 0.0000 Constraint 667 680 0.8000 1.0000 1.5000 0.0000 Constraint 667 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 691 0.8000 1.0000 1.5000 0.0000 Constraint 660 680 0.8000 1.0000 1.5000 0.0000 Constraint 660 673 0.8000 1.0000 1.5000 0.0000 Constraint 660 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 691 0.8000 1.0000 1.5000 0.0000 Constraint 649 680 0.8000 1.0000 1.5000 0.0000 Constraint 649 673 0.8000 1.0000 1.5000 0.0000 Constraint 649 667 0.8000 1.0000 1.5000 0.0000 Constraint 649 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 691 0.8000 1.0000 1.5000 0.0000 Constraint 642 680 0.8000 1.0000 1.5000 0.0000 Constraint 642 673 0.8000 1.0000 1.5000 0.0000 Constraint 642 667 0.8000 1.0000 1.5000 0.0000 Constraint 642 660 0.8000 1.0000 1.5000 0.0000 Constraint 642 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 691 0.8000 1.0000 1.5000 0.0000 Constraint 634 680 0.8000 1.0000 1.5000 0.0000 Constraint 634 673 0.8000 1.0000 1.5000 0.0000 Constraint 634 667 0.8000 1.0000 1.5000 0.0000 Constraint 634 660 0.8000 1.0000 1.5000 0.0000 Constraint 634 649 0.8000 1.0000 1.5000 0.0000 Constraint 634 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 680 0.8000 1.0000 1.5000 0.0000 Constraint 626 673 0.8000 1.0000 1.5000 0.0000 Constraint 626 667 0.8000 1.0000 1.5000 0.0000 Constraint 626 660 0.8000 1.0000 1.5000 0.0000 Constraint 626 649 0.8000 1.0000 1.5000 0.0000 Constraint 626 642 0.8000 1.0000 1.5000 0.0000 Constraint 626 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 673 0.8000 1.0000 1.5000 0.0000 Constraint 615 667 0.8000 1.0000 1.5000 0.0000 Constraint 615 660 0.8000 1.0000 1.5000 0.0000 Constraint 615 649 0.8000 1.0000 1.5000 0.0000 Constraint 615 642 0.8000 1.0000 1.5000 0.0000 Constraint 615 634 0.8000 1.0000 1.5000 0.0000 Constraint 615 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 667 0.8000 1.0000 1.5000 0.0000 Constraint 610 660 0.8000 1.0000 1.5000 0.0000 Constraint 610 649 0.8000 1.0000 1.5000 0.0000 Constraint 610 642 0.8000 1.0000 1.5000 0.0000 Constraint 610 634 0.8000 1.0000 1.5000 0.0000 Constraint 610 626 0.8000 1.0000 1.5000 0.0000 Constraint 610 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 667 0.8000 1.0000 1.5000 0.0000 Constraint 601 660 0.8000 1.0000 1.5000 0.0000 Constraint 601 649 0.8000 1.0000 1.5000 0.0000 Constraint 601 642 0.8000 1.0000 1.5000 0.0000 Constraint 601 634 0.8000 1.0000 1.5000 0.0000 Constraint 601 626 0.8000 1.0000 1.5000 0.0000 Constraint 601 615 0.8000 1.0000 1.5000 0.0000 Constraint 601 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 667 0.8000 1.0000 1.5000 0.0000 Constraint 593 660 0.8000 1.0000 1.5000 0.0000 Constraint 593 649 0.8000 1.0000 1.5000 0.0000 Constraint 593 642 0.8000 1.0000 1.5000 0.0000 Constraint 593 634 0.8000 1.0000 1.5000 0.0000 Constraint 593 626 0.8000 1.0000 1.5000 0.0000 Constraint 593 615 0.8000 1.0000 1.5000 0.0000 Constraint 593 610 0.8000 1.0000 1.5000 0.0000 Constraint 593 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 667 0.8000 1.0000 1.5000 0.0000 Constraint 584 660 0.8000 1.0000 1.5000 0.0000 Constraint 584 649 0.8000 1.0000 1.5000 0.0000 Constraint 584 642 0.8000 1.0000 1.5000 0.0000 Constraint 584 634 0.8000 1.0000 1.5000 0.0000 Constraint 584 626 0.8000 1.0000 1.5000 0.0000 Constraint 584 615 0.8000 1.0000 1.5000 0.0000 Constraint 584 610 0.8000 1.0000 1.5000 0.0000 Constraint 584 601 0.8000 1.0000 1.5000 0.0000 Constraint 584 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 667 0.8000 1.0000 1.5000 0.0000 Constraint 573 660 0.8000 1.0000 1.5000 0.0000 Constraint 573 642 0.8000 1.0000 1.5000 0.0000 Constraint 573 634 0.8000 1.0000 1.5000 0.0000 Constraint 573 626 0.8000 1.0000 1.5000 0.0000 Constraint 573 615 0.8000 1.0000 1.5000 0.0000 Constraint 573 610 0.8000 1.0000 1.5000 0.0000 Constraint 573 601 0.8000 1.0000 1.5000 0.0000 Constraint 573 593 0.8000 1.0000 1.5000 0.0000 Constraint 573 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 667 0.8000 1.0000 1.5000 0.0000 Constraint 568 660 0.8000 1.0000 1.5000 0.0000 Constraint 568 649 0.8000 1.0000 1.5000 0.0000 Constraint 568 634 0.8000 1.0000 1.5000 0.0000 Constraint 568 626 0.8000 1.0000 1.5000 0.0000 Constraint 568 615 0.8000 1.0000 1.5000 0.0000 Constraint 568 610 0.8000 1.0000 1.5000 0.0000 Constraint 568 601 0.8000 1.0000 1.5000 0.0000 Constraint 568 593 0.8000 1.0000 1.5000 0.0000 Constraint 568 584 0.8000 1.0000 1.5000 0.0000 Constraint 568 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 667 0.8000 1.0000 1.5000 0.0000 Constraint 559 660 0.8000 1.0000 1.5000 0.0000 Constraint 559 626 0.8000 1.0000 1.5000 0.0000 Constraint 559 615 0.8000 1.0000 1.5000 0.0000 Constraint 559 610 0.8000 1.0000 1.5000 0.0000 Constraint 559 601 0.8000 1.0000 1.5000 0.0000 Constraint 559 593 0.8000 1.0000 1.5000 0.0000 Constraint 559 584 0.8000 1.0000 1.5000 0.0000 Constraint 559 573 0.8000 1.0000 1.5000 0.0000 Constraint 559 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 667 0.8000 1.0000 1.5000 0.0000 Constraint 551 615 0.8000 1.0000 1.5000 0.0000 Constraint 551 610 0.8000 1.0000 1.5000 0.0000 Constraint 551 601 0.8000 1.0000 1.5000 0.0000 Constraint 551 593 0.8000 1.0000 1.5000 0.0000 Constraint 551 584 0.8000 1.0000 1.5000 0.0000 Constraint 551 573 0.8000 1.0000 1.5000 0.0000 Constraint 551 568 0.8000 1.0000 1.5000 0.0000 Constraint 551 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 667 0.8000 1.0000 1.5000 0.0000 Constraint 545 610 0.8000 1.0000 1.5000 0.0000 Constraint 545 601 0.8000 1.0000 1.5000 0.0000 Constraint 545 593 0.8000 1.0000 1.5000 0.0000 Constraint 545 584 0.8000 1.0000 1.5000 0.0000 Constraint 545 573 0.8000 1.0000 1.5000 0.0000 Constraint 545 568 0.8000 1.0000 1.5000 0.0000 Constraint 545 559 0.8000 1.0000 1.5000 0.0000 Constraint 545 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 680 0.8000 1.0000 1.5000 0.0000 Constraint 540 667 0.8000 1.0000 1.5000 0.0000 Constraint 540 660 0.8000 1.0000 1.5000 0.0000 Constraint 540 649 0.8000 1.0000 1.5000 0.0000 Constraint 540 601 0.8000 1.0000 1.5000 0.0000 Constraint 540 593 0.8000 1.0000 1.5000 0.0000 Constraint 540 584 0.8000 1.0000 1.5000 0.0000 Constraint 540 573 0.8000 1.0000 1.5000 0.0000 Constraint 540 568 0.8000 1.0000 1.5000 0.0000 Constraint 540 559 0.8000 1.0000 1.5000 0.0000 Constraint 540 551 0.8000 1.0000 1.5000 0.0000 Constraint 540 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 667 0.8000 1.0000 1.5000 0.0000 Constraint 533 593 0.8000 1.0000 1.5000 0.0000 Constraint 533 584 0.8000 1.0000 1.5000 0.0000 Constraint 533 573 0.8000 1.0000 1.5000 0.0000 Constraint 533 568 0.8000 1.0000 1.5000 0.0000 Constraint 533 559 0.8000 1.0000 1.5000 0.0000 Constraint 533 551 0.8000 1.0000 1.5000 0.0000 Constraint 533 545 0.8000 1.0000 1.5000 0.0000 Constraint 533 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 584 0.8000 1.0000 1.5000 0.0000 Constraint 526 573 0.8000 1.0000 1.5000 0.0000 Constraint 526 568 0.8000 1.0000 1.5000 0.0000 Constraint 526 559 0.8000 1.0000 1.5000 0.0000 Constraint 526 551 0.8000 1.0000 1.5000 0.0000 Constraint 526 545 0.8000 1.0000 1.5000 0.0000 Constraint 526 540 0.8000 1.0000 1.5000 0.0000 Constraint 526 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 680 0.8000 1.0000 1.5000 0.0000 Constraint 517 667 0.8000 1.0000 1.5000 0.0000 Constraint 517 660 0.8000 1.0000 1.5000 0.0000 Constraint 517 573 0.8000 1.0000 1.5000 0.0000 Constraint 517 568 0.8000 1.0000 1.5000 0.0000 Constraint 517 559 0.8000 1.0000 1.5000 0.0000 Constraint 517 551 0.8000 1.0000 1.5000 0.0000 Constraint 517 545 0.8000 1.0000 1.5000 0.0000 Constraint 517 540 0.8000 1.0000 1.5000 0.0000 Constraint 517 533 0.8000 1.0000 1.5000 0.0000 Constraint 517 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 680 0.8000 1.0000 1.5000 0.0000 Constraint 512 667 0.8000 1.0000 1.5000 0.0000 Constraint 512 660 0.8000 1.0000 1.5000 0.0000 Constraint 512 601 0.8000 1.0000 1.5000 0.0000 Constraint 512 568 0.8000 1.0000 1.5000 0.0000 Constraint 512 559 0.8000 1.0000 1.5000 0.0000 Constraint 512 551 0.8000 1.0000 1.5000 0.0000 Constraint 512 545 0.8000 1.0000 1.5000 0.0000 Constraint 512 540 0.8000 1.0000 1.5000 0.0000 Constraint 512 533 0.8000 1.0000 1.5000 0.0000 Constraint 512 526 0.8000 1.0000 1.5000 0.0000 Constraint 512 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 691 0.8000 1.0000 1.5000 0.0000 Constraint 502 680 0.8000 1.0000 1.5000 0.0000 Constraint 502 601 0.8000 1.0000 1.5000 0.0000 Constraint 502 559 0.8000 1.0000 1.5000 0.0000 Constraint 502 551 0.8000 1.0000 1.5000 0.0000 Constraint 502 545 0.8000 1.0000 1.5000 0.0000 Constraint 502 540 0.8000 1.0000 1.5000 0.0000 Constraint 502 533 0.8000 1.0000 1.5000 0.0000 Constraint 502 526 0.8000 1.0000 1.5000 0.0000 Constraint 502 517 0.8000 1.0000 1.5000 0.0000 Constraint 502 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 691 0.8000 1.0000 1.5000 0.0000 Constraint 491 680 0.8000 1.0000 1.5000 0.0000 Constraint 491 673 0.8000 1.0000 1.5000 0.0000 Constraint 491 667 0.8000 1.0000 1.5000 0.0000 Constraint 491 601 0.8000 1.0000 1.5000 0.0000 Constraint 491 593 0.8000 1.0000 1.5000 0.0000 Constraint 491 551 0.8000 1.0000 1.5000 0.0000 Constraint 491 545 0.8000 1.0000 1.5000 0.0000 Constraint 491 540 0.8000 1.0000 1.5000 0.0000 Constraint 491 533 0.8000 1.0000 1.5000 0.0000 Constraint 491 526 0.8000 1.0000 1.5000 0.0000 Constraint 491 517 0.8000 1.0000 1.5000 0.0000 Constraint 491 512 0.8000 1.0000 1.5000 0.0000 Constraint 491 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 593 0.8000 1.0000 1.5000 0.0000 Constraint 483 545 0.8000 1.0000 1.5000 0.0000 Constraint 483 540 0.8000 1.0000 1.5000 0.0000 Constraint 483 533 0.8000 1.0000 1.5000 0.0000 Constraint 483 526 0.8000 1.0000 1.5000 0.0000 Constraint 483 517 0.8000 1.0000 1.5000 0.0000 Constraint 483 512 0.8000 1.0000 1.5000 0.0000 Constraint 483 502 0.8000 1.0000 1.5000 0.0000 Constraint 483 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 601 0.8000 1.0000 1.5000 0.0000 Constraint 470 593 0.8000 1.0000 1.5000 0.0000 Constraint 470 584 0.8000 1.0000 1.5000 0.0000 Constraint 470 533 0.8000 1.0000 1.5000 0.0000 Constraint 470 526 0.8000 1.0000 1.5000 0.0000 Constraint 470 517 0.8000 1.0000 1.5000 0.0000 Constraint 470 512 0.8000 1.0000 1.5000 0.0000 Constraint 470 502 0.8000 1.0000 1.5000 0.0000 Constraint 470 491 0.8000 1.0000 1.5000 0.0000 Constraint 470 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 526 0.8000 1.0000 1.5000 0.0000 Constraint 463 517 0.8000 1.0000 1.5000 0.0000 Constraint 463 512 0.8000 1.0000 1.5000 0.0000 Constraint 463 502 0.8000 1.0000 1.5000 0.0000 Constraint 463 491 0.8000 1.0000 1.5000 0.0000 Constraint 463 483 0.8000 1.0000 1.5000 0.0000 Constraint 463 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 517 0.8000 1.0000 1.5000 0.0000 Constraint 455 512 0.8000 1.0000 1.5000 0.0000 Constraint 455 502 0.8000 1.0000 1.5000 0.0000 Constraint 455 491 0.8000 1.0000 1.5000 0.0000 Constraint 455 483 0.8000 1.0000 1.5000 0.0000 Constraint 455 470 0.8000 1.0000 1.5000 0.0000 Constraint 455 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 512 0.8000 1.0000 1.5000 0.0000 Constraint 446 502 0.8000 1.0000 1.5000 0.0000 Constraint 446 491 0.8000 1.0000 1.5000 0.0000 Constraint 446 483 0.8000 1.0000 1.5000 0.0000 Constraint 446 470 0.8000 1.0000 1.5000 0.0000 Constraint 446 463 0.8000 1.0000 1.5000 0.0000 Constraint 446 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 491 0.8000 1.0000 1.5000 0.0000 Constraint 434 483 0.8000 1.0000 1.5000 0.0000 Constraint 434 470 0.8000 1.0000 1.5000 0.0000 Constraint 434 463 0.8000 1.0000 1.5000 0.0000 Constraint 434 455 0.8000 1.0000 1.5000 0.0000 Constraint 434 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 483 0.8000 1.0000 1.5000 0.0000 Constraint 427 470 0.8000 1.0000 1.5000 0.0000 Constraint 427 463 0.8000 1.0000 1.5000 0.0000 Constraint 427 455 0.8000 1.0000 1.5000 0.0000 Constraint 427 446 0.8000 1.0000 1.5000 0.0000 Constraint 427 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 470 0.8000 1.0000 1.5000 0.0000 Constraint 418 463 0.8000 1.0000 1.5000 0.0000 Constraint 418 455 0.8000 1.0000 1.5000 0.0000 Constraint 418 446 0.8000 1.0000 1.5000 0.0000 Constraint 418 434 0.8000 1.0000 1.5000 0.0000 Constraint 418 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 470 0.8000 1.0000 1.5000 0.0000 Constraint 410 463 0.8000 1.0000 1.5000 0.0000 Constraint 410 455 0.8000 1.0000 1.5000 0.0000 Constraint 410 446 0.8000 1.0000 1.5000 0.0000 Constraint 410 434 0.8000 1.0000 1.5000 0.0000 Constraint 410 427 0.8000 1.0000 1.5000 0.0000 Constraint 410 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 463 0.8000 1.0000 1.5000 0.0000 Constraint 402 455 0.8000 1.0000 1.5000 0.0000 Constraint 402 446 0.8000 1.0000 1.5000 0.0000 Constraint 402 434 0.8000 1.0000 1.5000 0.0000 Constraint 402 427 0.8000 1.0000 1.5000 0.0000 Constraint 402 418 0.8000 1.0000 1.5000 0.0000 Constraint 402 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 601 0.8000 1.0000 1.5000 0.0000 Constraint 391 593 0.8000 1.0000 1.5000 0.0000 Constraint 391 584 0.8000 1.0000 1.5000 0.0000 Constraint 391 455 0.8000 1.0000 1.5000 0.0000 Constraint 391 446 0.8000 1.0000 1.5000 0.0000 Constraint 391 434 0.8000 1.0000 1.5000 0.0000 Constraint 391 427 0.8000 1.0000 1.5000 0.0000 Constraint 391 418 0.8000 1.0000 1.5000 0.0000 Constraint 391 410 0.8000 1.0000 1.5000 0.0000 Constraint 391 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 593 0.8000 1.0000 1.5000 0.0000 Constraint 383 446 0.8000 1.0000 1.5000 0.0000 Constraint 383 434 0.8000 1.0000 1.5000 0.0000 Constraint 383 427 0.8000 1.0000 1.5000 0.0000 Constraint 383 418 0.8000 1.0000 1.5000 0.0000 Constraint 383 410 0.8000 1.0000 1.5000 0.0000 Constraint 383 402 0.8000 1.0000 1.5000 0.0000 Constraint 383 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 615 0.8000 1.0000 1.5000 0.0000 Constraint 374 601 0.8000 1.0000 1.5000 0.0000 Constraint 374 593 0.8000 1.0000 1.5000 0.0000 Constraint 374 584 0.8000 1.0000 1.5000 0.0000 Constraint 374 573 0.8000 1.0000 1.5000 0.0000 Constraint 374 568 0.8000 1.0000 1.5000 0.0000 Constraint 374 559 0.8000 1.0000 1.5000 0.0000 Constraint 374 540 0.8000 1.0000 1.5000 0.0000 Constraint 374 434 0.8000 1.0000 1.5000 0.0000 Constraint 374 427 0.8000 1.0000 1.5000 0.0000 Constraint 374 418 0.8000 1.0000 1.5000 0.0000 Constraint 374 410 0.8000 1.0000 1.5000 0.0000 Constraint 374 402 0.8000 1.0000 1.5000 0.0000 Constraint 374 391 0.8000 1.0000 1.5000 0.0000 Constraint 374 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 601 0.8000 1.0000 1.5000 0.0000 Constraint 369 593 0.8000 1.0000 1.5000 0.0000 Constraint 369 584 0.8000 1.0000 1.5000 0.0000 Constraint 369 573 0.8000 1.0000 1.5000 0.0000 Constraint 369 568 0.8000 1.0000 1.5000 0.0000 Constraint 369 559 0.8000 1.0000 1.5000 0.0000 Constraint 369 545 0.8000 1.0000 1.5000 0.0000 Constraint 369 540 0.8000 1.0000 1.5000 0.0000 Constraint 369 517 0.8000 1.0000 1.5000 0.0000 Constraint 369 491 0.8000 1.0000 1.5000 0.0000 Constraint 369 455 0.8000 1.0000 1.5000 0.0000 Constraint 369 446 0.8000 1.0000 1.5000 0.0000 Constraint 369 434 0.8000 1.0000 1.5000 0.0000 Constraint 369 427 0.8000 1.0000 1.5000 0.0000 Constraint 369 418 0.8000 1.0000 1.5000 0.0000 Constraint 369 410 0.8000 1.0000 1.5000 0.0000 Constraint 369 402 0.8000 1.0000 1.5000 0.0000 Constraint 369 391 0.8000 1.0000 1.5000 0.0000 Constraint 369 383 0.8000 1.0000 1.5000 0.0000 Constraint 369 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 593 0.8000 1.0000 1.5000 0.0000 Constraint 358 584 0.8000 1.0000 1.5000 0.0000 Constraint 358 568 0.8000 1.0000 1.5000 0.0000 Constraint 358 559 0.8000 1.0000 1.5000 0.0000 Constraint 358 545 0.8000 1.0000 1.5000 0.0000 Constraint 358 540 0.8000 1.0000 1.5000 0.0000 Constraint 358 517 0.8000 1.0000 1.5000 0.0000 Constraint 358 512 0.8000 1.0000 1.5000 0.0000 Constraint 358 491 0.8000 1.0000 1.5000 0.0000 Constraint 358 427 0.8000 1.0000 1.5000 0.0000 Constraint 358 418 0.8000 1.0000 1.5000 0.0000 Constraint 358 410 0.8000 1.0000 1.5000 0.0000 Constraint 358 402 0.8000 1.0000 1.5000 0.0000 Constraint 358 391 0.8000 1.0000 1.5000 0.0000 Constraint 358 383 0.8000 1.0000 1.5000 0.0000 Constraint 358 374 0.8000 1.0000 1.5000 0.0000 Constraint 358 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 418 0.8000 1.0000 1.5000 0.0000 Constraint 350 410 0.8000 1.0000 1.5000 0.0000 Constraint 350 402 0.8000 1.0000 1.5000 0.0000 Constraint 350 391 0.8000 1.0000 1.5000 0.0000 Constraint 350 383 0.8000 1.0000 1.5000 0.0000 Constraint 350 374 0.8000 1.0000 1.5000 0.0000 Constraint 350 369 0.8000 1.0000 1.5000 0.0000 Constraint 350 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 491 0.8000 1.0000 1.5000 0.0000 Constraint 340 402 0.8000 1.0000 1.5000 0.0000 Constraint 340 391 0.8000 1.0000 1.5000 0.0000 Constraint 340 383 0.8000 1.0000 1.5000 0.0000 Constraint 340 374 0.8000 1.0000 1.5000 0.0000 Constraint 340 369 0.8000 1.0000 1.5000 0.0000 Constraint 340 358 0.8000 1.0000 1.5000 0.0000 Constraint 340 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 540 0.8000 1.0000 1.5000 0.0000 Constraint 329 517 0.8000 1.0000 1.5000 0.0000 Constraint 329 512 0.8000 1.0000 1.5000 0.0000 Constraint 329 502 0.8000 1.0000 1.5000 0.0000 Constraint 329 491 0.8000 1.0000 1.5000 0.0000 Constraint 329 483 0.8000 1.0000 1.5000 0.0000 Constraint 329 470 0.8000 1.0000 1.5000 0.0000 Constraint 329 455 0.8000 1.0000 1.5000 0.0000 Constraint 329 446 0.8000 1.0000 1.5000 0.0000 Constraint 329 410 0.8000 1.0000 1.5000 0.0000 Constraint 329 391 0.8000 1.0000 1.5000 0.0000 Constraint 329 383 0.8000 1.0000 1.5000 0.0000 Constraint 329 374 0.8000 1.0000 1.5000 0.0000 Constraint 329 369 0.8000 1.0000 1.5000 0.0000 Constraint 329 358 0.8000 1.0000 1.5000 0.0000 Constraint 329 350 0.8000 1.0000 1.5000 0.0000 Constraint 329 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 540 0.8000 1.0000 1.5000 0.0000 Constraint 324 517 0.8000 1.0000 1.5000 0.0000 Constraint 324 512 0.8000 1.0000 1.5000 0.0000 Constraint 324 491 0.8000 1.0000 1.5000 0.0000 Constraint 324 483 0.8000 1.0000 1.5000 0.0000 Constraint 324 470 0.8000 1.0000 1.5000 0.0000 Constraint 324 455 0.8000 1.0000 1.5000 0.0000 Constraint 324 446 0.8000 1.0000 1.5000 0.0000 Constraint 324 383 0.8000 1.0000 1.5000 0.0000 Constraint 324 374 0.8000 1.0000 1.5000 0.0000 Constraint 324 369 0.8000 1.0000 1.5000 0.0000 Constraint 324 358 0.8000 1.0000 1.5000 0.0000 Constraint 324 350 0.8000 1.0000 1.5000 0.0000 Constraint 324 340 0.8000 1.0000 1.5000 0.0000 Constraint 324 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 374 0.8000 1.0000 1.5000 0.0000 Constraint 319 369 0.8000 1.0000 1.5000 0.0000 Constraint 319 358 0.8000 1.0000 1.5000 0.0000 Constraint 319 350 0.8000 1.0000 1.5000 0.0000 Constraint 319 340 0.8000 1.0000 1.5000 0.0000 Constraint 319 329 0.8000 1.0000 1.5000 0.0000 Constraint 319 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 667 0.8000 1.0000 1.5000 0.0000 Constraint 312 491 0.8000 1.0000 1.5000 0.0000 Constraint 312 470 0.8000 1.0000 1.5000 0.0000 Constraint 312 455 0.8000 1.0000 1.5000 0.0000 Constraint 312 369 0.8000 1.0000 1.5000 0.0000 Constraint 312 358 0.8000 1.0000 1.5000 0.0000 Constraint 312 350 0.8000 1.0000 1.5000 0.0000 Constraint 312 340 0.8000 1.0000 1.5000 0.0000 Constraint 312 329 0.8000 1.0000 1.5000 0.0000 Constraint 312 324 0.8000 1.0000 1.5000 0.0000 Constraint 312 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 649 0.8000 1.0000 1.5000 0.0000 Constraint 306 491 0.8000 1.0000 1.5000 0.0000 Constraint 306 470 0.8000 1.0000 1.5000 0.0000 Constraint 306 455 0.8000 1.0000 1.5000 0.0000 Constraint 306 410 0.8000 1.0000 1.5000 0.0000 Constraint 306 358 0.8000 1.0000 1.5000 0.0000 Constraint 306 350 0.8000 1.0000 1.5000 0.0000 Constraint 306 340 0.8000 1.0000 1.5000 0.0000 Constraint 306 329 0.8000 1.0000 1.5000 0.0000 Constraint 306 324 0.8000 1.0000 1.5000 0.0000 Constraint 306 319 0.8000 1.0000 1.5000 0.0000 Constraint 306 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 649 0.8000 1.0000 1.5000 0.0000 Constraint 295 568 0.8000 1.0000 1.5000 0.0000 Constraint 295 517 0.8000 1.0000 1.5000 0.0000 Constraint 295 491 0.8000 1.0000 1.5000 0.0000 Constraint 295 470 0.8000 1.0000 1.5000 0.0000 Constraint 295 455 0.8000 1.0000 1.5000 0.0000 Constraint 295 446 0.8000 1.0000 1.5000 0.0000 Constraint 295 418 0.8000 1.0000 1.5000 0.0000 Constraint 295 410 0.8000 1.0000 1.5000 0.0000 Constraint 295 340 0.8000 1.0000 1.5000 0.0000 Constraint 295 329 0.8000 1.0000 1.5000 0.0000 Constraint 295 324 0.8000 1.0000 1.5000 0.0000 Constraint 295 319 0.8000 1.0000 1.5000 0.0000 Constraint 295 312 0.8000 1.0000 1.5000 0.0000 Constraint 295 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 649 0.8000 1.0000 1.5000 0.0000 Constraint 287 517 0.8000 1.0000 1.5000 0.0000 Constraint 287 491 0.8000 1.0000 1.5000 0.0000 Constraint 287 470 0.8000 1.0000 1.5000 0.0000 Constraint 287 455 0.8000 1.0000 1.5000 0.0000 Constraint 287 340 0.8000 1.0000 1.5000 0.0000 Constraint 287 329 0.8000 1.0000 1.5000 0.0000 Constraint 287 324 0.8000 1.0000 1.5000 0.0000 Constraint 287 319 0.8000 1.0000 1.5000 0.0000 Constraint 287 312 0.8000 1.0000 1.5000 0.0000 Constraint 287 306 0.8000 1.0000 1.5000 0.0000 Constraint 287 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 329 0.8000 1.0000 1.5000 0.0000 Constraint 280 324 0.8000 1.0000 1.5000 0.0000 Constraint 280 319 0.8000 1.0000 1.5000 0.0000 Constraint 280 312 0.8000 1.0000 1.5000 0.0000 Constraint 280 306 0.8000 1.0000 1.5000 0.0000 Constraint 280 295 0.8000 1.0000 1.5000 0.0000 Constraint 280 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 601 0.8000 1.0000 1.5000 0.0000 Constraint 274 593 0.8000 1.0000 1.5000 0.0000 Constraint 274 455 0.8000 1.0000 1.5000 0.0000 Constraint 274 324 0.8000 1.0000 1.5000 0.0000 Constraint 274 319 0.8000 1.0000 1.5000 0.0000 Constraint 274 312 0.8000 1.0000 1.5000 0.0000 Constraint 274 306 0.8000 1.0000 1.5000 0.0000 Constraint 274 295 0.8000 1.0000 1.5000 0.0000 Constraint 274 287 0.8000 1.0000 1.5000 0.0000 Constraint 274 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 601 0.8000 1.0000 1.5000 0.0000 Constraint 263 593 0.8000 1.0000 1.5000 0.0000 Constraint 263 319 0.8000 1.0000 1.5000 0.0000 Constraint 263 312 0.8000 1.0000 1.5000 0.0000 Constraint 263 306 0.8000 1.0000 1.5000 0.0000 Constraint 263 295 0.8000 1.0000 1.5000 0.0000 Constraint 263 287 0.8000 1.0000 1.5000 0.0000 Constraint 263 280 0.8000 1.0000 1.5000 0.0000 Constraint 263 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 312 0.8000 1.0000 1.5000 0.0000 Constraint 255 306 0.8000 1.0000 1.5000 0.0000 Constraint 255 295 0.8000 1.0000 1.5000 0.0000 Constraint 255 287 0.8000 1.0000 1.5000 0.0000 Constraint 255 280 0.8000 1.0000 1.5000 0.0000 Constraint 255 274 0.8000 1.0000 1.5000 0.0000 Constraint 255 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 601 0.8000 1.0000 1.5000 0.0000 Constraint 243 593 0.8000 1.0000 1.5000 0.0000 Constraint 243 306 0.8000 1.0000 1.5000 0.0000 Constraint 243 295 0.8000 1.0000 1.5000 0.0000 Constraint 243 287 0.8000 1.0000 1.5000 0.0000 Constraint 243 280 0.8000 1.0000 1.5000 0.0000 Constraint 243 274 0.8000 1.0000 1.5000 0.0000 Constraint 243 263 0.8000 1.0000 1.5000 0.0000 Constraint 243 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 295 0.8000 1.0000 1.5000 0.0000 Constraint 234 287 0.8000 1.0000 1.5000 0.0000 Constraint 234 280 0.8000 1.0000 1.5000 0.0000 Constraint 234 274 0.8000 1.0000 1.5000 0.0000 Constraint 234 263 0.8000 1.0000 1.5000 0.0000 Constraint 234 255 0.8000 1.0000 1.5000 0.0000 Constraint 234 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 601 0.8000 1.0000 1.5000 0.0000 Constraint 223 593 0.8000 1.0000 1.5000 0.0000 Constraint 223 584 0.8000 1.0000 1.5000 0.0000 Constraint 223 329 0.8000 1.0000 1.5000 0.0000 Constraint 223 324 0.8000 1.0000 1.5000 0.0000 Constraint 223 312 0.8000 1.0000 1.5000 0.0000 Constraint 223 306 0.8000 1.0000 1.5000 0.0000 Constraint 223 295 0.8000 1.0000 1.5000 0.0000 Constraint 223 287 0.8000 1.0000 1.5000 0.0000 Constraint 223 280 0.8000 1.0000 1.5000 0.0000 Constraint 223 274 0.8000 1.0000 1.5000 0.0000 Constraint 223 263 0.8000 1.0000 1.5000 0.0000 Constraint 223 255 0.8000 1.0000 1.5000 0.0000 Constraint 223 243 0.8000 1.0000 1.5000 0.0000 Constraint 223 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 601 0.8000 1.0000 1.5000 0.0000 Constraint 212 593 0.8000 1.0000 1.5000 0.0000 Constraint 212 584 0.8000 1.0000 1.5000 0.0000 Constraint 212 340 0.8000 1.0000 1.5000 0.0000 Constraint 212 329 0.8000 1.0000 1.5000 0.0000 Constraint 212 324 0.8000 1.0000 1.5000 0.0000 Constraint 212 312 0.8000 1.0000 1.5000 0.0000 Constraint 212 306 0.8000 1.0000 1.5000 0.0000 Constraint 212 295 0.8000 1.0000 1.5000 0.0000 Constraint 212 287 0.8000 1.0000 1.5000 0.0000 Constraint 212 280 0.8000 1.0000 1.5000 0.0000 Constraint 212 274 0.8000 1.0000 1.5000 0.0000 Constraint 212 263 0.8000 1.0000 1.5000 0.0000 Constraint 212 255 0.8000 1.0000 1.5000 0.0000 Constraint 212 243 0.8000 1.0000 1.5000 0.0000 Constraint 212 234 0.8000 1.0000 1.5000 0.0000 Constraint 212 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 601 0.8000 1.0000 1.5000 0.0000 Constraint 206 593 0.8000 1.0000 1.5000 0.0000 Constraint 206 584 0.8000 1.0000 1.5000 0.0000 Constraint 206 340 0.8000 1.0000 1.5000 0.0000 Constraint 206 329 0.8000 1.0000 1.5000 0.0000 Constraint 206 324 0.8000 1.0000 1.5000 0.0000 Constraint 206 312 0.8000 1.0000 1.5000 0.0000 Constraint 206 306 0.8000 1.0000 1.5000 0.0000 Constraint 206 295 0.8000 1.0000 1.5000 0.0000 Constraint 206 274 0.8000 1.0000 1.5000 0.0000 Constraint 206 263 0.8000 1.0000 1.5000 0.0000 Constraint 206 255 0.8000 1.0000 1.5000 0.0000 Constraint 206 243 0.8000 1.0000 1.5000 0.0000 Constraint 206 234 0.8000 1.0000 1.5000 0.0000 Constraint 206 223 0.8000 1.0000 1.5000 0.0000 Constraint 206 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 601 0.8000 1.0000 1.5000 0.0000 Constraint 197 593 0.8000 1.0000 1.5000 0.0000 Constraint 197 584 0.8000 1.0000 1.5000 0.0000 Constraint 197 340 0.8000 1.0000 1.5000 0.0000 Constraint 197 329 0.8000 1.0000 1.5000 0.0000 Constraint 197 324 0.8000 1.0000 1.5000 0.0000 Constraint 197 312 0.8000 1.0000 1.5000 0.0000 Constraint 197 306 0.8000 1.0000 1.5000 0.0000 Constraint 197 295 0.8000 1.0000 1.5000 0.0000 Constraint 197 263 0.8000 1.0000 1.5000 0.0000 Constraint 197 255 0.8000 1.0000 1.5000 0.0000 Constraint 197 243 0.8000 1.0000 1.5000 0.0000 Constraint 197 234 0.8000 1.0000 1.5000 0.0000 Constraint 197 223 0.8000 1.0000 1.5000 0.0000 Constraint 197 212 0.8000 1.0000 1.5000 0.0000 Constraint 197 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 601 0.8000 1.0000 1.5000 0.0000 Constraint 189 593 0.8000 1.0000 1.5000 0.0000 Constraint 189 584 0.8000 1.0000 1.5000 0.0000 Constraint 189 329 0.8000 1.0000 1.5000 0.0000 Constraint 189 255 0.8000 1.0000 1.5000 0.0000 Constraint 189 243 0.8000 1.0000 1.5000 0.0000 Constraint 189 234 0.8000 1.0000 1.5000 0.0000 Constraint 189 223 0.8000 1.0000 1.5000 0.0000 Constraint 189 212 0.8000 1.0000 1.5000 0.0000 Constraint 189 206 0.8000 1.0000 1.5000 0.0000 Constraint 189 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 243 0.8000 1.0000 1.5000 0.0000 Constraint 183 234 0.8000 1.0000 1.5000 0.0000 Constraint 183 223 0.8000 1.0000 1.5000 0.0000 Constraint 183 212 0.8000 1.0000 1.5000 0.0000 Constraint 183 206 0.8000 1.0000 1.5000 0.0000 Constraint 183 197 0.8000 1.0000 1.5000 0.0000 Constraint 183 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 601 0.8000 1.0000 1.5000 0.0000 Constraint 173 593 0.8000 1.0000 1.5000 0.0000 Constraint 173 234 0.8000 1.0000 1.5000 0.0000 Constraint 173 223 0.8000 1.0000 1.5000 0.0000 Constraint 173 212 0.8000 1.0000 1.5000 0.0000 Constraint 173 206 0.8000 1.0000 1.5000 0.0000 Constraint 173 197 0.8000 1.0000 1.5000 0.0000 Constraint 173 189 0.8000 1.0000 1.5000 0.0000 Constraint 173 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 691 0.8000 1.0000 1.5000 0.0000 Constraint 165 223 0.8000 1.0000 1.5000 0.0000 Constraint 165 212 0.8000 1.0000 1.5000 0.0000 Constraint 165 206 0.8000 1.0000 1.5000 0.0000 Constraint 165 197 0.8000 1.0000 1.5000 0.0000 Constraint 165 189 0.8000 1.0000 1.5000 0.0000 Constraint 165 183 0.8000 1.0000 1.5000 0.0000 Constraint 165 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 691 0.8000 1.0000 1.5000 0.0000 Constraint 157 680 0.8000 1.0000 1.5000 0.0000 Constraint 157 673 0.8000 1.0000 1.5000 0.0000 Constraint 157 223 0.8000 1.0000 1.5000 0.0000 Constraint 157 212 0.8000 1.0000 1.5000 0.0000 Constraint 157 206 0.8000 1.0000 1.5000 0.0000 Constraint 157 197 0.8000 1.0000 1.5000 0.0000 Constraint 157 189 0.8000 1.0000 1.5000 0.0000 Constraint 157 183 0.8000 1.0000 1.5000 0.0000 Constraint 157 173 0.8000 1.0000 1.5000 0.0000 Constraint 157 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 691 0.8000 1.0000 1.5000 0.0000 Constraint 146 212 0.8000 1.0000 1.5000 0.0000 Constraint 146 206 0.8000 1.0000 1.5000 0.0000 Constraint 146 197 0.8000 1.0000 1.5000 0.0000 Constraint 146 189 0.8000 1.0000 1.5000 0.0000 Constraint 146 183 0.8000 1.0000 1.5000 0.0000 Constraint 146 173 0.8000 1.0000 1.5000 0.0000 Constraint 146 165 0.8000 1.0000 1.5000 0.0000 Constraint 146 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 691 0.8000 1.0000 1.5000 0.0000 Constraint 130 680 0.8000 1.0000 1.5000 0.0000 Constraint 130 673 0.8000 1.0000 1.5000 0.0000 Constraint 130 667 0.8000 1.0000 1.5000 0.0000 Constraint 130 197 0.8000 1.0000 1.5000 0.0000 Constraint 130 189 0.8000 1.0000 1.5000 0.0000 Constraint 130 183 0.8000 1.0000 1.5000 0.0000 Constraint 130 173 0.8000 1.0000 1.5000 0.0000 Constraint 130 165 0.8000 1.0000 1.5000 0.0000 Constraint 130 157 0.8000 1.0000 1.5000 0.0000 Constraint 130 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 691 0.8000 1.0000 1.5000 0.0000 Constraint 117 680 0.8000 1.0000 1.5000 0.0000 Constraint 117 673 0.8000 1.0000 1.5000 0.0000 Constraint 117 667 0.8000 1.0000 1.5000 0.0000 Constraint 117 660 0.8000 1.0000 1.5000 0.0000 Constraint 117 649 0.8000 1.0000 1.5000 0.0000 Constraint 117 470 0.8000 1.0000 1.5000 0.0000 Constraint 117 455 0.8000 1.0000 1.5000 0.0000 Constraint 117 410 0.8000 1.0000 1.5000 0.0000 Constraint 117 391 0.8000 1.0000 1.5000 0.0000 Constraint 117 374 0.8000 1.0000 1.5000 0.0000 Constraint 117 223 0.8000 1.0000 1.5000 0.0000 Constraint 117 212 0.8000 1.0000 1.5000 0.0000 Constraint 117 206 0.8000 1.0000 1.5000 0.0000 Constraint 117 197 0.8000 1.0000 1.5000 0.0000 Constraint 117 183 0.8000 1.0000 1.5000 0.0000 Constraint 117 173 0.8000 1.0000 1.5000 0.0000 Constraint 117 165 0.8000 1.0000 1.5000 0.0000 Constraint 117 157 0.8000 1.0000 1.5000 0.0000 Constraint 117 146 0.8000 1.0000 1.5000 0.0000 Constraint 117 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 691 0.8000 1.0000 1.5000 0.0000 Constraint 110 680 0.8000 1.0000 1.5000 0.0000 Constraint 110 673 0.8000 1.0000 1.5000 0.0000 Constraint 110 667 0.8000 1.0000 1.5000 0.0000 Constraint 110 660 0.8000 1.0000 1.5000 0.0000 Constraint 110 649 0.8000 1.0000 1.5000 0.0000 Constraint 110 483 0.8000 1.0000 1.5000 0.0000 Constraint 110 470 0.8000 1.0000 1.5000 0.0000 Constraint 110 455 0.8000 1.0000 1.5000 0.0000 Constraint 110 418 0.8000 1.0000 1.5000 0.0000 Constraint 110 410 0.8000 1.0000 1.5000 0.0000 Constraint 110 391 0.8000 1.0000 1.5000 0.0000 Constraint 110 383 0.8000 1.0000 1.5000 0.0000 Constraint 110 374 0.8000 1.0000 1.5000 0.0000 Constraint 110 243 0.8000 1.0000 1.5000 0.0000 Constraint 110 234 0.8000 1.0000 1.5000 0.0000 Constraint 110 223 0.8000 1.0000 1.5000 0.0000 Constraint 110 212 0.8000 1.0000 1.5000 0.0000 Constraint 110 206 0.8000 1.0000 1.5000 0.0000 Constraint 110 197 0.8000 1.0000 1.5000 0.0000 Constraint 110 189 0.8000 1.0000 1.5000 0.0000 Constraint 110 183 0.8000 1.0000 1.5000 0.0000 Constraint 110 173 0.8000 1.0000 1.5000 0.0000 Constraint 110 165 0.8000 1.0000 1.5000 0.0000 Constraint 110 157 0.8000 1.0000 1.5000 0.0000 Constraint 110 146 0.8000 1.0000 1.5000 0.0000 Constraint 110 130 0.8000 1.0000 1.5000 0.0000 Constraint 110 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 691 0.8000 1.0000 1.5000 0.0000 Constraint 97 680 0.8000 1.0000 1.5000 0.0000 Constraint 97 673 0.8000 1.0000 1.5000 0.0000 Constraint 97 667 0.8000 1.0000 1.5000 0.0000 Constraint 97 660 0.8000 1.0000 1.5000 0.0000 Constraint 97 649 0.8000 1.0000 1.5000 0.0000 Constraint 97 491 0.8000 1.0000 1.5000 0.0000 Constraint 97 470 0.8000 1.0000 1.5000 0.0000 Constraint 97 391 0.8000 1.0000 1.5000 0.0000 Constraint 97 374 0.8000 1.0000 1.5000 0.0000 Constraint 97 223 0.8000 1.0000 1.5000 0.0000 Constraint 97 212 0.8000 1.0000 1.5000 0.0000 Constraint 97 206 0.8000 1.0000 1.5000 0.0000 Constraint 97 197 0.8000 1.0000 1.5000 0.0000 Constraint 97 189 0.8000 1.0000 1.5000 0.0000 Constraint 97 157 0.8000 1.0000 1.5000 0.0000 Constraint 97 146 0.8000 1.0000 1.5000 0.0000 Constraint 97 130 0.8000 1.0000 1.5000 0.0000 Constraint 97 117 0.8000 1.0000 1.5000 0.0000 Constraint 97 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 691 0.8000 1.0000 1.5000 0.0000 Constraint 86 680 0.8000 1.0000 1.5000 0.0000 Constraint 86 673 0.8000 1.0000 1.5000 0.0000 Constraint 86 667 0.8000 1.0000 1.5000 0.0000 Constraint 86 660 0.8000 1.0000 1.5000 0.0000 Constraint 86 512 0.8000 1.0000 1.5000 0.0000 Constraint 86 491 0.8000 1.0000 1.5000 0.0000 Constraint 86 470 0.8000 1.0000 1.5000 0.0000 Constraint 86 223 0.8000 1.0000 1.5000 0.0000 Constraint 86 212 0.8000 1.0000 1.5000 0.0000 Constraint 86 206 0.8000 1.0000 1.5000 0.0000 Constraint 86 197 0.8000 1.0000 1.5000 0.0000 Constraint 86 189 0.8000 1.0000 1.5000 0.0000 Constraint 86 146 0.8000 1.0000 1.5000 0.0000 Constraint 86 130 0.8000 1.0000 1.5000 0.0000 Constraint 86 117 0.8000 1.0000 1.5000 0.0000 Constraint 86 110 0.8000 1.0000 1.5000 0.0000 Constraint 86 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 691 0.8000 1.0000 1.5000 0.0000 Constraint 78 680 0.8000 1.0000 1.5000 0.0000 Constraint 78 673 0.8000 1.0000 1.5000 0.0000 Constraint 78 512 0.8000 1.0000 1.5000 0.0000 Constraint 78 491 0.8000 1.0000 1.5000 0.0000 Constraint 78 212 0.8000 1.0000 1.5000 0.0000 Constraint 78 197 0.8000 1.0000 1.5000 0.0000 Constraint 78 130 0.8000 1.0000 1.5000 0.0000 Constraint 78 117 0.8000 1.0000 1.5000 0.0000 Constraint 78 110 0.8000 1.0000 1.5000 0.0000 Constraint 78 97 0.8000 1.0000 1.5000 0.0000 Constraint 78 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 691 0.8000 1.0000 1.5000 0.0000 Constraint 68 680 0.8000 1.0000 1.5000 0.0000 Constraint 68 673 0.8000 1.0000 1.5000 0.0000 Constraint 68 512 0.8000 1.0000 1.5000 0.0000 Constraint 68 502 0.8000 1.0000 1.5000 0.0000 Constraint 68 491 0.8000 1.0000 1.5000 0.0000 Constraint 68 212 0.8000 1.0000 1.5000 0.0000 Constraint 68 206 0.8000 1.0000 1.5000 0.0000 Constraint 68 197 0.8000 1.0000 1.5000 0.0000 Constraint 68 189 0.8000 1.0000 1.5000 0.0000 Constraint 68 130 0.8000 1.0000 1.5000 0.0000 Constraint 68 117 0.8000 1.0000 1.5000 0.0000 Constraint 68 110 0.8000 1.0000 1.5000 0.0000 Constraint 68 97 0.8000 1.0000 1.5000 0.0000 Constraint 68 86 0.8000 1.0000 1.5000 0.0000 Constraint 68 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 512 0.8000 1.0000 1.5000 0.0000 Constraint 62 491 0.8000 1.0000 1.5000 0.0000 Constraint 62 197 0.8000 1.0000 1.5000 0.0000 Constraint 62 117 0.8000 1.0000 1.5000 0.0000 Constraint 62 110 0.8000 1.0000 1.5000 0.0000 Constraint 62 97 0.8000 1.0000 1.5000 0.0000 Constraint 62 86 0.8000 1.0000 1.5000 0.0000 Constraint 62 78 0.8000 1.0000 1.5000 0.0000 Constraint 62 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 559 0.8000 1.0000 1.5000 0.0000 Constraint 54 540 0.8000 1.0000 1.5000 0.0000 Constraint 54 533 0.8000 1.0000 1.5000 0.0000 Constraint 54 512 0.8000 1.0000 1.5000 0.0000 Constraint 54 502 0.8000 1.0000 1.5000 0.0000 Constraint 54 491 0.8000 1.0000 1.5000 0.0000 Constraint 54 295 0.8000 1.0000 1.5000 0.0000 Constraint 54 274 0.8000 1.0000 1.5000 0.0000 Constraint 54 263 0.8000 1.0000 1.5000 0.0000 Constraint 54 197 0.8000 1.0000 1.5000 0.0000 Constraint 54 173 0.8000 1.0000 1.5000 0.0000 Constraint 54 117 0.8000 1.0000 1.5000 0.0000 Constraint 54 110 0.8000 1.0000 1.5000 0.0000 Constraint 54 97 0.8000 1.0000 1.5000 0.0000 Constraint 54 86 0.8000 1.0000 1.5000 0.0000 Constraint 54 78 0.8000 1.0000 1.5000 0.0000 Constraint 54 68 0.8000 1.0000 1.5000 0.0000 Constraint 54 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 593 0.8000 1.0000 1.5000 0.0000 Constraint 43 568 0.8000 1.0000 1.5000 0.0000 Constraint 43 559 0.8000 1.0000 1.5000 0.0000 Constraint 43 540 0.8000 1.0000 1.5000 0.0000 Constraint 43 533 0.8000 1.0000 1.5000 0.0000 Constraint 43 517 0.8000 1.0000 1.5000 0.0000 Constraint 43 512 0.8000 1.0000 1.5000 0.0000 Constraint 43 502 0.8000 1.0000 1.5000 0.0000 Constraint 43 491 0.8000 1.0000 1.5000 0.0000 Constraint 43 295 0.8000 1.0000 1.5000 0.0000 Constraint 43 197 0.8000 1.0000 1.5000 0.0000 Constraint 43 117 0.8000 1.0000 1.5000 0.0000 Constraint 43 110 0.8000 1.0000 1.5000 0.0000 Constraint 43 97 0.8000 1.0000 1.5000 0.0000 Constraint 43 86 0.8000 1.0000 1.5000 0.0000 Constraint 43 78 0.8000 1.0000 1.5000 0.0000 Constraint 43 68 0.8000 1.0000 1.5000 0.0000 Constraint 43 62 0.8000 1.0000 1.5000 0.0000 Constraint 43 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 593 0.8000 1.0000 1.5000 0.0000 Constraint 36 568 0.8000 1.0000 1.5000 0.0000 Constraint 36 559 0.8000 1.0000 1.5000 0.0000 Constraint 36 540 0.8000 1.0000 1.5000 0.0000 Constraint 36 533 0.8000 1.0000 1.5000 0.0000 Constraint 36 512 0.8000 1.0000 1.5000 0.0000 Constraint 36 502 0.8000 1.0000 1.5000 0.0000 Constraint 36 491 0.8000 1.0000 1.5000 0.0000 Constraint 36 306 0.8000 1.0000 1.5000 0.0000 Constraint 36 295 0.8000 1.0000 1.5000 0.0000 Constraint 36 287 0.8000 1.0000 1.5000 0.0000 Constraint 36 274 0.8000 1.0000 1.5000 0.0000 Constraint 36 157 0.8000 1.0000 1.5000 0.0000 Constraint 36 117 0.8000 1.0000 1.5000 0.0000 Constraint 36 110 0.8000 1.0000 1.5000 0.0000 Constraint 36 97 0.8000 1.0000 1.5000 0.0000 Constraint 36 86 0.8000 1.0000 1.5000 0.0000 Constraint 36 78 0.8000 1.0000 1.5000 0.0000 Constraint 36 68 0.8000 1.0000 1.5000 0.0000 Constraint 36 62 0.8000 1.0000 1.5000 0.0000 Constraint 36 54 0.8000 1.0000 1.5000 0.0000 Constraint 36 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 601 0.8000 1.0000 1.5000 0.0000 Constraint 25 593 0.8000 1.0000 1.5000 0.0000 Constraint 25 584 0.8000 1.0000 1.5000 0.0000 Constraint 25 573 0.8000 1.0000 1.5000 0.0000 Constraint 25 568 0.8000 1.0000 1.5000 0.0000 Constraint 25 559 0.8000 1.0000 1.5000 0.0000 Constraint 25 551 0.8000 1.0000 1.5000 0.0000 Constraint 25 545 0.8000 1.0000 1.5000 0.0000 Constraint 25 540 0.8000 1.0000 1.5000 0.0000 Constraint 25 533 0.8000 1.0000 1.5000 0.0000 Constraint 25 526 0.8000 1.0000 1.5000 0.0000 Constraint 25 517 0.8000 1.0000 1.5000 0.0000 Constraint 25 512 0.8000 1.0000 1.5000 0.0000 Constraint 25 502 0.8000 1.0000 1.5000 0.0000 Constraint 25 491 0.8000 1.0000 1.5000 0.0000 Constraint 25 483 0.8000 1.0000 1.5000 0.0000 Constraint 25 306 0.8000 1.0000 1.5000 0.0000 Constraint 25 295 0.8000 1.0000 1.5000 0.0000 Constraint 25 287 0.8000 1.0000 1.5000 0.0000 Constraint 25 274 0.8000 1.0000 1.5000 0.0000 Constraint 25 173 0.8000 1.0000 1.5000 0.0000 Constraint 25 157 0.8000 1.0000 1.5000 0.0000 Constraint 25 130 0.8000 1.0000 1.5000 0.0000 Constraint 25 117 0.8000 1.0000 1.5000 0.0000 Constraint 25 110 0.8000 1.0000 1.5000 0.0000 Constraint 25 97 0.8000 1.0000 1.5000 0.0000 Constraint 25 86 0.8000 1.0000 1.5000 0.0000 Constraint 25 78 0.8000 1.0000 1.5000 0.0000 Constraint 25 68 0.8000 1.0000 1.5000 0.0000 Constraint 25 62 0.8000 1.0000 1.5000 0.0000 Constraint 25 54 0.8000 1.0000 1.5000 0.0000 Constraint 25 43 0.8000 1.0000 1.5000 0.0000 Constraint 25 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 601 0.8000 1.0000 1.5000 0.0000 Constraint 17 593 0.8000 1.0000 1.5000 0.0000 Constraint 17 584 0.8000 1.0000 1.5000 0.0000 Constraint 17 573 0.8000 1.0000 1.5000 0.0000 Constraint 17 568 0.8000 1.0000 1.5000 0.0000 Constraint 17 559 0.8000 1.0000 1.5000 0.0000 Constraint 17 545 0.8000 1.0000 1.5000 0.0000 Constraint 17 540 0.8000 1.0000 1.5000 0.0000 Constraint 17 533 0.8000 1.0000 1.5000 0.0000 Constraint 17 517 0.8000 1.0000 1.5000 0.0000 Constraint 17 512 0.8000 1.0000 1.5000 0.0000 Constraint 17 306 0.8000 1.0000 1.5000 0.0000 Constraint 17 295 0.8000 1.0000 1.5000 0.0000 Constraint 17 287 0.8000 1.0000 1.5000 0.0000 Constraint 17 117 0.8000 1.0000 1.5000 0.0000 Constraint 17 110 0.8000 1.0000 1.5000 0.0000 Constraint 17 97 0.8000 1.0000 1.5000 0.0000 Constraint 17 86 0.8000 1.0000 1.5000 0.0000 Constraint 17 78 0.8000 1.0000 1.5000 0.0000 Constraint 17 68 0.8000 1.0000 1.5000 0.0000 Constraint 17 62 0.8000 1.0000 1.5000 0.0000 Constraint 17 54 0.8000 1.0000 1.5000 0.0000 Constraint 17 43 0.8000 1.0000 1.5000 0.0000 Constraint 17 36 0.8000 1.0000 1.5000 0.0000 Constraint 17 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 691 0.8000 1.0000 1.5000 0.0000 Constraint 9 610 0.8000 1.0000 1.5000 0.0000 Constraint 9 601 0.8000 1.0000 1.5000 0.0000 Constraint 9 593 0.8000 1.0000 1.5000 0.0000 Constraint 9 584 0.8000 1.0000 1.5000 0.0000 Constraint 9 573 0.8000 1.0000 1.5000 0.0000 Constraint 9 568 0.8000 1.0000 1.5000 0.0000 Constraint 9 559 0.8000 1.0000 1.5000 0.0000 Constraint 9 551 0.8000 1.0000 1.5000 0.0000 Constraint 9 545 0.8000 1.0000 1.5000 0.0000 Constraint 9 540 0.8000 1.0000 1.5000 0.0000 Constraint 9 533 0.8000 1.0000 1.5000 0.0000 Constraint 9 526 0.8000 1.0000 1.5000 0.0000 Constraint 9 517 0.8000 1.0000 1.5000 0.0000 Constraint 9 512 0.8000 1.0000 1.5000 0.0000 Constraint 9 502 0.8000 1.0000 1.5000 0.0000 Constraint 9 491 0.8000 1.0000 1.5000 0.0000 Constraint 9 483 0.8000 1.0000 1.5000 0.0000 Constraint 9 312 0.8000 1.0000 1.5000 0.0000 Constraint 9 306 0.8000 1.0000 1.5000 0.0000 Constraint 9 295 0.8000 1.0000 1.5000 0.0000 Constraint 9 287 0.8000 1.0000 1.5000 0.0000 Constraint 9 274 0.8000 1.0000 1.5000 0.0000 Constraint 9 263 0.8000 1.0000 1.5000 0.0000 Constraint 9 197 0.8000 1.0000 1.5000 0.0000 Constraint 9 183 0.8000 1.0000 1.5000 0.0000 Constraint 9 173 0.8000 1.0000 1.5000 0.0000 Constraint 9 165 0.8000 1.0000 1.5000 0.0000 Constraint 9 157 0.8000 1.0000 1.5000 0.0000 Constraint 9 130 0.8000 1.0000 1.5000 0.0000 Constraint 9 117 0.8000 1.0000 1.5000 0.0000 Constraint 9 110 0.8000 1.0000 1.5000 0.0000 Constraint 9 97 0.8000 1.0000 1.5000 0.0000 Constraint 9 86 0.8000 1.0000 1.5000 0.0000 Constraint 9 78 0.8000 1.0000 1.5000 0.0000 Constraint 9 68 0.8000 1.0000 1.5000 0.0000 Constraint 9 62 0.8000 1.0000 1.5000 0.0000 Constraint 9 54 0.8000 1.0000 1.5000 0.0000 Constraint 9 43 0.8000 1.0000 1.5000 0.0000 Constraint 9 36 0.8000 1.0000 1.5000 0.0000 Constraint 9 25 0.8000 1.0000 1.5000 0.0000 Constraint 9 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 691 0.8000 1.0000 1.5000 0.0000 Constraint 3 615 0.8000 1.0000 1.5000 0.0000 Constraint 3 610 0.8000 1.0000 1.5000 0.0000 Constraint 3 601 0.8000 1.0000 1.5000 0.0000 Constraint 3 593 0.8000 1.0000 1.5000 0.0000 Constraint 3 584 0.8000 1.0000 1.5000 0.0000 Constraint 3 573 0.8000 1.0000 1.5000 0.0000 Constraint 3 568 0.8000 1.0000 1.5000 0.0000 Constraint 3 559 0.8000 1.0000 1.5000 0.0000 Constraint 3 551 0.8000 1.0000 1.5000 0.0000 Constraint 3 545 0.8000 1.0000 1.5000 0.0000 Constraint 3 540 0.8000 1.0000 1.5000 0.0000 Constraint 3 533 0.8000 1.0000 1.5000 0.0000 Constraint 3 526 0.8000 1.0000 1.5000 0.0000 Constraint 3 517 0.8000 1.0000 1.5000 0.0000 Constraint 3 512 0.8000 1.0000 1.5000 0.0000 Constraint 3 502 0.8000 1.0000 1.5000 0.0000 Constraint 3 491 0.8000 1.0000 1.5000 0.0000 Constraint 3 483 0.8000 1.0000 1.5000 0.0000 Constraint 3 463 0.8000 1.0000 1.5000 0.0000 Constraint 3 455 0.8000 1.0000 1.5000 0.0000 Constraint 3 446 0.8000 1.0000 1.5000 0.0000 Constraint 3 434 0.8000 1.0000 1.5000 0.0000 Constraint 3 427 0.8000 1.0000 1.5000 0.0000 Constraint 3 312 0.8000 1.0000 1.5000 0.0000 Constraint 3 306 0.8000 1.0000 1.5000 0.0000 Constraint 3 295 0.8000 1.0000 1.5000 0.0000 Constraint 3 287 0.8000 1.0000 1.5000 0.0000 Constraint 3 165 0.8000 1.0000 1.5000 0.0000 Constraint 3 157 0.8000 1.0000 1.5000 0.0000 Constraint 3 130 0.8000 1.0000 1.5000 0.0000 Constraint 3 117 0.8000 1.0000 1.5000 0.0000 Constraint 3 110 0.8000 1.0000 1.5000 0.0000 Constraint 3 97 0.8000 1.0000 1.5000 0.0000 Constraint 3 86 0.8000 1.0000 1.5000 0.0000 Constraint 3 68 0.8000 1.0000 1.5000 0.0000 Constraint 3 62 0.8000 1.0000 1.5000 0.0000 Constraint 3 54 0.8000 1.0000 1.5000 0.0000 Constraint 3 43 0.8000 1.0000 1.5000 0.0000 Constraint 3 36 0.8000 1.0000 1.5000 0.0000 Constraint 3 25 0.8000 1.0000 1.5000 0.0000 Constraint 3 17 0.8000 1.0000 1.5000 0.0000 Constraint 3 9 0.8000 1.0000 1.5000 0.0000 Done printing distance constraints # command: